3O7AA

Crystal structure of phf13 in complex with h3k4me3
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
52
structure length
52
Chain Sequence
SWDLVTCFCMKPFAGRPMIECNECHTWIHLSCAKIRKSNVPEVFVCQKCRDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PHD finger protein 13 variant
publication title PHF13 is a molecular reader and transcriptional co-regulator of H3K4me2/3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 9
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2010-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3o7aA00
2L0BA 2MNZA 2C2VS 5C11A 2YHNA 4A0CD 2M3HA 5TDRA 4TKPB 1WEWA 2Y43A 4LK9A 1VD4A 4B7YC 2MIQA 1HYJA 1WEPA 3MHHA 5G05B 2VJEB 4V3LC 3ZPV1 3HTKC 2HYED 2KIZA 3M63A 1LDJB 4I7BA 4YBSA 3PURA 1VYXA 4A4CA 5LKXA 2E6RA 3T6RA 3VK6A 5LKUA 3M99A 4YBTA 1WFKA 5TABA 4X3GA 4QF3A 2VPDA 3U5NA 4IC3A 5D1MB 2NAAA 3LQJA 2CKLB 2XB1A 3N9MA 4GNGA 2ECJA 2L5UA 1JM7A 2K16A 4GB0A 4I7DA 2LRIC 5B75A 2LQ6A 3RTRB 3M62A 2L75A 4V3KC 2H0DB 1T1HA 3O7AA 3KQIA 3SOWA 5B8DA 3SHBA 3V43A 2KWNA 1FBVA 4BHWA 3O34A 3IHPA 4AYCB 5FB1A 2LGGA 5J3XA 2VNFA 1CHCA 2G6QA 5DINA 3QZVA 1VFYA 4NN2A 4PPEA 2RSDA 2LXPC 2YSJA 2FSAA 3L11A 2VPGA 2LDRA 4AUQB 2M1RA 5TBNA 5H1UA 3ZYQA 2YT5A 1JOCA 2JMDA 5B76A 2CKLA 5JG6A 5FERA 4A49A 4C9ZA 5H9MA 3L1XA 4ZQLA 2VP7A 1WIMA 3HCSA 2VPEA 3SOUA 1U6GB 2QJ0A 5D1LB 2VPBA 2PUYA 4UI9B 2M85A 5AIUA 1Z60A 3C5KA 1WILA 4S3OB 1HYIA 3O36A 2F42A 1WEUA 1MM2A 2YUCA 2F6JA 4F52B 2K1JA 4AYCA 2KYUA 2KU3A 4UP0A 2MNYA 4YC9A 4YADA 2CT2A 3U5PA 2G45A 1WENA 2KWOA 2LGVA 1MM3A 2F6NA 4MVTA 5D1KB 2OXQC 4R7EA 1X4JA 2EGPA 2D8SA 3DPLR 2BAYA 2XEUA 2VJFA 2KGGA 2YYRA 4XI1A 2QICA 1WEQA 3ZVZB 5C13A 4P5OB 2CSYA 2E6SA 2LXHC 4BBQA 2JRJA 4YBMA 1ZBDB 2ECNA 3KV5A 4CCGX 3C6WA 3O70A 3KNVA 1WEMA 2AN6A 1XWHA 2EODA 3I2DA 2LN0A 2LGKA 2YHOA 1V87A 5TDWA 2ECVA 2VJEA 4CA1A 1N87A 4N4FA 4B86C 1G25A 3N9OA 4LADB 4FO9A 2FUIA 2MUMA 2KGIA 4W4UA 3GL6A 5AITA 5I3LA 2YQLA 2L43A 3U5OA 2ZETC 2HDPA 2RI7A 3PUQA 3ASLA 2KFTA 4R2YA 5G0FA 4ZUXU 3N9QA 4LJNA 4GNEA 3DQVR 4FJCA 3FL2A 5H1TA 2YQMA 1FP0A 4FK5A 2ECWA 2LV9A 4ZDTA 2ECIA 1WE9A 2H0DA 5DKAA 2FUUA 5LKTA 1K2FA 1WEEA 4YAXA 3U5MA 2JMIA 5EYAF 1JM7B 2CSZA 3N9LA 4L7XA 4IC2A 5B79A 2JMJA 3LQIA 5B77A 3ZVYA 4WZ2A 3O35A 1DVPA 3RPGB 2L80A 2KE1A 3NG2A 4YABA 2MD7B 5KH7A 5FB0A 2PNXA 3N9NA 4A4BA 2K4DA 4AP4A 4I7CA 3ZPVE 1BORA 3HCUA 2IDAA 4UP5A 4L58A 2KWKA 1F62A 4FIPA 4YATA 4WZ3B 2YREA 5FEYA 2EA6A 3GV4A 2QIZA 2Y1NA 4LLBA 3SOXA 2LGLA 4QF2A 4LKAA 4R8PK 4O64A 2MT5A 2MA6A 3HCTA 3L1ZB 3LQHA 2M6MA 5G04B 2YURA 5TRBA 4GNFA 1Z6UA 2ECGA 5LCWB 3MHSA 1X4UA 4AVXA 2KREA 3T7LA 2UZGA 4S3OC 1WGMA 1Z2QA 4WA6A 2C2LA 2K17A 3EB6A 3ZTGA 1E4UA 2KR4A 3PHDA 5B78A 1IYMA 2YSMA 1RMDA 3RPGC 5H1VA 2ECTA 3KV6A 3O37A 4Q6FA 3N9PA 2KWJA 2DX8A 4GNDA 5KH9A 2MA5A 2I50A 3EB5A 4WZ0A 2MD8C 2Y1MA 2VJFB 1WEOA 4PTBA 1WESA 3O33A 3ZNIA 1WEVA 2G43A 3LRQA 2YW8A 4N3WA 4MSXA 5KH3A 1LDKC 2YU4A 1X4IA 5LKZA
chains in the Genus database with same CATH superfamily
2L0BA 2MNZA 2C2VS 5C11A 2YHNA 4A0CD 2M3HA 5TDRA 4TKPB 1WEWA 2L7PA 2Y43A 4LK9A 1VD4A 4B7YC 2MIQA 1HYJA 1WEPA 3SUBA 3MHHA 5G05B 2VJEB 4V3LC 3ZPV1 3HTKC 2HYED 2KIZA 3M63A 3LVQE 1LDJB 2RR4A 4I7BA 4YBSA 3PURA 1VYXA 4A4CA 5LKXA 2D8UA 2E6RA 3T6RA 3VK6A 5LKUA 3M99A 4YBTA 1WFKA 5TABA 4X3GA 4QF3A 2VPDA 2DSMA 3U5NA 3T9KA 4IC3A 5D1MB 2NAAA 3LQJA 2CKLB 2XB1A 3N9MA 2EGMA 4GNGA 2ECJA 2L5UA 1JM7A 2K16A 2JM3A 4GB0A 4I7DA 2LRIC 5B75A 2LQ6A 3RTRB 3M62A 2M13A 2L75A 4V3KC 2H0DB 1T1HA 3O7AA 3KQIA 5SVXA 3SOWA 5B8DA 3SHBA 3V43A 2KWNA 1FBVA 4BHWA 3DDTA 3O34A 3IHPA 4AYCB 2P57A 5FB1A 2LGGA 5J3XA 2VNFA 1CHCA 2G6QA 5DINA 3QZVA 1VFYA 4NN2A 4PPEA 2RSDA 2XOYA 2LXPC 2YSJA 2FSAA 3L11A 2B0OE 2VPGA 2LDRA 4F1PA 3FAOA 4AUQB 2M1RA 5TBNA 5H1UA 2DJAA 5SVIB 3ZYQA 2YT5A 1JOCA 2JMDA 5B76A 2CKLA 5JG6A 5FERA 4A49A 4C9ZA 5H9MA 3L1XA 4ZQLA 2CSVA 3LDYA 2VP7A 4Z0OA 1WIMA 3HCSA 2VPEA 3SOUA 1U6GB 2QJ0A 5D1LB 2VPBA 2PUYA 4UI9B 2M85A 5AIUA 1Z60A 3C5KA 1WILA 4S3OB 1HYIA 2KKXA 3O36A 2F42A 1WEUA 1MM2A 2YUCA 2F6JA 4F52B 2K1JA 4AYCA 2KYUA 2KU3A 4UP0A 2MNYA 4YC9A 4YADA 2CT2A 3U5PA 2G45A 1WENA 2KWOA 2LGVA 1MM3A 2XP0A 3FEHA 3FJUB 2EXUA 2F6NA 2YVRA 4MVTA 3MDBC 5D1KB 2OXQC 4R7EA 1X4JA 2EGPA 5SVIA 2D8SA 3M7KA 3DPLR 2BAYA 2XEUA 2VJFA 3FANA 2KGGA 2YYRA 4XI1A 2QICA 1WEQA 3FM8C 3ZVZB 5C13A 4P5OB 2CSYA 2E6SA 2LXHC 4BBQA 2JRJA 2OWAA 4YBMA 1ZBDB 2ECNA 3KV5A 4CCGX 3C6WA 3O70A 3KNVA 1WEMA 5SVYA 2AN6A 1XWHA 2EODA 3I2DA 2LN0A 2LGKA 2YHOA 3H7HA 1V87A 5TDWA 2ECVA 2VJEA 4CA1A 1N87A 4N4FA 2CONA 4B86C 1G25A 3N9OA 4LADB 4FO9A 2FUIA 2MUMA 2KGIA 4W4UA 3GL6A 5AITA 5I3LA 2YQLA 2L43A 3U5OA 2ZETC 2HDPA 2RI7A 3PUQA 3Q1DA 3ASLA 2KFTA 4R2YA 5G0FA 4ZUXU 3N9QA 4LJNA 4GNEA 3DQVR 4FJCA 3FL2A 5H1TA 2YQMA 1FP0A 4OGEA 4FK5A 2ECWA 2LV9A 4ZDTA 3LVRE 2ECIA 1WE9A 2H0DA 2MKEA 5DKAA 2FUUA 5LKTA 1K2FA 4OGCA 1WEEA 4YAXA 3U5MA 3KDEC 1MBMA 2JMIA 5EYAF 1JM7B 2CRWA 2CSZA 3N9LA 4L7XA 4IC2A 5B79A 2JMJA 3LQIA 5B77A 3ZVYA 4WZ2A 3O35A 1DVPA 4O62A 3RPGB 2L80A 2KE1A 3NG2A 4YABA 1DCQA 4H9DA 2MD7B 5KH7A 5FB0A 2PNXA 3N9NA 4A4BA 2K4DA 4AP4A 4I7CA 3ZPVE 1BORA 3HCUA 2IDAA 4UP5A 4L58A 2KWKA 1F62A 4FIPA 2CRRA 4YATA 4WZ3B 2YREA 5FEYA 2EA6A 3GV4A 3JUEA 2QIZA 2Y1NA 4LLBA 3SOXA 2LGLA 3PLWA 4QF2A 4LKAA 4R8PK 2KKYA 4O64A 4QQ4A 2MT5A 2MA6A 3HCTA 2LAUA 2IQJA 3L1ZB 3LQHA 2M6MA 5G04B 2YURA 5TRBA 4GNFA 1Z6UA 3O47A 2ECGA 4Z0RA 5LCWB 3MHSA 1X4UA 2JUNA 4AVXA 2KREA 3T7LA 2UZGA 4S3OC 1WGMA 1Z2QA 4WA6A 2C2LA 2K17A 5K3QA 3DWDA 3EB6A 3ZTGA 3LJUX 1E4UA 2KR4A 3PHDA 5B78A 1IYMA 2YSMA 1RMDA 3RPGC 5H1VA 2ECTA 2XOCA 3KV6A 3O37A 4Q6FA 3N9PA 2FFWA 2KWJA 2DX8A 2E61A 4GNDA 5KH9A 2MA5A 2XOZA 2I50A 3EB5A 4WZ0A 2MD8C 2Y1MA 2VJFB 1WEOA 4PTBA 1WESA 2FD4A 3O33A 3ZNIA 1WEVA 2G43A 3E2DA 3LRQA 2YW8A 4N3WA 4MSXA 5KH3A 1LDKC 2YU4A 1X4IA 5LKZA
chains in the Genus database with same CATH topology
2L0BA 2MNZA 2C2VS 5C11A 2YHNA 4A0CD 2M3HA 5TDRA 4TKPB 1WEWA 2Y43A 4LK9A 1VD4A 4B7YC 2MIQA 1HYJA 1WEPA 3MHHA 5G05B 2VJEB 4V3LC 3ZPV1 3HTKC 2HYED 2KIZA 3M63A 1LDJB 4I7BA 4YBSA 3PURA 1VYXA 4A4CA 5LKXA 2E6RA 3T6RA 3VK6A 5LKUA 3M99A 4YBTA 1WFKA 5TABA 4X3GA 4QF3A 2VPDA 3U5NA 4IC3A 5D1MB 2NAAA 3LQJA 2CKLB 2XB1A 3N9MA 4GNGA 2ECJA 2L5UA 1JM7A 2K16A 4GB0A 4I7DA 2LRIC 5B75A 2LQ6A 3RTRB 3M62A 2L75A 4V3KC 2H0DB 1T1HA 3O7AA 3KQIA 3SOWA 5B8DA 3SHBA 3V43A 2KWNA 1FBVA 4BHWA 3O34A 3IHPA 4AYCB 5FB1A 2LGGA 5J3XA 2VNFA 1CHCA 2G6QA 5DINA 3QZVA 1VFYA 4NN2A 4PPEA 2RSDA 2LXPC 2YSJA 2FSAA 3L11A 2VPGA 2LDRA 4AUQB 2M1RA 5TBNA 5H1UA 3ZYQA 2YT5A 1JOCA 2JMDA 5B76A 2CKLA 5JG6A 5FERA 4A49A 4C9ZA 5H9MA 3L1XA 4ZQLA 2VP7A 1WIMA 3HCSA 2VPEA 3SOUA 1U6GB 2QJ0A 5D1LB 2VPBA 2PUYA 4UI9B 2M85A 5AIUA 1Z60A 3C5KA 1WILA 4S3OB 1HYIA 3O36A 2F42A 1WEUA 1MM2A 2YUCA 2F6JA 4F52B 2K1JA 4AYCA 2KYUA 2KU3A 4UP0A 2MNYA 4YC9A 4YADA 2CT2A 3U5PA 2G45A 1WENA 2KWOA 2LGVA 1MM3A 2F6NA 4MVTA 5D1KB 2OXQC 4R7EA 1X4JA 2EGPA 2D8SA 3DPLR 2BAYA 2XEUA 2VJFA 2KGGA 2YYRA 4XI1A 2QICA 1WEQA 3ZVZB 5C13A 4P5OB 2CSYA 2E6SA 2LXHC 4BBQA 2JRJA 4YBMA 1ZBDB 2ECNA 3KV5A 4CCGX 3C6WA 3O70A 3KNVA 1WEMA 2AN6A 1XWHA 2EODA 3I2DA 2LN0A 2LGKA 2YHOA 1V87A 5TDWA 2ECVA 2VJEA 4CA1A 1N87A 4N4FA 4B86C 1G25A 3N9OA 4LADB 4FO9A 2FUIA 2MUMA 2KGIA 4W4UA 3GL6A 5AITA 5I3LA 2YQLA 2L43A 3U5OA 2ZETC 2HDPA 2RI7A 3PUQA 3ASLA 2KFTA 4R2YA 5G0FA 4ZUXU 3N9QA 4LJNA 4GNEA 3DQVR 4FJCA 3FL2A 5H1TA 2YQMA 1FP0A 4FK5A 2ECWA 2LV9A 4ZDTA 2ECIA 1WE9A 2H0DA 5DKAA 2FUUA 5LKTA 1K2FA 1WEEA 4YAXA 3U5MA 2JMIA 5EYAF 1JM7B 2CSZA 3N9LA 4L7XA 4IC2A 5B79A 2JMJA 3LQIA 5B77A 3ZVYA 4WZ2A 3O35A 1DVPA 3RPGB 2L80A 2KE1A 3NG2A 4YABA 2MD7B 5KH7A 5FB0A 2PNXA 3N9NA 4A4BA 2K4DA 4AP4A 4I7CA 3ZPVE 1BORA 3HCUA 2IDAA 4UP5A 4L58A 2KWKA 1F62A 4FIPA 4YATA 4WZ3B 2YREA 5FEYA 2EA6A 3GV4A 2QIZA 2Y1NA 4LLBA 3SOXA 2LGLA 4QF2A 4LKAA 4R8PK 4O64A 2MT5A 2MA6A 3HCTA 3L1ZB 3LQHA 2M6MA 5G04B 2YURA 5TRBA 4GNFA 1Z6UA 2ECGA 5LCWB 3MHSA 1X4UA 4AVXA 2KREA 3T7LA 2UZGA 4S3OC 1WGMA 1Z2QA 4WA6A 2C2LA 2K17A 3EB6A 3ZTGA 1E4UA 2KR4A 3PHDA 5B78A 1IYMA 2YSMA 1RMDA 3RPGC 5H1VA 2ECTA 3KV6A 3O37A 4Q6FA 3N9PA 2KWJA 2DX8A 4GNDA 5KH9A 2MA5A 2I50A 3EB5A 4WZ0A 2MD8C 2Y1MA 2VJFB 1WEOA 4PTBA 1WESA 3O33A 3ZNIA 1WEVA 2G43A 3LRQA 2YW8A 4N3WA 4MSXA 5KH3A 1LDKC 2YU4A 1X4IA 5LKZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L0B A;  2MNZ A;  2C2V S;  5C11 A;  2YHN A;  4A0C D;  2M3H A;  5TDR A;  4TKP B;  1WEW A;  2Y43 A;  4LK9 A;  1VD4 A;  4B7Y C;  2MIQ A;  1HYJ A;  1WEP A;  3MHH A;  5G05 B;  2VJE B;  4V3L C;  3ZPV 1;  3HTK C;  2HYE D;  2KIZ A;  3M63 A;  1LDJ B;  4I7B A;  4YBS A;  3PUR A;  1VYX A;  4A4C A;  5LKX A;  2E6R A;  3T6R A;  3VK6 A;  5LKU A;  3M99 A;  4YBT A;  1WFK A;  5TAB A;  4X3G A;  4QF3 A;  2VPD A;  3U5N A;  4IC3 A;  5D1M B;  2NAA A;  3LQJ A;  2CKL B;  2XB1 A;  3N9M A;  4GNG A;  2ECJ A;  2L5U A;  1JM7 A;  2K16 A;  4GB0 A;  4I7D A;  2LRI C;  5B75 A;  2LQ6 A;  3RTR B;  3M62 A;  2L75 A;  4V3K C;  2H0D B;  1T1H A;  3O7A A;  3KQI A;  3SOW A;  5B8D A;  3SHB A;  3V43 A;  2KWN A;  1FBV A;  4BHW A;  3O34 A;  3IHP A;  4AYC B;  5FB1 A;  2LGG A;  5J3X A;  2VNF A;  1CHC A;  2G6Q A;  5DIN A;  3QZV A;  1VFY A;  4NN2 A;  4PPE A;  2RSD A;  2LXP C;  2YSJ A;  2FSA A;  3L11 A;  2VPG A;  2LDR A;  4AUQ B;  2M1R A;  5TBN A;  5H1U A;  3ZYQ A;  2YT5 A;  1JOC A;  2JMD A;  5B76 A;  2CKL A;  5JG6 A;  5FER A;  4A49 A;  4C9Z A;  5H9M A;  3L1X A;  4ZQL A;  2VP7 A;  1WIM A;  3HCS A;  2VPE A;  3SOU A;  1U6G B;  2QJ0 A;  5D1L B;  2VPB A;  2PUY A;  4UI9 B;  2M85 A;  5AIU A;  1Z60 A;  3C5K A;  1WIL A;  4S3O B;  1HYI A;  3O36 A;  2F42 A;  1WEU A;  1MM2 A;  2YUC A;  2F6J A;  4F52 B;  2K1J A;  4AYC A;  2KYU A;  2KU3 A;  4UP0 A;  2MNY A;  4YC9 A;  4YAD A;  2CT2 A;  3U5P A;  2G45 A;  1WEN A;  2KWO A;  2LGV A;  1MM3 A;  2F6N A;  4MVT A;  5D1K B;  2OXQ C;  4R7E A;  1X4J A;  2EGP A;  2D8S A;  3DPL R;  2BAY A;  2XEU A;  2VJF A;  2KGG A;  2YYR A;  4XI1 A;  2QIC A;  1WEQ A;  3ZVZ B;  5C13 A;  4P5O B;  2CSY A;  2E6S A;  2LXH C;  4BBQ A;  2JRJ A;  4YBM A;  1ZBD B;  2ECN A;  3KV5 A;  4CCG X;  3C6W A;  3O70 A;  3KNV A;  1WEM A;  2AN6 A;  1XWH A;  2EOD A;  3I2D A;  2LN0 A;  2LGK A;  2YHO A;  1V87 A;  5TDW A;  2ECV A;  2VJE A;  4CA1 A;  1N87 A;  4N4F A;  4B86 C;  1G25 A;  3N9O A;  4LAD B;  4FO9 A;  2FUI A;  2MUM A;  2KGI A;  4W4U A;  3GL6 A;  5AIT A;  5I3L A;  2YQL A;  2L43 A;  3U5O A;  2ZET C;  2HDP A;  2RI7 A;  3PUQ A;  3ASL A;  2KFT A;  4R2Y A;  5G0F A;  4ZUX U;  3N9Q A;  4LJN A;  4GNE A;  3DQV R;  4FJC A;  3FL2 A;  5H1T A;  2YQM A;  1FP0 A;  4FK5 A;  2ECW A;  2LV9 A;  4ZDT A;  2ECI A;  1WE9 A;  2H0D A;  5DKA A;  2FUU A;  5LKT A;  1K2F A;  1WEE A;  4YAX A;  3U5M A;  2JMI A;  5EYA F;  1JM7 B;  2CSZ A;  3N9L A;  4L7X A;  4IC2 A;  5B79 A;  2JMJ A;  3LQI A;  5B77 A;  3ZVY A;  4WZ2 A;  3O35 A;  1DVP A;  3RPG B;  2L80 A;  2KE1 A;  3NG2 A;  4YAB A;  2MD7 B;  5KH7 A;  5FB0 A;  2PNX A;  3N9N A;  4A4B A;  2K4D A;  4AP4 A;  4I7C A;  3ZPV E;  1BOR A;  3HCU A;  2IDA A;  4UP5 A;  4L58 A;  2KWK A;  1F62 A;  4FIP A;  4YAT A;  4WZ3 B;  2YRE A;  5FEY A;  2EA6 A;  3GV4 A;  2QIZ A;  2Y1N A;  4LLB A;  3SOX A;  2LGL A;  4QF2 A;  4LKA A;  4R8P K;  4O64 A;  2MT5 A;  2MA6 A;  3HCT A;  3L1Z B;  3LQH A;  2M6M A;  5G04 B;  2YUR A;  5TRB A;  4GNF A;  1Z6U A;  2ECG A;  5LCW B;  3MHS A;  1X4U A;  4AVX A;  2KRE A;  3T7L A;  2UZG A;  4S3O C;  1WGM A;  1Z2Q A;  4WA6 A;  2C2L A;  2K17 A;  3EB6 A;  3ZTG A;  1E4U A;  2KR4 A;  3PHD A;  5B78 A;  1IYM A;  2YSM A;  1RMD A;  3RPG C;  5H1V A;  2ECT A;  3KV6 A;  3O37 A;  4Q6F A;  3N9P A;  2KWJ A;  2DX8 A;  4GND A;  5KH9 A;  2MA5 A;  2I50 A;  3EB5 A;  4WZ0 A;  2MD8 C;  2Y1M A;  2VJF B;  1WEO A;  4PTB A;  1WES A;  3O33 A;  3ZNI A;  1WEV A;  2G43 A;  3LRQ A;  2YW8 A;  4N3W A;  4MSX A;  5KH3 A;  1LDK C;  2YU4 A;  1X4I A;  5LKZ A; 
#chains in the Genus database with same CATH topology
 2L0B A;  2MNZ A;  2C2V S;  5C11 A;  2YHN A;  4A0C D;  2M3H A;  5TDR A;  4TKP B;  1WEW A;  2L7P A;  2Y43 A;  4LK9 A;  1VD4 A;  4B7Y C;  2MIQ A;  1HYJ A;  1WEP A;  3SUB A;  3MHH A;  5G05 B;  2VJE B;  4V3L C;  3ZPV 1;  3HTK C;  2HYE D;  2KIZ A;  3M63 A;  3LVQ E;  1LDJ B;  2RR4 A;  4I7B A;  4YBS A;  3PUR A;  1VYX A;  4A4C A;  5LKX A;  2D8U A;  2E6R A;  3T6R A;  3VK6 A;  5LKU A;  3M99 A;  4YBT A;  1WFK A;  5TAB A;  4X3G A;  4QF3 A;  2VPD A;  2DSM A;  3U5N A;  3T9K A;  4IC3 A;  5D1M B;  2NAA A;  3LQJ A;  2CKL B;  2XB1 A;  3N9M A;  2EGM A;  4GNG A;  2ECJ A;  2L5U A;  1JM7 A;  2K16 A;  2JM3 A;  4GB0 A;  4I7D A;  2LRI C;  5B75 A;  2LQ6 A;  3RTR B;  3M62 A;  2M13 A;  2L75 A;  4V3K C;  2H0D B;  1T1H A;  3O7A A;  3KQI A;  5SVX A;  3SOW A;  5B8D A;  3SHB A;  3V43 A;  2KWN A;  1FBV A;  4BHW A;  3DDT A;  3O34 A;  3IHP A;  4AYC B;  2P57 A;  5FB1 A;  2LGG A;  5J3X A;  2VNF A;  1CHC A;  2G6Q A;  5DIN A;  3QZV A;  1VFY A;  4NN2 A;  4PPE A;  2RSD A;  2XOY A;  2LXP C;  2YSJ A;  2FSA A;  3L11 A;  2B0O E;  2VPG A;  2LDR A;  4F1P A;  3FAO A;  4AUQ B;  2M1R A;  5TBN A;  5H1U A;  2DJA A;  5SVI B;  3ZYQ A;  2YT5 A;  1JOC A;  2JMD A;  5B76 A;  2CKL A;  5JG6 A;  5FER A;  4A49 A;  4C9Z A;  5H9M A;  3L1X A;  4ZQL A;  2CSV A;  3LDY A;  2VP7 A;  4Z0O A;  1WIM A;  3HCS A;  2VPE A;  3SOU A;  1U6G B;  2QJ0 A;  5D1L B;  2VPB A;  2PUY A;  4UI9 B;  2M85 A;  5AIU A;  1Z60 A;  3C5K A;  1WIL A;  4S3O B;  1HYI A;  2KKX A;  3O36 A;  2F42 A;  1WEU A;  1MM2 A;  2YUC A;  2F6J A;  4F52 B;  2K1J A;  4AYC A;  2KYU A;  2KU3 A;  4UP0 A;  2MNY A;  4YC9 A;  4YAD A;  2CT2 A;  3U5P A;  2G45 A;  1WEN A;  2KWO A;  2LGV A;  1MM3 A;  2XP0 A;  3FEH A;  3FJU B;  2EXU A;  2F6N A;  2YVR A;  4MVT A;  3MDB C;  5D1K B;  2OXQ C;  4R7E A;  1X4J A;  2EGP A;  5SVI A;  2D8S A;  3M7K A;  3DPL R;  2BAY A;  2XEU A;  2VJF A;  3FAN A;  2KGG A;  2YYR A;  4XI1 A;  2QIC A;  1WEQ A;  3FM8 C;  3ZVZ B;  5C13 A;  4P5O B;  2CSY A;  2E6S A;  2LXH C;  4BBQ A;  2JRJ A;  2OWA A;  4YBM A;  1ZBD B;  2ECN A;  3KV5 A;  4CCG X;  3C6W A;  3O70 A;  3KNV A;  1WEM A;  5SVY A;  2AN6 A;  1XWH A;  2EOD A;  3I2D A;  2LN0 A;  2LGK A;  2YHO A;  3H7H A;  1V87 A;  5TDW A;  2ECV A;  2VJE A;  4CA1 A;  1N87 A;  4N4F A;  2CON A;  4B86 C;  1G25 A;  3N9O A;  4LAD B;  4FO9 A;  2FUI A;  2MUM A;  2KGI A;  4W4U A;  3GL6 A;  5AIT A;  5I3L A;  2YQL A;  2L43 A;  3U5O A;  2ZET C;  2HDP A;  2RI7 A;  3PUQ A;  3Q1D A;  3ASL A;  2KFT A;  4R2Y A;  5G0F A;  4ZUX U;  3N9Q A;  4LJN A;  4GNE A;  3DQV R;  4FJC A;  3FL2 A;  5H1T A;  2YQM A;  1FP0 A;  4OGE A;  4FK5 A;  2ECW A;  2LV9 A;  4ZDT A;  3LVR E;  2ECI A;  1WE9 A;  2H0D A;  2MKE A;  5DKA A;  2FUU A;  5LKT A;  1K2F A;  4OGC A;  1WEE A;  4YAX A;  3U5M A;  3KDE C;  1MBM A;  2JMI A;  5EYA F;  1JM7 B;  2CRW A;  2CSZ A;  3N9L A;  4L7X A;  4IC2 A;  5B79 A;  2JMJ A;  3LQI A;  5B77 A;  3ZVY A;  4WZ2 A;  3O35 A;  1DVP A;  4O62 A;  3RPG B;  2L80 A;  2KE1 A;  3NG2 A;  4YAB A;  1DCQ A;  4H9D A;  2MD7 B;  5KH7 A;  5FB0 A;  2PNX A;  3N9N A;  4A4B A;  2K4D A;  4AP4 A;  4I7C A;  3ZPV E;  1BOR A;  3HCU A;  2IDA A;  4UP5 A;  4L58 A;  2KWK A;  1F62 A;  4FIP A;  2CRR A;  4YAT A;  4WZ3 B;  2YRE A;  5FEY A;  2EA6 A;  3GV4 A;  3JUE A;  2QIZ A;  2Y1N A;  4LLB A;  3SOX A;  2LGL A;  3PLW A;  4QF2 A;  4LKA A;  4R8P K;  2KKY A;  4O64 A;  4QQ4 A;  2MT5 A;  2MA6 A;  3HCT A;  2LAU A;  2IQJ A;  3L1Z B;  3LQH A;  2M6M A;  5G04 B;  2YUR A;  5TRB A;  4GNF A;  1Z6U A;  3O47 A;  2ECG A;  4Z0R A;  5LCW B;  3MHS A;  1X4U A;  2JUN A;  4AVX A;  2KRE A;  3T7L A;  2UZG A;  4S3O C;  1WGM A;  1Z2Q A;  4WA6 A;  2C2L A;  2K17 A;  5K3Q A;  3DWD A;  3EB6 A;  3ZTG A;  3LJU X;  1E4U A;  2KR4 A;  3PHD A;  5B78 A;  1IYM A;  2YSM A;  1RMD A;  3RPG C;  5H1V A;  2ECT A;  2XOC A;  3KV6 A;  3O37 A;  4Q6F A;  3N9P A;  2FFW A;  2KWJ A;  2DX8 A;  2E61 A;  4GND A;  5KH9 A;  2MA5 A;  2XOZ A;  2I50 A;  3EB5 A;  4WZ0 A;  2MD8 C;  2Y1M A;  2VJF B;  1WEO A;  4PTB A;  1WES A;  2FD4 A;  3O33 A;  3ZNI A;  1WEV A;  2G43 A;  3E2D A;  3LRQ A;  2YW8 A;  4N3W A;  4MSX A;  5KH3 A;  1LDK C;  2YU4 A;  1X4I A;  5LKZ A; 
#chains in the Genus database with same CATH homology
 2L0B A;  2MNZ A;  2C2V S;  5C11 A;  2YHN A;  4A0C D;  2M3H A;  5TDR A;  4TKP B;  1WEW A;  2Y43 A;  4LK9 A;  1VD4 A;  4B7Y C;  2MIQ A;  1HYJ A;  1WEP A;  3MHH A;  5G05 B;  2VJE B;  4V3L C;  3ZPV 1;  3HTK C;  2HYE D;  2KIZ A;  3M63 A;  1LDJ B;  4I7B A;  4YBS A;  3PUR A;  1VYX A;  4A4C A;  5LKX A;  2E6R A;  3T6R A;  3VK6 A;  5LKU A;  3M99 A;  4YBT A;  1WFK A;  5TAB A;  4X3G A;  4QF3 A;  2VPD A;  3U5N A;  4IC3 A;  5D1M B;  2NAA A;  3LQJ A;  2CKL B;  2XB1 A;  3N9M A;  4GNG A;  2ECJ A;  2L5U A;  1JM7 A;  2K16 A;  4GB0 A;  4I7D A;  2LRI C;  5B75 A;  2LQ6 A;  3RTR B;  3M62 A;  2L75 A;  4V3K C;  2H0D B;  1T1H A;  3O7A A;  3KQI A;  3SOW A;  5B8D A;  3SHB A;  3V43 A;  2KWN A;  1FBV A;  4BHW A;  3O34 A;  3IHP A;  4AYC B;  5FB1 A;  2LGG A;  5J3X A;  2VNF A;  1CHC A;  2G6Q A;  5DIN A;  3QZV A;  1VFY A;  4NN2 A;  4PPE A;  2RSD A;  2LXP C;  2YSJ A;  2FSA A;  3L11 A;  2VPG A;  2LDR A;  4AUQ B;  2M1R A;  5TBN A;  5H1U A;  3ZYQ A;  2YT5 A;  1JOC A;  2JMD A;  5B76 A;  2CKL A;  5JG6 A;  5FER A;  4A49 A;  4C9Z A;  5H9M A;  3L1X A;  4ZQL A;  2VP7 A;  1WIM A;  3HCS A;  2VPE A;  3SOU A;  1U6G B;  2QJ0 A;  5D1L B;  2VPB A;  2PUY A;  4UI9 B;  2M85 A;  5AIU A;  1Z60 A;  3C5K A;  1WIL A;  4S3O B;  1HYI A;  3O36 A;  2F42 A;  1WEU A;  1MM2 A;  2YUC A;  2F6J A;  4F52 B;  2K1J A;  4AYC A;  2KYU A;  2KU3 A;  4UP0 A;  2MNY A;  4YC9 A;  4YAD A;  2CT2 A;  3U5P A;  2G45 A;  1WEN A;  2KWO A;  2LGV A;  1MM3 A;  2F6N A;  4MVT A;  5D1K B;  2OXQ C;  4R7E A;  1X4J A;  2EGP A;  2D8S A;  3DPL R;  2BAY A;  2XEU A;  2VJF A;  2KGG A;  2YYR A;  4XI1 A;  2QIC A;  1WEQ A;  3ZVZ B;  5C13 A;  4P5O B;  2CSY A;  2E6S A;  2LXH C;  4BBQ A;  2JRJ A;  4YBM A;  1ZBD B;  2ECN A;  3KV5 A;  4CCG X;  3C6W A;  3O70 A;  3KNV A;  1WEM A;  2AN6 A;  1XWH A;  2EOD A;  3I2D A;  2LN0 A;  2LGK A;  2YHO A;  1V87 A;  5TDW A;  2ECV A;  2VJE A;  4CA1 A;  1N87 A;  4N4F A;  4B86 C;  1G25 A;  3N9O A;  4LAD B;  4FO9 A;  2FUI A;  2MUM A;  2KGI A;  4W4U A;  3GL6 A;  5AIT A;  5I3L A;  2YQL A;  2L43 A;  3U5O A;  2ZET C;  2HDP A;  2RI7 A;  3PUQ A;  3ASL A;  2KFT A;  4R2Y A;  5G0F A;  4ZUX U;  3N9Q A;  4LJN A;  4GNE A;  3DQV R;  4FJC A;  3FL2 A;  5H1T A;  2YQM A;  1FP0 A;  4FK5 A;  2ECW A;  2LV9 A;  4ZDT A;  2ECI A;  1WE9 A;  2H0D A;  5DKA A;  2FUU A;  5LKT A;  1K2F A;  1WEE A;  4YAX A;  3U5M A;  2JMI A;  5EYA F;  1JM7 B;  2CSZ A;  3N9L A;  4L7X A;  4IC2 A;  5B79 A;  2JMJ A;  3LQI A;  5B77 A;  3ZVY A;  4WZ2 A;  3O35 A;  1DVP A;  3RPG B;  2L80 A;  2KE1 A;  3NG2 A;  4YAB A;  2MD7 B;  5KH7 A;  5FB0 A;  2PNX A;  3N9N A;  4A4B A;  2K4D A;  4AP4 A;  4I7C A;  3ZPV E;  1BOR A;  3HCU A;  2IDA A;  4UP5 A;  4L58 A;  2KWK A;  1F62 A;  4FIP A;  4YAT A;  4WZ3 B;  2YRE A;  5FEY A;  2EA6 A;  3GV4 A;  2QIZ A;  2Y1N A;  4LLB A;  3SOX A;  2LGL A;  4QF2 A;  4LKA A;  4R8P K;  4O64 A;  2MT5 A;  2MA6 A;  3HCT A;  3L1Z B;  3LQH A;  2M6M A;  5G04 B;  2YUR A;  5TRB A;  4GNF A;  1Z6U A;  2ECG A;  5LCW B;  3MHS A;  1X4U A;  4AVX A;  2KRE A;  3T7L A;  2UZG A;  4S3O C;  1WGM A;  1Z2Q A;  4WA6 A;  2C2L A;  2K17 A;  3EB6 A;  3ZTG A;  1E4U A;  2KR4 A;  3PHD A;  5B78 A;  1IYM A;  2YSM A;  1RMD A;  3RPG C;  5H1V A;  2ECT A;  3KV6 A;  3O37 A;  4Q6F A;  3N9P A;  2KWJ A;  2DX8 A;  4GND A;  5KH9 A;  2MA5 A;  2I50 A;  3EB5 A;  4WZ0 A;  2MD8 C;  2Y1M A;  2VJF B;  1WEO A;  4PTB A;  1WES A;  3O33 A;  3ZNI A;  1WEV A;  2G43 A;  3LRQ A;  2YW8 A;  4N3W A;  4MSX A;  5KH3 A;  1LDK C;  2YU4 A;  1X4I A;  5LKZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...