3O7AA

Crystal structure of phf13 in complex with h3k4me3
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
52
structure length
52
Chain Sequence
SWDLVTCFCMKPFAGRPMIECNECHTWIHLSCAKIRKSNVPEVFVCQKCRDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title PHF13 is a molecular reader and transcriptional co-regulator of H3K4me2/3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords PHD finger protein 13 variant
total genus 9
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2010-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3o7aA00
4CCGX 2H0DA 2G43A 2VPBA 4YBMA 1MM2A 1E4UA 4GNEA 4LADB 3LRQA 2UZGA 2YYRA 2YUCA 2I50A 3L1XA 2FUUA 2MNZA 2KGIA 2LQ6A 2RSDA 5FERA 1WE9A 3O33A 1ZBDB 2F6JA 1K2FA 2MNYA 1WEWA 2ECNA 2YURA 2EODA 1LDJB 5D1LB 1N87A 2VPGA 4R2YA 3LQHA 2ECTA 1F62A 4X3GA 4Q6FA 4A0CD 3KV5A 5B75A 2D8SA 2F42A 1HYIA 3MHHA 2QJ0A 2E6RA 2LXPC 2HYED 3L1ZB 1FP0A 1CHCA 4I7DA 3RPGC 5KH7A 4BHWA 5KH9A 2ECGA 2C2LA 3T6RA 3HCTA 5G0FA 4ZQLA 5C11A 1BORA 2ECJA 3U5PA 4WZ0A 5FB1A 4FIPA 4QF2A 3ZTGA 4AP4A 2M1RA 5H1VA 4YBTA 2VJEA 4F52B 4S3OB 3DQVR 5DINA 1IYMA 2F6NA 3HCSA 2OXQC 4NN2A 2ECVA 2RI7A 4YABA 3ZNIA 2K4DA 4L58A 4GNFA 2LGVA 3SOWA 5EYAF 1FBVA 4IC3A 2QIZA 3U5OA 2KU3A 2ECWA 4TKPB 2KREA 1X4IA 3ZPVE 2VPEA 2L0BA 4QF3A 3T7LA 2KFTA 3EB6A 4FJCA 5TABA 3PUQA 1WESA 4ZUXU 2K1JA 1WEPA 5LKXA 2MA5A 4YC9A 4YBSA 2VJFA 1U6GB 4WZ3B 5B77A 3DPLR 4PPEA 1VD4A 2YW8A 4I7CA 1WEVA 5AITA 3SOUA 2MIQA 1WILA 1Z6UA 2YSMA 3C6WA 5H1TA 2KWJA 4LJNA 2KR4A 1JM7B 4C9ZA 5J3XA 2CKLB 1Z2QA 3N9MA 4FK5A 2FSAA 4AUQB 4V3LC 2YHOA 3O36A 4LK9A 2M6MA 5B76A 2CT2A 5G04B 5B79A 3GV4A 3IHPA 4N3WA 3PHDA 2LN0A 5FEYA 3PURA 2YQMA 4W4UA 4ZDTA 2E6SA 2PNXA 2JRJA 2LDRA 4UP0A 2ECIA 3RTRB 2LGGA 4MVTA 2EGPA 3KV6A 2KE1A 2Y1NA 1VFYA 5FB0A 2L5UA 1WEQA 2C2VS 4YADA 2MD7B 4XI1A 3SOXA 2Y43A 4I7BA 4N4FA 2VJFB 3SHBA 5TDRA 5LKUA 2CKLA 2KGGA 2G45A 3I2DA 1X4UA 3M63A 2VPDA 3EB5A 1X4JA 2LGKA 5LCWB 1WENA 3N9NA 5D1MB 4LLBA 3KQIA 2YHNA 1WEEA 2VP7A 4MSXA 4GNDA 2HDPA 2L80A 3LQJA 4WA6A 3RPGB 1WEMA 4FO9A 2KWOA 2PUYA 4A4BA 4BBQA 2YSJA 3L11A 4LKAA 2VNFA 1V87A 3ZYQA 5TDWA 2LRIC 3M99A 2JMDA 1VYXA 5H9MA 2AN6A 4AYCB 5B8DA 3KNVA 5DKAA 2JMJA 2XB1A 3V43A 1JM7A 5D1KB 4UI9B 2VJEB 2L43A 3N9LA 1XWHA 2JMIA 3ZPV1 2KYUA 5LKTA 1HYJA 3ZVYA 1WGMA 5B78A 3LQIA 3MHSA 5H1UA 1JOCA 4R7EA 3U5MA 4V3KC 2CSZA 1G25A 4UP5A 5TRBA 2YT5A 3N9PA 2ZETC 3HCUA 5C13A 3N9OA 4B7YC 1MM3A 2FUIA 2MD8C 1WFKA 3O7AA 1DVPA 1T1HA 3NG2A 3ASLA 1WEUA 4PTBA 3C5KA 2LGLA 4O64A 3QZVA 4B86C 3O70A 5KH3A 2YREA 3GL6A 1Z60A 2YQLA 2NAAA 2K16A 5JG6A 2XEUA 2DX8A 4GB0A 2BAYA 4YATA 3N9QA 3HTKC 5LKZA 3O37A 3O34A 2CSYA 2K17A 5TBNA 5I3LA 1RMDA 2H0DB 3FL2A 4A4CA 2MT5A 4YAXA 3VK6A 4IC2A 2Y1MA 4WZ2A 2LV9A 5AIUA 2KWNA 4GNGA 2L75A 4P5OB 2M3HA 5G05B 3O35A 1WEOA 3U5NA 3ZVZB 1WIMA 2M85A 2KWKA 4A49A 1LDKC 2QICA 4S3OC 2MA6A 2G6QA 2LXHC 4CA1A 2YU4A 3M62A 2MUMA 2KIZA 4L7XA 4R8PK 2IDAA 4AVXA 2EA6A 4AYCA
chains in the Genus database with same CATH superfamily
4CCGX 2H0DA 2G43A 2VPBA 4YBMA 1MM2A 1E4UA 4GNEA 4LADB 3LRQA 1DCQA 2UZGA 2YYRA 2B0OE 2I50A 2YUCA 3L1XA 2FUUA 2MNZA 2KGIA 2LQ6A 2RSDA 5FERA 1WE9A 3O33A 1ZBDB 2F6JA 1K2FA 2MNYA 1WEWA 4OGCA 4OGEA 2ECNA 2YURA 2EODA 1LDJB 5D1LB 1N87A 2LAUA 2VPGA 4R2YA 3Q1DA 3LQHA 2ECTA 5SVYA 2CRWA 1F62A 3SUBA 4X3GA 4Q6FA 4A0CD 3KV5A 3FEHA 5B75A 2D8SA 2F42A 1HYIA 3MHHA 2QJ0A 2E6RA 2LXPC 2HYED 3L1ZB 1FP0A 1CHCA 2FFWA 4I7DA 3RPGC 5KH7A 4BHWA 5KH9A 2ECGA 2C2LA 3T6RA 3HCTA 5G0FA 4ZQLA 4H9DA 5C11A 1BORA 2ECJA 3U5PA 4WZ0A 5FB1A 4FIPA 4QF2A 3ZTGA 3PLWA 4AP4A 2CONA 2M1RA 5H1VA 4YBTA 2VJEA 4F52B 4S3OB 3DQVR 5DINA 1IYMA 2F6NA 3HCSA 2OXQC 4NN2A 2ECVA 2RI7A 4YABA 3ZNIA 2K4DA 4L58A 4GNFA 2EGMA 2LGVA 3SOWA 5EYAF 3MDBC 1FBVA 4IC3A 2QIZA 3U5OA 2RR4A 2KU3A 2ECWA 4TKPB 2KREA 1X4IA 3ZPVE 2VPEA 2E61A 2L0BA 4QF3A 3T7LA 2KFTA 3EB6A 4FJCA 5TABA 3PUQA 1WESA 4ZUXU 2K1JA 1WEPA 5LKXA 2MA5A 4YC9A 4YBSA 2VJFA 1U6GB 4WZ3B 5B77A 3DPLR 4PPEA 2CSVA 1VD4A 2YW8A 4I7CA 1WEVA 5AITA 3SOUA 2EXUA 2MIQA 1WILA 1Z6UA 2YSMA 3C6WA 5H1TA 2KWJA 4LJNA 2KR4A 1JM7B 4C9ZA 5J3XA 2CKLB 1Z2QA 3N9MA 4FK5A 2FSAA 4AUQB 2XOYA 4V3LC 2YHOA 3O36A 4LK9A 2M6MA 5B76A 2CT2A 5G04B 3GV4A 5B79A 3IHPA 4N3WA 3PHDA 2LN0A 5FEYA 3PURA 2YQMA 4W4UA 4ZDTA 2KKXA 2E6SA 2PNXA 2JRJA 2LDRA 4UP0A 2ECIA 3RTRB 2LGGA 4MVTA 2EGPA 3KV6A 2KE1A 2Y1NA 4F1PA 1VFYA 5FB0A 2L5UA 1WEQA 2C2VS 4YADA 2MD7B 4XI1A 2Y43A 3SOXA 4I7BA 4N4FA 2VJFB 2XOCA 2M13A 3SHBA 5TDRA 5LKUA 4O62A 2CKLA 2KGGA 2G45A 3I2DA 1X4UA 3M63A 2VPDA 3EB5A 5K3QA 1X4JA 2LGKA 5LCWB 1WENA 2P57A 3O47A 3N9NA 5D1MB 3LJUX 4LLBA 3M7KA 3KQIA 2YHNA 3FAOA 1WEEA 2MKEA 3T9KA 2VP7A 4MSXA 4GNDA 2HDPA 2L80A 3LQJA 2XP0A 3JUEA 2KKYA 3E2DA 2JM3A 4WA6A 3RPGB 1WEMA 4FO9A 2KWOA 2PUYA 1MBMA 4A4BA 4BBQA 2YSJA 3L11A 4LKAA 2VNFA 1V87A 2D8UA 2FD4A 5SVXA 5TDWA 3ZYQA 2LRIC 3M99A 2JMDA 1VYXA 5H9MA 2AN6A 4AYCB 5B8DA 3KNVA 5DKAA 2JMJA 2XB1A 3V43A 1JM7A 5D1KB 4UI9B 2IQJA 2VJEB 2L43A 3N9LA 1XWHA 5SVIB 2JMIA 4QQ4A 3ZPV1 2KYUA 3LDYA 2DJAA 5LKTA 3LVQE 1HYJA 3ZVYA 1WGMA 5B78A 3LQIA 3MHSA 5H1UA 1JOCA 2YVRA 4R7EA 3U5MA 4V3KC 2CSZA 1G25A 4UP5A 5TRBA 2YT5A 3N9PA 2DSMA 2XOZA 2ZETC 4Z0RA 3FANA 3HCUA 5C13A 3N9OA 4B7YC 1MM3A 2FUIA 3DWDA 2MD8C 1WFKA 3O7AA 1DVPA 1T1HA 3NG2A 3ASLA 1WEUA 4PTBA 3C5KA 2L7PA 2LGLA 4O64A 3QZVA 3KDEC 4B86C 3O70A 5KH3A 2YREA 3GL6A 5SVIA 1Z60A 2YQLA 2NAAA 2K16A 5JG6A 2XEUA 2DX8A 3H7HA 4GB0A 2BAYA 3DDTA 4YATA 3N9QA 3HTKC 5LKZA 3O37A 3FJUB 3O34A 2CSYA 3FM8C 2K17A 5TBNA 5I3LA 1RMDA 2H0DB 2JUNA 3FL2A 4A4CA 2MT5A 4YAXA 3VK6A 4IC2A 2Y1MA 3LVRE 4WZ2A 2LV9A 5AIUA 2KWNA 4GNGA 2L75A 4P5OB 2M3HA 5G05B 3O35A 1WEOA 3U5NA 3ZVZB 1WIMA 2M85A 2KWKA 4A49A 1LDKC 2QICA 4S3OC 4Z0OA 2CRRA 2MA6A 2G6QA 2LXHC 4CA1A 2OWAA 2YU4A 3M62A 2MUMA 2KIZA 4L7XA 4R8PK 2IDAA 4AVXA 2EA6A 4AYCA
chains in the Genus database with same CATH topology
4CCGX 2H0DA 2G43A 2VPBA 4YBMA 1MM2A 1E4UA 4GNEA 4LADB 3LRQA 2UZGA 2YYRA 2YUCA 2I50A 3L1XA 2FUUA 2MNZA 2KGIA 2LQ6A 2RSDA 5FERA 1WE9A 3O33A 1ZBDB 2F6JA 1K2FA 2MNYA 1WEWA 2ECNA 2YURA 2EODA 1LDJB 5D1LB 1N87A 2VPGA 4R2YA 3LQHA 2ECTA 1F62A 4X3GA 4Q6FA 4A0CD 3KV5A 5B75A 2D8SA 2F42A 1HYIA 3MHHA 2QJ0A 2E6RA 2LXPC 2HYED 3L1ZB 1FP0A 1CHCA 4I7DA 3RPGC 5KH7A 4BHWA 5KH9A 2ECGA 2C2LA 3T6RA 3HCTA 5G0FA 4ZQLA 5C11A 1BORA 2ECJA 3U5PA 4WZ0A 5FB1A 4FIPA 4QF2A 3ZTGA 4AP4A 2M1RA 5H1VA 4YBTA 2VJEA 4F52B 4S3OB 3DQVR 5DINA 1IYMA 2F6NA 3HCSA 2OXQC 4NN2A 2ECVA 2RI7A 4YABA 3ZNIA 2K4DA 4L58A 4GNFA 2LGVA 3SOWA 5EYAF 1FBVA 4IC3A 2QIZA 3U5OA 2KU3A 2ECWA 4TKPB 2KREA 1X4IA 3ZPVE 2VPEA 2L0BA 4QF3A 3T7LA 2KFTA 3EB6A 4FJCA 5TABA 3PUQA 1WESA 4ZUXU 2K1JA 1WEPA 5LKXA 2MA5A 4YC9A 4YBSA 2VJFA 1U6GB 4WZ3B 5B77A 3DPLR 4PPEA 1VD4A 2YW8A 4I7CA 1WEVA 5AITA 3SOUA 2MIQA 1WILA 1Z6UA 2YSMA 3C6WA 5H1TA 2KWJA 4LJNA 2KR4A 1JM7B 4C9ZA 5J3XA 2CKLB 1Z2QA 3N9MA 4FK5A 2FSAA 4AUQB 4V3LC 2YHOA 3O36A 4LK9A 2M6MA 5B76A 2CT2A 5G04B 5B79A 3GV4A 3IHPA 4N3WA 3PHDA 2LN0A 5FEYA 3PURA 2YQMA 4W4UA 4ZDTA 2E6SA 2PNXA 2JRJA 2LDRA 4UP0A 2ECIA 3RTRB 2LGGA 4MVTA 2EGPA 3KV6A 2KE1A 2Y1NA 1VFYA 5FB0A 2L5UA 1WEQA 2C2VS 4YADA 2MD7B 4XI1A 3SOXA 2Y43A 4I7BA 4N4FA 2VJFB 3SHBA 5TDRA 5LKUA 2CKLA 2KGGA 2G45A 3I2DA 1X4UA 3M63A 2VPDA 3EB5A 1X4JA 2LGKA 5LCWB 1WENA 3N9NA 5D1MB 4LLBA 3KQIA 2YHNA 1WEEA 2VP7A 4MSXA 4GNDA 2HDPA 2L80A 3LQJA 4WA6A 3RPGB 1WEMA 4FO9A 2KWOA 2PUYA 4A4BA 4BBQA 2YSJA 3L11A 4LKAA 2VNFA 1V87A 3ZYQA 5TDWA 2LRIC 3M99A 2JMDA 1VYXA 5H9MA 2AN6A 4AYCB 5B8DA 3KNVA 5DKAA 2JMJA 2XB1A 3V43A 1JM7A 5D1KB 4UI9B 2VJEB 2L43A 3N9LA 1XWHA 2JMIA 3ZPV1 2KYUA 5LKTA 1HYJA 3ZVYA 1WGMA 5B78A 3LQIA 3MHSA 5H1UA 1JOCA 4R7EA 3U5MA 4V3KC 2CSZA 1G25A 4UP5A 5TRBA 2YT5A 3N9PA 2ZETC 3HCUA 5C13A 3N9OA 4B7YC 1MM3A 2FUIA 2MD8C 1WFKA 3O7AA 1DVPA 1T1HA 3NG2A 3ASLA 1WEUA 4PTBA 3C5KA 2LGLA 4O64A 3QZVA 4B86C 3O70A 5KH3A 2YREA 3GL6A 1Z60A 2YQLA 2NAAA 2K16A 5JG6A 2XEUA 2DX8A 4GB0A 2BAYA 4YATA 3N9QA 3HTKC 5LKZA 3O37A 3O34A 2CSYA 2K17A 5TBNA 5I3LA 1RMDA 2H0DB 3FL2A 4A4CA 2MT5A 4YAXA 3VK6A 4IC2A 2Y1MA 4WZ2A 2LV9A 5AIUA 2KWNA 4GNGA 2L75A 4P5OB 2M3HA 5G05B 3O35A 1WEOA 3U5NA 3ZVZB 1WIMA 2M85A 2KWKA 4A49A 1LDKC 2QICA 4S3OC 2MA6A 2G6QA 2LXHC 4CA1A 2YU4A 3M62A 2MUMA 2KIZA 4L7XA 4R8PK 2IDAA 4AVXA 2EA6A 4AYCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CCG X;  2H0D A;  2G43 A;  2VPB A;  4YBM A;  1MM2 A;  1E4U A;  4GNE A;  4LAD B;  3LRQ A;  2UZG A;  2YYR A;  2YUC A;  2I50 A;  3L1X A;  2FUU A;  2MNZ A;  2KGI A;  2LQ6 A;  2RSD A;  5FER A;  1WE9 A;  3O33 A;  1ZBD B;  2F6J A;  1K2F A;  2MNY A;  1WEW A;  2ECN A;  2YUR A;  2EOD A;  1LDJ B;  5D1L B;  1N87 A;  2VPG A;  4R2Y A;  3LQH A;  2ECT A;  1F62 A;  4X3G A;  4Q6F A;  4A0C D;  3KV5 A;  5B75 A;  2D8S A;  2F42 A;  1HYI A;  3MHH A;  2QJ0 A;  2E6R A;  2LXP C;  2HYE D;  3L1Z B;  1FP0 A;  1CHC A;  4I7D A;  3RPG C;  5KH7 A;  4BHW A;  5KH9 A;  2ECG A;  2C2L A;  3T6R A;  3HCT A;  5G0F A;  4ZQL A;  5C11 A;  1BOR A;  2ECJ A;  3U5P A;  4WZ0 A;  5FB1 A;  4FIP A;  4QF2 A;  3ZTG A;  4AP4 A;  2M1R A;  5H1V A;  4YBT A;  2VJE A;  4F52 B;  4S3O B;  3DQV R;  5DIN A;  1IYM A;  2F6N A;  3HCS A;  2OXQ C;  4NN2 A;  2ECV A;  2RI7 A;  4YAB A;  3ZNI A;  2K4D A;  4L58 A;  4GNF A;  2LGV A;  3SOW A;  5EYA F;  1FBV A;  4IC3 A;  2QIZ A;  3U5O A;  2KU3 A;  2ECW A;  4TKP B;  2KRE A;  1X4I A;  3ZPV E;  2VPE A;  2L0B A;  4QF3 A;  3T7L A;  2KFT A;  3EB6 A;  4FJC A;  5TAB A;  3PUQ A;  1WES A;  4ZUX U;  2K1J A;  1WEP A;  5LKX A;  2MA5 A;  4YC9 A;  4YBS A;  2VJF A;  1U6G B;  4WZ3 B;  5B77 A;  3DPL R;  4PPE A;  1VD4 A;  2YW8 A;  4I7C A;  1WEV A;  5AIT A;  3SOU A;  2MIQ A;  1WIL A;  1Z6U A;  2YSM A;  3C6W A;  5H1T A;  2KWJ A;  4LJN A;  2KR4 A;  1JM7 B;  4C9Z A;  5J3X A;  2CKL B;  1Z2Q A;  3N9M A;  4FK5 A;  2FSA A;  4AUQ B;  4V3L C;  2YHO A;  3O36 A;  4LK9 A;  2M6M A;  5B76 A;  2CT2 A;  5G04 B;  5B79 A;  3GV4 A;  3IHP A;  4N3W A;  3PHD A;  2LN0 A;  5FEY A;  3PUR A;  2YQM A;  4W4U A;  4ZDT A;  2E6S A;  2PNX A;  2JRJ A;  2LDR A;  4UP0 A;  2ECI A;  3RTR B;  2LGG A;  4MVT A;  2EGP A;  3KV6 A;  2KE1 A;  2Y1N A;  1VFY A;  5FB0 A;  2L5U A;  1WEQ A;  2C2V S;  4YAD A;  2MD7 B;  4XI1 A;  3SOX A;  2Y43 A;  4I7B A;  4N4F A;  2VJF B;  3SHB A;  5TDR A;  5LKU A;  2CKL A;  2KGG A;  2G45 A;  3I2D A;  1X4U A;  3M63 A;  2VPD A;  3EB5 A;  1X4J A;  2LGK A;  5LCW B;  1WEN A;  3N9N A;  5D1M B;  4LLB A;  3KQI A;  2YHN A;  1WEE A;  2VP7 A;  4MSX A;  4GND A;  2HDP A;  2L80 A;  3LQJ A;  4WA6 A;  3RPG B;  1WEM A;  4FO9 A;  2KWO A;  2PUY A;  4A4B A;  4BBQ A;  2YSJ A;  3L11 A;  4LKA A;  2VNF A;  1V87 A;  3ZYQ A;  5TDW A;  2LRI C;  3M99 A;  2JMD A;  1VYX A;  5H9M A;  2AN6 A;  4AYC B;  5B8D A;  3KNV A;  5DKA A;  2JMJ A;  2XB1 A;  3V43 A;  1JM7 A;  5D1K B;  4UI9 B;  2VJE B;  2L43 A;  3N9L A;  1XWH A;  2JMI A;  3ZPV 1;  2KYU A;  5LKT A;  1HYJ A;  3ZVY A;  1WGM A;  5B78 A;  3LQI A;  3MHS A;  5H1U A;  1JOC A;  4R7E A;  3U5M A;  4V3K C;  2CSZ A;  1G25 A;  4UP5 A;  5TRB A;  2YT5 A;  3N9P A;  2ZET C;  3HCU A;  5C13 A;  3N9O A;  4B7Y C;  1MM3 A;  2FUI A;  2MD8 C;  1WFK A;  3O7A A;  1DVP A;  1T1H A;  3NG2 A;  3ASL A;  1WEU A;  4PTB A;  3C5K A;  2LGL A;  4O64 A;  3QZV A;  4B86 C;  3O70 A;  5KH3 A;  2YRE A;  3GL6 A;  1Z60 A;  2YQL A;  2NAA A;  2K16 A;  5JG6 A;  2XEU A;  2DX8 A;  4GB0 A;  2BAY A;  4YAT A;  3N9Q A;  3HTK C;  5LKZ A;  3O37 A;  3O34 A;  2CSY A;  2K17 A;  5TBN A;  5I3L A;  1RMD A;  2H0D B;  3FL2 A;  4A4C A;  2MT5 A;  4YAX A;  3VK6 A;  4IC2 A;  2Y1M A;  4WZ2 A;  2LV9 A;  5AIU A;  2KWN A;  4GNG A;  2L75 A;  4P5O B;  2M3H A;  5G05 B;  3O35 A;  1WEO A;  3U5N A;  3ZVZ B;  1WIM A;  2M85 A;  2KWK A;  4A49 A;  1LDK C;  2QIC A;  4S3O C;  2MA6 A;  2G6Q A;  2LXH C;  4CA1 A;  2YU4 A;  3M62 A;  2MUM A;  2KIZ A;  4L7X A;  4R8P K;  2IDA A;  4AVX A;  2EA6 A;  4AYC A; 
#chains in the Genus database with same CATH topology
 4CCG X;  2H0D A;  2G43 A;  2VPB A;  4YBM A;  1MM2 A;  1E4U A;  4GNE A;  4LAD B;  3LRQ A;  1DCQ A;  2UZG A;  2YYR A;  2B0O E;  2I50 A;  2YUC A;  3L1X A;  2FUU A;  2MNZ A;  2KGI A;  2LQ6 A;  2RSD A;  5FER A;  1WE9 A;  3O33 A;  1ZBD B;  2F6J A;  1K2F A;  2MNY A;  1WEW A;  4OGC A;  4OGE A;  2ECN A;  2YUR A;  2EOD A;  1LDJ B;  5D1L B;  1N87 A;  2LAU A;  2VPG A;  4R2Y A;  3Q1D A;  3LQH A;  2ECT A;  5SVY A;  2CRW A;  1F62 A;  3SUB A;  4X3G A;  4Q6F A;  4A0C D;  3KV5 A;  3FEH A;  5B75 A;  2D8S A;  2F42 A;  1HYI A;  3MHH A;  2QJ0 A;  2E6R A;  2LXP C;  2HYE D;  3L1Z B;  1FP0 A;  1CHC A;  2FFW A;  4I7D A;  3RPG C;  5KH7 A;  4BHW A;  5KH9 A;  2ECG A;  2C2L A;  3T6R A;  3HCT A;  5G0F A;  4ZQL A;  4H9D A;  5C11 A;  1BOR A;  2ECJ A;  3U5P A;  4WZ0 A;  5FB1 A;  4FIP A;  4QF2 A;  3ZTG A;  3PLW A;  4AP4 A;  2CON A;  2M1R A;  5H1V A;  4YBT A;  2VJE A;  4F52 B;  4S3O B;  3DQV R;  5DIN A;  1IYM A;  2F6N A;  3HCS A;  2OXQ C;  4NN2 A;  2ECV A;  2RI7 A;  4YAB A;  3ZNI A;  2K4D A;  4L58 A;  4GNF A;  2EGM A;  2LGV A;  3SOW A;  5EYA F;  3MDB C;  1FBV A;  4IC3 A;  2QIZ A;  3U5O A;  2RR4 A;  2KU3 A;  2ECW A;  4TKP B;  2KRE A;  1X4I A;  3ZPV E;  2VPE A;  2E61 A;  2L0B A;  4QF3 A;  3T7L A;  2KFT A;  3EB6 A;  4FJC A;  5TAB A;  3PUQ A;  1WES A;  4ZUX U;  2K1J A;  1WEP A;  5LKX A;  2MA5 A;  4YC9 A;  4YBS A;  2VJF A;  1U6G B;  4WZ3 B;  5B77 A;  3DPL R;  4PPE A;  2CSV A;  1VD4 A;  2YW8 A;  4I7C A;  1WEV A;  5AIT A;  3SOU A;  2EXU A;  2MIQ A;  1WIL A;  1Z6U A;  2YSM A;  3C6W A;  5H1T A;  2KWJ A;  4LJN A;  2KR4 A;  1JM7 B;  4C9Z A;  5J3X A;  2CKL B;  1Z2Q A;  3N9M A;  4FK5 A;  2FSA A;  4AUQ B;  2XOY A;  4V3L C;  2YHO A;  3O36 A;  4LK9 A;  2M6M A;  5B76 A;  2CT2 A;  5G04 B;  3GV4 A;  5B79 A;  3IHP A;  4N3W A;  3PHD A;  2LN0 A;  5FEY A;  3PUR A;  2YQM A;  4W4U A;  4ZDT A;  2KKX A;  2E6S A;  2PNX A;  2JRJ A;  2LDR A;  4UP0 A;  2ECI A;  3RTR B;  2LGG A;  4MVT A;  2EGP A;  3KV6 A;  2KE1 A;  2Y1N A;  4F1P A;  1VFY A;  5FB0 A;  2L5U A;  1WEQ A;  2C2V S;  4YAD A;  2MD7 B;  4XI1 A;  2Y43 A;  3SOX A;  4I7B A;  4N4F A;  2VJF B;  2XOC A;  2M13 A;  3SHB A;  5TDR A;  5LKU A;  4O62 A;  2CKL A;  2KGG A;  2G45 A;  3I2D A;  1X4U A;  3M63 A;  2VPD A;  3EB5 A;  5K3Q A;  1X4J A;  2LGK A;  5LCW B;  1WEN A;  2P57 A;  3O47 A;  3N9N A;  5D1M B;  3LJU X;  4LLB A;  3M7K A;  3KQI A;  2YHN A;  3FAO A;  1WEE A;  2MKE A;  3T9K A;  2VP7 A;  4MSX A;  4GND A;  2HDP A;  2L80 A;  3LQJ A;  2XP0 A;  3JUE A;  2KKY A;  3E2D A;  2JM3 A;  4WA6 A;  3RPG B;  1WEM A;  4FO9 A;  2KWO A;  2PUY A;  1MBM A;  4A4B A;  4BBQ A;  2YSJ A;  3L11 A;  4LKA A;  2VNF A;  1V87 A;  2D8U A;  2FD4 A;  5SVX A;  5TDW A;  3ZYQ A;  2LRI C;  3M99 A;  2JMD A;  1VYX A;  5H9M A;  2AN6 A;  4AYC B;  5B8D A;  3KNV A;  5DKA A;  2JMJ A;  2XB1 A;  3V43 A;  1JM7 A;  5D1K B;  4UI9 B;  2IQJ A;  2VJE B;  2L43 A;  3N9L A;  1XWH A;  5SVI B;  2JMI A;  4QQ4 A;  3ZPV 1;  2KYU A;  3LDY A;  2DJA A;  5LKT A;  3LVQ E;  1HYJ A;  3ZVY A;  1WGM A;  5B78 A;  3LQI A;  3MHS A;  5H1U A;  1JOC A;  2YVR A;  4R7E A;  3U5M A;  4V3K C;  2CSZ A;  1G25 A;  4UP5 A;  5TRB A;  2YT5 A;  3N9P A;  2DSM A;  2XOZ A;  2ZET C;  4Z0R A;  3FAN A;  3HCU A;  5C13 A;  3N9O A;  4B7Y C;  1MM3 A;  2FUI A;  3DWD A;  2MD8 C;  1WFK A;  3O7A A;  1DVP A;  1T1H A;  3NG2 A;  3ASL A;  1WEU A;  4PTB A;  3C5K A;  2L7P A;  2LGL A;  4O64 A;  3QZV A;  3KDE C;  4B86 C;  3O70 A;  5KH3 A;  2YRE A;  3GL6 A;  5SVI A;  1Z60 A;  2YQL A;  2NAA A;  2K16 A;  5JG6 A;  2XEU A;  2DX8 A;  3H7H A;  4GB0 A;  2BAY A;  3DDT A;  4YAT A;  3N9Q A;  3HTK C;  5LKZ A;  3O37 A;  3FJU B;  3O34 A;  2CSY A;  3FM8 C;  2K17 A;  5TBN A;  5I3L A;  1RMD A;  2H0D B;  2JUN A;  3FL2 A;  4A4C A;  2MT5 A;  4YAX A;  3VK6 A;  4IC2 A;  2Y1M A;  3LVR E;  4WZ2 A;  2LV9 A;  5AIU A;  2KWN A;  4GNG A;  2L75 A;  4P5O B;  2M3H A;  5G05 B;  3O35 A;  1WEO A;  3U5N A;  3ZVZ B;  1WIM A;  2M85 A;  2KWK A;  4A49 A;  1LDK C;  2QIC A;  4S3O C;  4Z0O A;  2CRR A;  2MA6 A;  2G6Q A;  2LXH C;  4CA1 A;  2OWA A;  2YU4 A;  3M62 A;  2MUM A;  2KIZ A;  4L7X A;  4R8P K;  2IDA A;  4AVX A;  2EA6 A;  4AYC A; 
#chains in the Genus database with same CATH homology
 4CCG X;  2H0D A;  2G43 A;  2VPB A;  4YBM A;  1MM2 A;  1E4U A;  4GNE A;  4LAD B;  3LRQ A;  2UZG A;  2YYR A;  2YUC A;  2I50 A;  3L1X A;  2FUU A;  2MNZ A;  2KGI A;  2LQ6 A;  2RSD A;  5FER A;  1WE9 A;  3O33 A;  1ZBD B;  2F6J A;  1K2F A;  2MNY A;  1WEW A;  2ECN A;  2YUR A;  2EOD A;  1LDJ B;  5D1L B;  1N87 A;  2VPG A;  4R2Y A;  3LQH A;  2ECT A;  1F62 A;  4X3G A;  4Q6F A;  4A0C D;  3KV5 A;  5B75 A;  2D8S A;  2F42 A;  1HYI A;  3MHH A;  2QJ0 A;  2E6R A;  2LXP C;  2HYE D;  3L1Z B;  1FP0 A;  1CHC A;  4I7D A;  3RPG C;  5KH7 A;  4BHW A;  5KH9 A;  2ECG A;  2C2L A;  3T6R A;  3HCT A;  5G0F A;  4ZQL A;  5C11 A;  1BOR A;  2ECJ A;  3U5P A;  4WZ0 A;  5FB1 A;  4FIP A;  4QF2 A;  3ZTG A;  4AP4 A;  2M1R A;  5H1V A;  4YBT A;  2VJE A;  4F52 B;  4S3O B;  3DQV R;  5DIN A;  1IYM A;  2F6N A;  3HCS A;  2OXQ C;  4NN2 A;  2ECV A;  2RI7 A;  4YAB A;  3ZNI A;  2K4D A;  4L58 A;  4GNF A;  2LGV A;  3SOW A;  5EYA F;  1FBV A;  4IC3 A;  2QIZ A;  3U5O A;  2KU3 A;  2ECW A;  4TKP B;  2KRE A;  1X4I A;  3ZPV E;  2VPE A;  2L0B A;  4QF3 A;  3T7L A;  2KFT A;  3EB6 A;  4FJC A;  5TAB A;  3PUQ A;  1WES A;  4ZUX U;  2K1J A;  1WEP A;  5LKX A;  2MA5 A;  4YC9 A;  4YBS A;  2VJF A;  1U6G B;  4WZ3 B;  5B77 A;  3DPL R;  4PPE A;  1VD4 A;  2YW8 A;  4I7C A;  1WEV A;  5AIT A;  3SOU A;  2MIQ A;  1WIL A;  1Z6U A;  2YSM A;  3C6W A;  5H1T A;  2KWJ A;  4LJN A;  2KR4 A;  1JM7 B;  4C9Z A;  5J3X A;  2CKL B;  1Z2Q A;  3N9M A;  4FK5 A;  2FSA A;  4AUQ B;  4V3L C;  2YHO A;  3O36 A;  4LK9 A;  2M6M A;  5B76 A;  2CT2 A;  5G04 B;  5B79 A;  3GV4 A;  3IHP A;  4N3W A;  3PHD A;  2LN0 A;  5FEY A;  3PUR A;  2YQM A;  4W4U A;  4ZDT A;  2E6S A;  2PNX A;  2JRJ A;  2LDR A;  4UP0 A;  2ECI A;  3RTR B;  2LGG A;  4MVT A;  2EGP A;  3KV6 A;  2KE1 A;  2Y1N A;  1VFY A;  5FB0 A;  2L5U A;  1WEQ A;  2C2V S;  4YAD A;  2MD7 B;  4XI1 A;  3SOX A;  2Y43 A;  4I7B A;  4N4F A;  2VJF B;  3SHB A;  5TDR A;  5LKU A;  2CKL A;  2KGG A;  2G45 A;  3I2D A;  1X4U A;  3M63 A;  2VPD A;  3EB5 A;  1X4J A;  2LGK A;  5LCW B;  1WEN A;  3N9N A;  5D1M B;  4LLB A;  3KQI A;  2YHN A;  1WEE A;  2VP7 A;  4MSX A;  4GND A;  2HDP A;  2L80 A;  3LQJ A;  4WA6 A;  3RPG B;  1WEM A;  4FO9 A;  2KWO A;  2PUY A;  4A4B A;  4BBQ A;  2YSJ A;  3L11 A;  4LKA A;  2VNF A;  1V87 A;  3ZYQ A;  5TDW A;  2LRI C;  3M99 A;  2JMD A;  1VYX A;  5H9M A;  2AN6 A;  4AYC B;  5B8D A;  3KNV A;  5DKA A;  2JMJ A;  2XB1 A;  3V43 A;  1JM7 A;  5D1K B;  4UI9 B;  2VJE B;  2L43 A;  3N9L A;  1XWH A;  2JMI A;  3ZPV 1;  2KYU A;  5LKT A;  1HYJ A;  3ZVY A;  1WGM A;  5B78 A;  3LQI A;  3MHS A;  5H1U A;  1JOC A;  4R7E A;  3U5M A;  4V3K C;  2CSZ A;  1G25 A;  4UP5 A;  5TRB A;  2YT5 A;  3N9P A;  2ZET C;  3HCU A;  5C13 A;  3N9O A;  4B7Y C;  1MM3 A;  2FUI A;  2MD8 C;  1WFK A;  3O7A A;  1DVP A;  1T1H A;  3NG2 A;  3ASL A;  1WEU A;  4PTB A;  3C5K A;  2LGL A;  4O64 A;  3QZV A;  4B86 C;  3O70 A;  5KH3 A;  2YRE A;  3GL6 A;  1Z60 A;  2YQL A;  2NAA A;  2K16 A;  5JG6 A;  2XEU A;  2DX8 A;  4GB0 A;  2BAY A;  4YAT A;  3N9Q A;  3HTK C;  5LKZ A;  3O37 A;  3O34 A;  2CSY A;  2K17 A;  5TBN A;  5I3L A;  1RMD A;  2H0D B;  3FL2 A;  4A4C A;  2MT5 A;  4YAX A;  3VK6 A;  4IC2 A;  2Y1M A;  4WZ2 A;  2LV9 A;  5AIU A;  2KWN A;  4GNG A;  2L75 A;  4P5O B;  2M3H A;  5G05 B;  3O35 A;  1WEO A;  3U5N A;  3ZVZ B;  1WIM A;  2M85 A;  2KWK A;  4A49 A;  1LDK C;  2QIC A;  4S3O C;  2MA6 A;  2G6Q A;  2LXH C;  4CA1 A;  2YU4 A;  3M62 A;  2MUM A;  2KIZ A;  4L7X A;  4R8P K;  2IDA A;  4AVX A;  2EA6 A;  4AYC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...