3O7AA

Crystal structure of phf13 in complex with h3k4me3
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
52
structure length
52
Chain Sequence
b'SWDLVTCFCMKPFAGRPMIECNECHTWIHLSCAKIRKSNVPEVFVCQKCRDS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PHD finger protein 13 variant
publication title PHF13 is a molecular reader and transcriptional co-regulator of H3K4me2/3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 9
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2010-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3o7aA00
5AITA 2FUIA 2LGKA 3M99A 1WESA 4ZUXU 4FJCA 4UI9B 2KGGA 5LKZA 4AUQB 5JG6A 3L11A 5B77A 4MVTA 2MD7B 1VFYA 3NG2A 4XI1A 2QICA 5KH9A 5TABA 1JM7B 1K2FA 1BORA 2CT2A 3U5MA 1JM7A 2DX8A 3LQIA 4R2YA 4FIPA 4LLBA 3HCUA 5KH7A 5B78A 2K4DA 4L58A 4YC9A 2L43A 2KR4A 2VJEB 2XB1A 2K16A 3PURA 3T7LA 4YABA 2YQLA 2KREA 4LJNA 1LDKC 2VJEA 3KNVA 4GB0A 2KWNA 2VPGA 2I50A 2KU3A 2LQ6A 3FL2A 4R7EA 5LKUA 1F62A 1WEEA 2CSZA 2KYUA 5TDWA 4F52B 2VPEA 2LN0A 1WILA 5FERA 2KWKA 3C5KA 1VD4A 1U6GB 5H1UA 2L80A 4LKAA 4GNFA 4LK9A 3O70A 3ZVYA 4UP5A 3U5PA 1HYIA 3QZVA 2LRIC 2L0BA 2JMDA 5B75A 1X4UA 2LXHC 3RPGB 1FP0A 2MUMA 3O7AA 5AIUA 4BBQA 4S3OC 5C11A 3O36A 3RTRB 4YBMA 5C13A 4YBSA 3DQVR 2UZGA 2YSMA 1WFKA 3KV5A 1FBVA 3N9OA 2CKLB 4I7DA 5KH3A 1WENA 4A4BA 2JMJA 2CKLA 3HCTA 2G43A 2PNXA 4A4CA 4CA1A 2HDPA 2YSJA 3N9NA 3L1XA 4WA6A 1WEMA 3KQIA 1JOCA 2M85A 2KFTA 4IC3A 2YU4A 1HYJA 3EB6A 2C2LA 2MA6A 5D1KB 2MT5A 2MNYA 4A49A 4B86C 5TDRA 2YHNA 4PTBA 2EODA 2MNZA 4O64A 2YW8A 3N9QA 2F42A 1WEOA 2RSDA 2KGIA 2YT5A 3ZNIA 5H9MA 1Z6UA 2VPDA 1WEUA 2KWOA 4ZQLA 1WEQA 2MA5A 2RI7A 3ZTGA 2LGGA 4MSXA 3V43A 5DKAA 4V3KC 3VK6A 2KWJA 2K1JA 2VP7A 3DPLR 2FUUA 2FSAA 5G05B 1ZBDB 3L1ZB 3LQJA 2CSYA 2YHOA 5LKTA 2ECIA 3SOUA 3HTKC 5G04B 4AYCB 3O37A 2HYED 3SHBA 4AYCA 3PHDA 3M63A 4C9ZA 4I7BA 4X3GA 2ECWA 2JMIA 4FO9A 4YATA 2YQMA 5LKXA 2KE1A 2OXQC 5FEYA 2F6NA 5DINA 3MHHA 2M3HA 2F6JA 2D8SA 4ZDTA 4TKPB 1WEWA 3C6WA 1G25A 3O35A 3ZPVE 1MM3A 2IDAA 4AVXA 3U5NA 3ASLA 4BHWA 2JRJA 1MM2A 1WEVA 4S3OB 1DVPA 2LDRA 5G0FA 3LQHA 3KV6A 2VPBA 5TBNA 3I2DA 2BAYA 5FB0A 2E6RA 2QJ0A 2VJFB 1LDJB 3SOXA 4GNDA 2AN6A 2LGVA 5EYAF 5J3XA 1XWHA 2VJFA 5B8DA 4P5OB 5FB1A 4AP4A 4WZ2A 2K17A 4N4FA 3GL6A 1IYMA 3IHPA 3O34A 3LRQA 4YAXA 4NN2A 2E6SA 2YURA 5TRBA 4UP0A 4YADA 3PUQA 3N9LA 2XEUA 2EGPA 4CCGX 2L75A 5LCWB 4PPEA 1Z2QA 1RMDA 2QIZA 2C2VS 2YUCA 3O33A 4N3WA 5H1VA 4LADB 5D1MB 5B76A 4GNEA 4WZ3B 3M62A 1X4IA 2H0DB 3RPGC 4A0CD 4WZ0A 1WEPA 2ECVA 2ECNA 4IC2A 2ECTA 2ECJA 2EA6A 2H0DA 4V3LC 4FK5A 4W4UA 2ECGA 1X4JA 4QF3A 1N87A 2M6MA 2VNFA 2L5UA 1Z60A 5B79A 3SOWA 1WIMA 5H1TA 1V87A 2MIQA 2Y1NA 4Q6FA 4R8PK 2KIZA 3T6RA 2YYRA 3MHSA 3N9MA 4I7CA 2Y43A 2ZETC 1E4UA 4QF2A 3ZVZB 2LV9A 3HCSA 2M1RA 2MD8C 4L7XA 5D1LB 3ZYQA 2YREA 3GV4A 2LGLA 1CHCA 4YBTA 2Y1MA 2NAAA 2PUYA 3ZPV1 3N9PA 1WGMA 2LXPC 2G6QA 3EB5A 1VYXA 1T1HA 3U5OA 1WE9A 2G45A 4B7YC 5I3LA 4GNGA
chains in the Genus database with same CATH superfamily
2B0OE 5AITA 2FUIA 2LGKA 3M99A 1WESA 3O47A 4ZUXU 4FJCA 4UI9B 2KGGA 3LVQE 4AUQB 2L7PA 3L11A 5JG6A 5LKZA 3LVRE 5B77A 4MVTA 2MD7B 1VFYA 3NG2A 3T9KA 2E61A 4XI1A 2QICA 5KH9A 5TABA 1JM7B 1K2FA 1BORA 2CT2A 3U5MA 1JM7A 2DX8A 3LQIA 4R2YA 4FIPA 4LLBA 3HCUA 5KH7A 5B78A 2K4DA 4F1PA 4L58A 4YC9A 2L43A 4O62A 3LJUX 2OWAA 3M7KA 2KR4A 2VJEB 2XB1A 2K16A 3PURA 3T7LA 4YABA 2KKYA 2YQLA 2KREA 4LJNA 1LDKC 2VJEA 3KNVA 4GB0A 2KWNA 3Q1DA 2VPGA 2I50A 2KU3A 2LQ6A 3FL2A 4R7EA 5LKUA 4H9DA 1F62A 1WEEA 2CSZA 2KYUA 3H7HA 5TDWA 4F52B 2VPEA 2LN0A 4OGCA 1WILA 5FERA 2KWKA 2MKEA 3C5KA 1VD4A 1U6GB 5H1UA 3LDYA 2LAUA 2L80A 3FM8C 4LKAA 4GNFA 4LK9A 3O70A 3FEHA 3ZVYA 4UP5A 3U5PA 1HYIA 3QZVA 2LRIC 2L0BA 2JMDA 5B75A 1X4UA 3PLWA 2LXHC 1FP0A 2MUMA 3O7AA 5AIUA 3RPGB 4BBQA 4S3OC 5C11A 3O36A 3RTRB 4YBMA 5C13A 4OGEA 4YBSA 3FJUB 3DQVR 2UZGA 2YSMA 1WFKA 3KV5A 1FBVA 3N9OA 2CKLB 2JM3A 4I7DA 5KH3A 1WENA 4A4BA 2JMJA 2CKLA 3HCTA 2G43A 2PNXA 4Z0RA 4A4CA 4CA1A 2HDPA 2YSJA 3N9NA 3L1XA 2CRWA 4WA6A 1WEMA 3KQIA 2XP0A 1JOCA 2M85A 2KFTA 4IC3A 2YU4A 1HYJA 3EB6A 2C2LA 2MA6A 5D1KB 2MT5A 2MNYA 4A49A 4B86C 3JUEA 5TDRA 2YHNA 4PTBA 2EODA 2MNZA 2XOYA 4O64A 2YW8A 1MBMA 3N9QA 2F42A 1WEOA 2RSDA 2KGIA 2YT5A 3ZNIA 5H9MA 1Z6UA 2VPDA 1WEUA 2KWOA 4ZQLA 1WEQA 2MA5A 2RI7A 3ZTGA 3DWDA 2LGGA 4MSXA 3V43A 5DKAA 4V3KC 3VK6A 2KWJA 2K1JA 2VP7A 3DPLR 2FUUA 2FSAA 5G05B 2FFWA 1ZBDB 3L1ZB 3LQJA 2EXUA 2CSYA 2YHOA 5LKTA 2ECIA 3SOUA 3HTKC 5G04B 4AYCB 2JUNA 3O37A 2HYED 3SHBA 4AYCA 3PHDA 3M63A 4C9ZA 4I7BA 4X3GA 2ECWA 2JMIA 3MDBC 4FO9A 4YATA 2DJAA 2YQMA 5LKXA 2KE1A 2OXQC 5FEYA 2F6NA 5DINA 3SUBA 3MHHA 3FAOA 2M3HA 2F6JA 2D8SA 4ZDTA 4TKPB 1WEWA 2XOCA 3C6WA 1G25A 2CONA 3O35A 3ZPVE 1MM3A 2IDAA 4AVXA 3U5NA 3ASLA 4BHWA 2JRJA 1MM2A 2P57A 1WEVA 4S3OB 1DVPA 2FD4A 2LDRA 5G0FA 3LQHA 3KV6A 2VPBA 5TBNA 4Z0OA 3I2DA 2BAYA 5FB0A 2E6RA 2QJ0A 2VJFB 2M13A 2EGMA 1LDJB 3SOXA 4GNDA 2AN6A 2LGVA 5EYAF 5J3XA 1XWHA 2VJFA 5B8DA 4P5OB 5K3QA 5FB1A 4AP4A 1DCQA 2KKXA 2K17A 4WZ2A 4N4FA 3GL6A 1IYMA 3IHPA 3O34A 3LRQA 4YAXA 4NN2A 2E6SA 2YURA 5TRBA 4UP0A 4YADA 3PUQA 3E2DA 3N9LA 2XEUA 2EGPA 4CCGX 2L75A 5LCWB 4PPEA 1Z2QA 1RMDA 2XOZA 2QIZA 2C2VS 2YUCA 3O33A 4N3WA 5H1VA 4LADB 5D1MB 5B76A 4GNEA 4WZ3B 3M62A 1X4IA 2CSVA 2IQJA 2H0DB 3RPGC 4A0CD 4WZ0A 1WEPA 2ECVA 3DDTA 2YVRA 2ECNA 4IC2A 2ECTA 5SVYA 2ECJA 2EA6A 2H0DA 4V3LC 4FK5A 4W4UA 2ECGA 1X4JA 4QF3A 1N87A 2DSMA 2M6MA 2VNFA 2L5UA 1Z60A 5B79A 3SOWA 1WIMA 5H1TA 4QQ4A 3KDEC 1V87A 2MIQA 2Y1NA 4Q6FA 4R8PK 2KIZA 5SVXA 3T6RA 2RR4A 2YYRA 3MHSA 5SVIB 3N9MA 4I7CA 2Y43A 2ZETC 5SVIA 1E4UA 4QF2A 3ZVZB 2D8UA 2LV9A 3HCSA 2M1RA 2MD8C 4L7XA 5D1LB 3ZYQA 2YREA 3GV4A 2LGLA 1CHCA 4YBTA 2CRRA 2Y1MA 2NAAA 2PUYA 3ZPV1 3N9PA 1WGMA 2LXPC 2G6QA 3EB5A 1VYXA 1T1HA 3FANA 3U5OA 1WE9A 2G45A 4B7YC 5I3LA 4GNGA
chains in the Genus database with same CATH topology
5AITA 2FUIA 2LGKA 3M99A 1WESA 4ZUXU 4FJCA 4UI9B 2KGGA 5LKZA 4AUQB 5JG6A 3L11A 5B77A 4MVTA 2MD7B 1VFYA 3NG2A 4XI1A 2QICA 5KH9A 5TABA 1JM7B 1K2FA 1BORA 2CT2A 3U5MA 1JM7A 2DX8A 3LQIA 4R2YA 4FIPA 4LLBA 3HCUA 5KH7A 5B78A 2K4DA 4L58A 4YC9A 2L43A 2KR4A 2VJEB 2XB1A 2K16A 3PURA 3T7LA 4YABA 2YQLA 2KREA 4LJNA 1LDKC 2VJEA 3KNVA 4GB0A 2KWNA 2VPGA 2I50A 2KU3A 2LQ6A 3FL2A 4R7EA 5LKUA 1F62A 1WEEA 2CSZA 2KYUA 5TDWA 4F52B 2VPEA 2LN0A 1WILA 5FERA 2KWKA 3C5KA 1VD4A 1U6GB 5H1UA 2L80A 4LKAA 4GNFA 4LK9A 3O70A 3ZVYA 4UP5A 3U5PA 1HYIA 3QZVA 2LRIC 2L0BA 2JMDA 5B75A 1X4UA 2LXHC 3RPGB 1FP0A 2MUMA 3O7AA 5AIUA 4BBQA 4S3OC 5C11A 3O36A 3RTRB 4YBMA 5C13A 4YBSA 3DQVR 2UZGA 2YSMA 1WFKA 3KV5A 1FBVA 3N9OA 2CKLB 4I7DA 5KH3A 1WENA 4A4BA 2JMJA 2CKLA 3HCTA 2G43A 2PNXA 4A4CA 4CA1A 2HDPA 2YSJA 3N9NA 3L1XA 4WA6A 1WEMA 3KQIA 1JOCA 2M85A 2KFTA 4IC3A 2YU4A 1HYJA 3EB6A 2C2LA 2MA6A 5D1KB 2MT5A 2MNYA 4A49A 4B86C 5TDRA 2YHNA 4PTBA 2EODA 2MNZA 4O64A 2YW8A 3N9QA 2F42A 1WEOA 2RSDA 2KGIA 2YT5A 3ZNIA 5H9MA 1Z6UA 2VPDA 1WEUA 2KWOA 4ZQLA 1WEQA 2MA5A 2RI7A 3ZTGA 2LGGA 4MSXA 3V43A 5DKAA 4V3KC 3VK6A 2KWJA 2K1JA 2VP7A 3DPLR 2FUUA 2FSAA 5G05B 1ZBDB 3L1ZB 3LQJA 2CSYA 2YHOA 5LKTA 2ECIA 3SOUA 3HTKC 5G04B 4AYCB 3O37A 2HYED 3SHBA 4AYCA 3PHDA 3M63A 4C9ZA 4I7BA 4X3GA 2ECWA 2JMIA 4FO9A 4YATA 2YQMA 5LKXA 2KE1A 2OXQC 5FEYA 2F6NA 5DINA 3MHHA 2M3HA 2F6JA 2D8SA 4ZDTA 4TKPB 1WEWA 3C6WA 1G25A 3O35A 3ZPVE 1MM3A 2IDAA 4AVXA 3U5NA 3ASLA 4BHWA 2JRJA 1MM2A 1WEVA 4S3OB 1DVPA 2LDRA 5G0FA 3LQHA 3KV6A 2VPBA 5TBNA 3I2DA 2BAYA 5FB0A 2E6RA 2QJ0A 2VJFB 1LDJB 3SOXA 4GNDA 2AN6A 2LGVA 5EYAF 5J3XA 1XWHA 2VJFA 5B8DA 4P5OB 5FB1A 4AP4A 4WZ2A 2K17A 4N4FA 3GL6A 1IYMA 3IHPA 3O34A 3LRQA 4YAXA 4NN2A 2E6SA 2YURA 5TRBA 4UP0A 4YADA 3PUQA 3N9LA 2XEUA 2EGPA 4CCGX 2L75A 5LCWB 4PPEA 1Z2QA 1RMDA 2QIZA 2C2VS 2YUCA 3O33A 4N3WA 5H1VA 4LADB 5D1MB 5B76A 4GNEA 4WZ3B 3M62A 1X4IA 2H0DB 3RPGC 4A0CD 4WZ0A 1WEPA 2ECVA 2ECNA 4IC2A 2ECTA 2ECJA 2EA6A 2H0DA 4V3LC 4FK5A 4W4UA 2ECGA 1X4JA 4QF3A 1N87A 2M6MA 2VNFA 2L5UA 1Z60A 5B79A 3SOWA 1WIMA 5H1TA 1V87A 2MIQA 2Y1NA 4Q6FA 4R8PK 2KIZA 3T6RA 2YYRA 3MHSA 3N9MA 4I7CA 2Y43A 2ZETC 1E4UA 4QF2A 3ZVZB 2LV9A 3HCSA 2M1RA 2MD8C 4L7XA 5D1LB 3ZYQA 2YREA 3GV4A 2LGLA 1CHCA 4YBTA 2Y1MA 2NAAA 2PUYA 3ZPV1 3N9PA 1WGMA 2LXPC 2G6QA 3EB5A 1VYXA 1T1HA 3U5OA 1WE9A 2G45A 4B7YC 5I3LA 4GNGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AIT A;  2FUI A;  2LGK A;  3M99 A;  1WES A;  4ZUX U;  4FJC A;  4UI9 B;  2KGG A;  5LKZ A;  4AUQ B;  5JG6 A;  3L11 A;  5B77 A;  4MVT A;  2MD7 B;  1VFY A;  3NG2 A;  4XI1 A;  2QIC A;  5KH9 A;  5TAB A;  1JM7 B;  1K2F A;  1BOR A;  2CT2 A;  3U5M A;  1JM7 A;  2DX8 A;  3LQI A;  4R2Y A;  4FIP A;  4LLB A;  3HCU A;  5KH7 A;  5B78 A;  2K4D A;  4L58 A;  4YC9 A;  2L43 A;  2KR4 A;  2VJE B;  2XB1 A;  2K16 A;  3PUR A;  3T7L A;  4YAB A;  2YQL A;  2KRE A;  4LJN A;  1LDK C;  2VJE A;  3KNV A;  4GB0 A;  2KWN A;  2VPG A;  2I50 A;  2KU3 A;  2LQ6 A;  3FL2 A;  4R7E A;  5LKU A;  1F62 A;  1WEE A;  2CSZ A;  2KYU A;  5TDW A;  4F52 B;  2VPE A;  2LN0 A;  1WIL A;  5FER A;  2KWK A;  3C5K A;  1VD4 A;  1U6G B;  5H1U A;  2L80 A;  4LKA A;  4GNF A;  4LK9 A;  3O70 A;  3ZVY A;  4UP5 A;  3U5P A;  1HYI A;  3QZV A;  2LRI C;  2L0B A;  2JMD A;  5B75 A;  1X4U A;  2LXH C;  3RPG B;  1FP0 A;  2MUM A;  3O7A A;  5AIU A;  4BBQ A;  4S3O C;  5C11 A;  3O36 A;  3RTR B;  4YBM A;  5C13 A;  4YBS A;  3DQV R;  2UZG A;  2YSM A;  1WFK A;  3KV5 A;  1FBV A;  3N9O A;  2CKL B;  4I7D A;  5KH3 A;  1WEN A;  4A4B A;  2JMJ A;  2CKL A;  3HCT A;  2G43 A;  2PNX A;  4A4C A;  4CA1 A;  2HDP A;  2YSJ A;  3N9N A;  3L1X A;  4WA6 A;  1WEM A;  3KQI A;  1JOC A;  2M85 A;  2KFT A;  4IC3 A;  2YU4 A;  1HYJ A;  3EB6 A;  2C2L A;  2MA6 A;  5D1K B;  2MT5 A;  2MNY A;  4A49 A;  4B86 C;  5TDR A;  2YHN A;  4PTB A;  2EOD A;  2MNZ A;  4O64 A;  2YW8 A;  3N9Q A;  2F42 A;  1WEO A;  2RSD A;  2KGI A;  2YT5 A;  3ZNI A;  5H9M A;  1Z6U A;  2VPD A;  1WEU A;  2KWO A;  4ZQL A;  1WEQ A;  2MA5 A;  2RI7 A;  3ZTG A;  2LGG A;  4MSX A;  3V43 A;  5DKA A;  4V3K C;  3VK6 A;  2KWJ A;  2K1J A;  2VP7 A;  3DPL R;  2FUU A;  2FSA A;  5G05 B;  1ZBD B;  3L1Z B;  3LQJ A;  2CSY A;  2YHO A;  5LKT A;  2ECI A;  3SOU A;  3HTK C;  5G04 B;  4AYC B;  3O37 A;  2HYE D;  3SHB A;  4AYC A;  3PHD A;  3M63 A;  4C9Z A;  4I7B A;  4X3G A;  2ECW A;  2JMI A;  4FO9 A;  4YAT A;  2YQM A;  5LKX A;  2KE1 A;  2OXQ C;  5FEY A;  2F6N A;  5DIN A;  3MHH A;  2M3H A;  2F6J A;  2D8S A;  4ZDT A;  4TKP B;  1WEW A;  3C6W A;  1G25 A;  3O35 A;  3ZPV E;  1MM3 A;  2IDA A;  4AVX A;  3U5N A;  3ASL A;  4BHW A;  2JRJ A;  1MM2 A;  1WEV A;  4S3O B;  1DVP A;  2LDR A;  5G0F A;  3LQH A;  3KV6 A;  2VPB A;  5TBN A;  3I2D A;  2BAY A;  5FB0 A;  2E6R A;  2QJ0 A;  2VJF B;  1LDJ B;  3SOX A;  4GND A;  2AN6 A;  2LGV A;  5EYA F;  5J3X A;  1XWH A;  2VJF A;  5B8D A;  4P5O B;  5FB1 A;  4AP4 A;  4WZ2 A;  2K17 A;  4N4F A;  3GL6 A;  1IYM A;  3IHP A;  3O34 A;  3LRQ A;  4YAX A;  4NN2 A;  2E6S A;  2YUR A;  5TRB A;  4UP0 A;  4YAD A;  3PUQ A;  3N9L A;  2XEU A;  2EGP A;  4CCG X;  2L75 A;  5LCW B;  4PPE A;  1Z2Q A;  1RMD A;  2QIZ A;  2C2V S;  2YUC A;  3O33 A;  4N3W A;  5H1V A;  4LAD B;  5D1M B;  5B76 A;  4GNE A;  4WZ3 B;  3M62 A;  1X4I A;  2H0D B;  3RPG C;  4A0C D;  4WZ0 A;  1WEP A;  2ECV A;  2ECN A;  4IC2 A;  2ECT A;  2ECJ A;  2EA6 A;  2H0D A;  4V3L C;  4FK5 A;  4W4U A;  2ECG A;  1X4J A;  4QF3 A;  1N87 A;  2M6M A;  2VNF A;  2L5U A;  1Z60 A;  5B79 A;  3SOW A;  1WIM A;  5H1T A;  1V87 A;  2MIQ A;  2Y1N A;  4Q6F A;  4R8P K;  2KIZ A;  3T6R A;  2YYR A;  3MHS A;  3N9M A;  4I7C A;  2Y43 A;  2ZET C;  1E4U A;  4QF2 A;  3ZVZ B;  2LV9 A;  3HCS A;  2M1R A;  2MD8 C;  4L7X A;  5D1L B;  3ZYQ A;  2YRE A;  3GV4 A;  2LGL A;  1CHC A;  4YBT A;  2Y1M A;  2NAA A;  2PUY A;  3ZPV 1;  3N9P A;  1WGM A;  2LXP C;  2G6Q A;  3EB5 A;  1VYX A;  1T1H A;  3U5O A;  1WE9 A;  2G45 A;  4B7Y C;  5I3L A;  4GNG A; 
#chains in the Genus database with same CATH topology
 2B0O E;  5AIT A;  2FUI A;  2LGK A;  3M99 A;  1WES A;  3O47 A;  4ZUX U;  4FJC A;  4UI9 B;  2KGG A;  3LVQ E;  4AUQ B;  2L7P A;  3L11 A;  5JG6 A;  5LKZ A;  3LVR E;  5B77 A;  4MVT A;  2MD7 B;  1VFY A;  3NG2 A;  3T9K A;  2E61 A;  4XI1 A;  2QIC A;  5KH9 A;  5TAB A;  1JM7 B;  1K2F A;  1BOR A;  2CT2 A;  3U5M A;  1JM7 A;  2DX8 A;  3LQI A;  4R2Y A;  4FIP A;  4LLB A;  3HCU A;  5KH7 A;  5B78 A;  2K4D A;  4F1P A;  4L58 A;  4YC9 A;  2L43 A;  4O62 A;  3LJU X;  2OWA A;  3M7K A;  2KR4 A;  2VJE B;  2XB1 A;  2K16 A;  3PUR A;  3T7L A;  4YAB A;  2KKY A;  2YQL A;  2KRE A;  4LJN A;  1LDK C;  2VJE A;  3KNV A;  4GB0 A;  2KWN A;  3Q1D A;  2VPG A;  2I50 A;  2KU3 A;  2LQ6 A;  3FL2 A;  4R7E A;  5LKU A;  4H9D A;  1F62 A;  1WEE A;  2CSZ A;  2KYU A;  3H7H A;  5TDW A;  4F52 B;  2VPE A;  2LN0 A;  4OGC A;  1WIL A;  5FER A;  2KWK A;  2MKE A;  3C5K A;  1VD4 A;  1U6G B;  5H1U A;  3LDY A;  2LAU A;  2L80 A;  3FM8 C;  4LKA A;  4GNF A;  4LK9 A;  3O70 A;  3FEH A;  3ZVY A;  4UP5 A;  3U5P A;  1HYI A;  3QZV A;  2LRI C;  2L0B A;  2JMD A;  5B75 A;  1X4U A;  3PLW A;  2LXH C;  1FP0 A;  2MUM A;  3O7A A;  5AIU A;  3RPG B;  4BBQ A;  4S3O C;  5C11 A;  3O36 A;  3RTR B;  4YBM A;  5C13 A;  4OGE A;  4YBS A;  3FJU B;  3DQV R;  2UZG A;  2YSM A;  1WFK A;  3KV5 A;  1FBV A;  3N9O A;  2CKL B;  2JM3 A;  4I7D A;  5KH3 A;  1WEN A;  4A4B A;  2JMJ A;  2CKL A;  3HCT A;  2G43 A;  2PNX A;  4Z0R A;  4A4C A;  4CA1 A;  2HDP A;  2YSJ A;  3N9N A;  3L1X A;  2CRW A;  4WA6 A;  1WEM A;  3KQI A;  2XP0 A;  1JOC A;  2M85 A;  2KFT A;  4IC3 A;  2YU4 A;  1HYJ A;  3EB6 A;  2C2L A;  2MA6 A;  5D1K B;  2MT5 A;  2MNY A;  4A49 A;  4B86 C;  3JUE A;  5TDR A;  2YHN A;  4PTB A;  2EOD A;  2MNZ A;  2XOY A;  4O64 A;  2YW8 A;  1MBM A;  3N9Q A;  2F42 A;  1WEO A;  2RSD A;  2KGI A;  2YT5 A;  3ZNI A;  5H9M A;  1Z6U A;  2VPD A;  1WEU A;  2KWO A;  4ZQL A;  1WEQ A;  2MA5 A;  2RI7 A;  3ZTG A;  3DWD A;  2LGG A;  4MSX A;  3V43 A;  5DKA A;  4V3K C;  3VK6 A;  2KWJ A;  2K1J A;  2VP7 A;  3DPL R;  2FUU A;  2FSA A;  5G05 B;  2FFW A;  1ZBD B;  3L1Z B;  3LQJ A;  2EXU A;  2CSY A;  2YHO A;  5LKT A;  2ECI A;  3SOU A;  3HTK C;  5G04 B;  4AYC B;  2JUN A;  3O37 A;  2HYE D;  3SHB A;  4AYC A;  3PHD A;  3M63 A;  4C9Z A;  4I7B A;  4X3G A;  2ECW A;  2JMI A;  3MDB C;  4FO9 A;  4YAT A;  2DJA A;  2YQM A;  5LKX A;  2KE1 A;  2OXQ C;  5FEY A;  2F6N A;  5DIN A;  3SUB A;  3MHH A;  3FAO A;  2M3H A;  2F6J A;  2D8S A;  4ZDT A;  4TKP B;  1WEW A;  2XOC A;  3C6W A;  1G25 A;  2CON A;  3O35 A;  3ZPV E;  1MM3 A;  2IDA A;  4AVX A;  3U5N A;  3ASL A;  4BHW A;  2JRJ A;  1MM2 A;  2P57 A;  1WEV A;  4S3O B;  1DVP A;  2FD4 A;  2LDR A;  5G0F A;  3LQH A;  3KV6 A;  2VPB A;  5TBN A;  4Z0O A;  3I2D A;  2BAY A;  5FB0 A;  2E6R A;  2QJ0 A;  2VJF B;  2M13 A;  2EGM A;  1LDJ B;  3SOX A;  4GND A;  2AN6 A;  2LGV A;  5EYA F;  5J3X A;  1XWH A;  2VJF A;  5B8D A;  4P5O B;  5K3Q A;  5FB1 A;  4AP4 A;  1DCQ A;  2KKX A;  2K17 A;  4WZ2 A;  4N4F A;  3GL6 A;  1IYM A;  3IHP A;  3O34 A;  3LRQ A;  4YAX A;  4NN2 A;  2E6S A;  2YUR A;  5TRB A;  4UP0 A;  4YAD A;  3PUQ A;  3E2D A;  3N9L A;  2XEU A;  2EGP A;  4CCG X;  2L75 A;  5LCW B;  4PPE A;  1Z2Q A;  1RMD A;  2XOZ A;  2QIZ A;  2C2V S;  2YUC A;  3O33 A;  4N3W A;  5H1V A;  4LAD B;  5D1M B;  5B76 A;  4GNE A;  4WZ3 B;  3M62 A;  1X4I A;  2CSV A;  2IQJ A;  2H0D B;  3RPG C;  4A0C D;  4WZ0 A;  1WEP A;  2ECV A;  3DDT A;  2YVR A;  2ECN A;  4IC2 A;  2ECT A;  5SVY A;  2ECJ A;  2EA6 A;  2H0D A;  4V3L C;  4FK5 A;  4W4U A;  2ECG A;  1X4J A;  4QF3 A;  1N87 A;  2DSM A;  2M6M A;  2VNF A;  2L5U A;  1Z60 A;  5B79 A;  3SOW A;  1WIM A;  5H1T A;  4QQ4 A;  3KDE C;  1V87 A;  2MIQ A;  2Y1N A;  4Q6F A;  4R8P K;  2KIZ A;  5SVX A;  3T6R A;  2RR4 A;  2YYR A;  3MHS A;  5SVI B;  3N9M A;  4I7C A;  2Y43 A;  2ZET C;  5SVI A;  1E4U A;  4QF2 A;  3ZVZ B;  2D8U A;  2LV9 A;  3HCS A;  2M1R A;  2MD8 C;  4L7X A;  5D1L B;  3ZYQ A;  2YRE A;  3GV4 A;  2LGL A;  1CHC A;  4YBT A;  2CRR A;  2Y1M A;  2NAA A;  2PUY A;  3ZPV 1;  3N9P A;  1WGM A;  2LXP C;  2G6Q A;  3EB5 A;  1VYX A;  1T1H A;  3FAN A;  3U5O A;  1WE9 A;  2G45 A;  4B7Y C;  5I3L A;  4GNG A; 
#chains in the Genus database with same CATH homology
 5AIT A;  2FUI A;  2LGK A;  3M99 A;  1WES A;  4ZUX U;  4FJC A;  4UI9 B;  2KGG A;  5LKZ A;  4AUQ B;  5JG6 A;  3L11 A;  5B77 A;  4MVT A;  2MD7 B;  1VFY A;  3NG2 A;  4XI1 A;  2QIC A;  5KH9 A;  5TAB A;  1JM7 B;  1K2F A;  1BOR A;  2CT2 A;  3U5M A;  1JM7 A;  2DX8 A;  3LQI A;  4R2Y A;  4FIP A;  4LLB A;  3HCU A;  5KH7 A;  5B78 A;  2K4D A;  4L58 A;  4YC9 A;  2L43 A;  2KR4 A;  2VJE B;  2XB1 A;  2K16 A;  3PUR A;  3T7L A;  4YAB A;  2YQL A;  2KRE A;  4LJN A;  1LDK C;  2VJE A;  3KNV A;  4GB0 A;  2KWN A;  2VPG A;  2I50 A;  2KU3 A;  2LQ6 A;  3FL2 A;  4R7E A;  5LKU A;  1F62 A;  1WEE A;  2CSZ A;  2KYU A;  5TDW A;  4F52 B;  2VPE A;  2LN0 A;  1WIL A;  5FER A;  2KWK A;  3C5K A;  1VD4 A;  1U6G B;  5H1U A;  2L80 A;  4LKA A;  4GNF A;  4LK9 A;  3O70 A;  3ZVY A;  4UP5 A;  3U5P A;  1HYI A;  3QZV A;  2LRI C;  2L0B A;  2JMD A;  5B75 A;  1X4U A;  2LXH C;  3RPG B;  1FP0 A;  2MUM A;  3O7A A;  5AIU A;  4BBQ A;  4S3O C;  5C11 A;  3O36 A;  3RTR B;  4YBM A;  5C13 A;  4YBS A;  3DQV R;  2UZG A;  2YSM A;  1WFK A;  3KV5 A;  1FBV A;  3N9O A;  2CKL B;  4I7D A;  5KH3 A;  1WEN A;  4A4B A;  2JMJ A;  2CKL A;  3HCT A;  2G43 A;  2PNX A;  4A4C A;  4CA1 A;  2HDP A;  2YSJ A;  3N9N A;  3L1X A;  4WA6 A;  1WEM A;  3KQI A;  1JOC A;  2M85 A;  2KFT A;  4IC3 A;  2YU4 A;  1HYJ A;  3EB6 A;  2C2L A;  2MA6 A;  5D1K B;  2MT5 A;  2MNY A;  4A49 A;  4B86 C;  5TDR A;  2YHN A;  4PTB A;  2EOD A;  2MNZ A;  4O64 A;  2YW8 A;  3N9Q A;  2F42 A;  1WEO A;  2RSD A;  2KGI A;  2YT5 A;  3ZNI A;  5H9M A;  1Z6U A;  2VPD A;  1WEU A;  2KWO A;  4ZQL A;  1WEQ A;  2MA5 A;  2RI7 A;  3ZTG A;  2LGG A;  4MSX A;  3V43 A;  5DKA A;  4V3K C;  3VK6 A;  2KWJ A;  2K1J A;  2VP7 A;  3DPL R;  2FUU A;  2FSA A;  5G05 B;  1ZBD B;  3L1Z B;  3LQJ A;  2CSY A;  2YHO A;  5LKT A;  2ECI A;  3SOU A;  3HTK C;  5G04 B;  4AYC B;  3O37 A;  2HYE D;  3SHB A;  4AYC A;  3PHD A;  3M63 A;  4C9Z A;  4I7B A;  4X3G A;  2ECW A;  2JMI A;  4FO9 A;  4YAT A;  2YQM A;  5LKX A;  2KE1 A;  2OXQ C;  5FEY A;  2F6N A;  5DIN A;  3MHH A;  2M3H A;  2F6J A;  2D8S A;  4ZDT A;  4TKP B;  1WEW A;  3C6W A;  1G25 A;  3O35 A;  3ZPV E;  1MM3 A;  2IDA A;  4AVX A;  3U5N A;  3ASL A;  4BHW A;  2JRJ A;  1MM2 A;  1WEV A;  4S3O B;  1DVP A;  2LDR A;  5G0F A;  3LQH A;  3KV6 A;  2VPB A;  5TBN A;  3I2D A;  2BAY A;  5FB0 A;  2E6R A;  2QJ0 A;  2VJF B;  1LDJ B;  3SOX A;  4GND A;  2AN6 A;  2LGV A;  5EYA F;  5J3X A;  1XWH A;  2VJF A;  5B8D A;  4P5O B;  5FB1 A;  4AP4 A;  4WZ2 A;  2K17 A;  4N4F A;  3GL6 A;  1IYM A;  3IHP A;  3O34 A;  3LRQ A;  4YAX A;  4NN2 A;  2E6S A;  2YUR A;  5TRB A;  4UP0 A;  4YAD A;  3PUQ A;  3N9L A;  2XEU A;  2EGP A;  4CCG X;  2L75 A;  5LCW B;  4PPE A;  1Z2Q A;  1RMD A;  2QIZ A;  2C2V S;  2YUC A;  3O33 A;  4N3W A;  5H1V A;  4LAD B;  5D1M B;  5B76 A;  4GNE A;  4WZ3 B;  3M62 A;  1X4I A;  2H0D B;  3RPG C;  4A0C D;  4WZ0 A;  1WEP A;  2ECV A;  2ECN A;  4IC2 A;  2ECT A;  2ECJ A;  2EA6 A;  2H0D A;  4V3L C;  4FK5 A;  4W4U A;  2ECG A;  1X4J A;  4QF3 A;  1N87 A;  2M6M A;  2VNF A;  2L5U A;  1Z60 A;  5B79 A;  3SOW A;  1WIM A;  5H1T A;  1V87 A;  2MIQ A;  2Y1N A;  4Q6F A;  4R8P K;  2KIZ A;  3T6R A;  2YYR A;  3MHS A;  3N9M A;  4I7C A;  2Y43 A;  2ZET C;  1E4U A;  4QF2 A;  3ZVZ B;  2LV9 A;  3HCS A;  2M1R A;  2MD8 C;  4L7X A;  5D1L B;  3ZYQ A;  2YRE A;  3GV4 A;  2LGL A;  1CHC A;  4YBT A;  2Y1M A;  2NAA A;  2PUY A;  3ZPV 1;  3N9P A;  1WGM A;  2LXP C;  2G6Q A;  3EB5 A;  1VYX A;  1T1H A;  3U5O A;  1WE9 A;  2G45 A;  4B7Y C;  5I3L A;  4GNG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...