4PPEA

Human rnf4 ring domain
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
66
structure length
66
Chain Sequence
RPSGTVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKNANTCPTCRKKINHKRYHPIYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title RNF4 interacts with both SUMO and nucleosomes to promote the DNA damage response.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase RNF4
total genus 9
structure length 66
sequence length 66
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2014-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13639 zf-RING_2 Ring finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4ppeA00
2QJ0A 2VPBA 2EGPA 4MSXA 4AP4A 2Y43A 3ZTGA 2DX8A 2ECJA 2VJEA 3HTKC 2I50A 4X3GA 2K16A 4YBSA 1VFYA 4R7EA 1WEVA 1T1HA 3KNVA 4O64A 3KQIA 5KH7A 4WZ3B 1WIMA 3L11A 2G6QA 3DQVR 5B78A 2KE1A 4UI9B 4NN2A 5JG6A 1Z60A 4PPEA 1MM2A 5C11A 5AIUA 2MA6A 1WEMA 4YABA 2LGLA 2KIZA 2LXHC 4UP0A 4AYCA 1CHCA 4W4UA 1WEUA 1WGMA 2UZGA 1WESA 2L43A 2FUIA 1JM7A 5B79A 3C5KA 3U5PA 4GNEA 2LXPC 3PURA 2YU4A 3EB6A 4FJCA 4IC2A 1RMDA 3ZPV1 3HCTA 4TKPB 3GL6A 4BBQA 5H1VA 3SOXA 4FO9A 2LQ6A 4AUQB 3O36A 5TDWA 2MNYA 3LQIA 4CA1A 2PUYA 4A49A 4WA6A 3GV4A 3LRQA 4N4FA 1X4IA 3FL2A 2VPEA 5TBNA 3EB5A 2QIZA 3IHPA 4AYCB 2AN6A 2RSDA 1Z6UA 5TABA 2KWJA 4WZ0A 3VK6A 5KH9A 4B86C 1WEPA 2KREA 2KR4A 3SHBA 4R2YA 3N9PA 2VJFB 4N3WA 4YADA 1XWHA 2YUCA 3U5MA 2MNZA 1WFKA 4FK5A 5KH3A 5C13A 3DPLR 5LCWB 3L1ZB 2MA5A 5TDRA 1JOCA 5FB1A 5FB0A 4LLBA 2CKLA 4A0CD 2M3HA 2MIQA 2LGGA 2HDPA 5D1KB 2KU3A 2MT5A 2KWKA 1LDJB 3LQHA 2F6NA 2E6SA 4B7YC 3N9LA 2YHNA 1WILA 2YW8A 2L75A 2ECNA 2YREA 5LKTA 3ZYQA 2C2VS 1G25A 5TRBA 2K1JA 2YQLA 4P5OB 2L0BA 3L1XA 2ECGA 1WENA 5B76A 3MHSA 2CT2A 2KWNA 3O34A 2LGKA 3LQJA 4ZDTA 4LADB 1VYXA 3U5OA 4XI1A 5D1LB 3M99A 4GB0A 1N87A 2JRJA 4L58A 5G05B 4YATA 2M85A 3O7AA 4Q6FA 4UP5A 2KGIA 4F52B 4YAXA 3N9QA 2Y1NA 4S3OB 2XB1A 2JMJA 3RPGC 2K17A 3T7LA 1F62A 2MD7B 1FBVA 4ZUXU 1E4UA 1ZBDB 1WEEA 5FEYA 3O37A 2MD8C 3M62A 2FSAA 2KWOA 2G45A 2YT5A 3I2DA 3N9NA 3SOUA 4QF2A 3KV5A 1VD4A 3ZNIA 4C9ZA 3N9MA 1WEQA 5I3LA 2LGVA 3C6WA 1BORA 4FIPA 4A4BA 4ZQLA 2E6RA 2ECTA 2JMDA 3SOWA 2M1RA 3O33A 1WEOA 5FERA 5H1UA 2LN0A 2C2LA 2JMIA 1FP0A 2Y1MA 2CSYA 1Z2QA 1DVPA 1MM3A 3ZVYA 5LKXA 4I7BA 2MUMA 2YURA 2YHOA 1HYIA 2VPDA 2YSMA 2L80A 5LKZA 2YQMA 4GNGA 3QZVA 1U6GB 5B77A 1IYMA 3HCSA 2LDRA 2VNFA 2EODA 5AITA 3ZVZB 2ECVA 3MHHA 5D1MB 2QICA 4V3LC 4MVTA 3RTRB 5G04B 2CKLB 1X4UA 3KV6A 2BAYA 4S3OC 2D8SA 2EA6A 2ECWA 2PNXA 3ASLA 3PUQA 4I7CA 2KGGA 2KFTA 2ZETC 5B75A 3T6RA 3HCUA 2FUUA 2VJFA 4A4CA 4WZ2A 2XEUA 5EYAF 4R8PK 2YSJA 4AVXA 5J3XA 5G0FA 3U5NA 4V3KC 2VP7A 2NAAA 4L7XA 2HYED 1LDKC 2M6MA 2YYRA 1WEWA 4LK9A 3O70A 2CSZA 2F42A 3O35A 3M63A 2ECIA 4YC9A 4GNDA 4LJNA 4PTBA 2F6JA 5DINA 3V43A 2KYUA 5DKAA 5H9MA 2LRIC 2G43A 5B8DA 1WE9A 2OXQC 2VJEB 4I7DA 1X4JA 3PHDA 4GNFA 2K4DA 4QF3A 2RI7A 3N9OA 5LKUA 3RPGB 4LKAA 1V87A 2H0DB 4BHWA 4YBTA 1HYJA 2IDAA 2L5UA 4YBMA 5H1TA 2VPGA 4IC3A 2LV9A 4CCGX 3NG2A 3ZPVE 1K2FA 1JM7B 2H0DA
chains in the Genus database with same CATH superfamily
2QJ0A 2VPBA 2EGPA 4MSXA 4AP4A 3DDTA 2Y43A 3ZTGA 2DX8A 2ECJA 2VJEA 3HTKC 2I50A 4X3GA 2K16A 4YBSA 1VFYA 4R7EA 2DJAA 1WEVA 1T1HA 3KNVA 4O64A 3KQIA 5KH7A 4WZ3B 3E2DA 1WIMA 3L11A 2G6QA 3DQVR 5B78A 2KE1A 4UI9B 4NN2A 5JG6A 1Z60A 4PPEA 1MM2A 2KKYA 5C11A 5AIUA 2MA6A 1WEMA 3DWDA 4YABA 2LGLA 2KIZA 2LXHC 4UP0A 4AYCA 2RR4A 1CHCA 4W4UA 1WEUA 1WGMA 2UZGA 1WESA 2L43A 2FUIA 1JM7A 5B79A 3C5KA 3U5PA 4GNEA 3O47A 2LXPC 3PURA 2YU4A 3EB6A 4FJCA 4IC2A 1RMDA 2FD4A 3ZPV1 3HCTA 2JUNA 4TKPB 3GL6A 4BBQA 5H1VA 3SOXA 4FO9A 3M7KA 2LQ6A 2B0OE 2P57A 4F1PA 4AUQB 3O36A 5TDWA 2MNYA 3LQIA 4Z0RA 4CA1A 2PUYA 4A49A 4WA6A 3GV4A 3LRQA 4N4FA 1X4IA 3FL2A 3SUBA 2VPEA 5TBNA 3EB5A 4Z0OA 2XOZA 2QIZA 3LVRE 3IHPA 4AYCB 2AN6A 2RSDA 1Z6UA 5TABA 2KWJA 4WZ0A 3VK6A 5KH9A 4B86C 1WEPA 2JM3A 3MDBC 2KREA 2KR4A 5SVIB 3SHBA 4R2YA 3N9PA 2VJFB 4N3WA 4YADA 1XWHA 2YUCA 3U5MA 2MNZA 1WFKA 4FK5A 5KH3A 5C13A 3DPLR 5LCWB 3L1ZB 2MA5A 5TDRA 5SVYA 5FB1A 5FB0A 1JOCA 4LLBA 2CKLA 4A0CD 2M3HA 2MIQA 2LGGA 2HDPA 5D1KB 2KU3A 3FANA 2MT5A 2KWKA 1LDJB 3LQHA 2F6NA 2E6SA 4B7YC 3N9LA 2YHNA 3FAOA 1WILA 2YW8A 3FJUB 2L75A 2ECNA 2YREA 5LKTA 3ZYQA 2C2VS 1G25A 5TRBA 2K1JA 2YQLA 4P5OB 2L0BA 3L1XA 4H9DA 2ECGA 1WENA 2DSMA 5B76A 3MHSA 2CT2A 2KWNA 3LJUX 3O34A 2LGKA 3LQJA 2YVRA 4ZDTA 2CRRA 4LADB 1VYXA 3U5OA 4XI1A 4GB0A 5D1LB 3M99A 2EXUA 1N87A 2JRJA 4L58A 5G05B 4YATA 4OGEA 2M85A 3O7AA 4Q6FA 4UP5A 2KGIA 4F52B 4YAXA 3N9QA 2Y1NA 4S3OB 3PLWA 2XB1A 2JMJA 2MKEA 3RPGC 3FM8C 2K17A 3T7LA 1F62A 2MD7B 1FBVA 4ZUXU 1E4UA 1ZBDB 1WEEA 2OWAA 5FEYA 3O37A 2MD8C 4OGCA 3M62A 2M13A 2FSAA 2KWOA 2G45A 2YT5A 3I2DA 3N9NA 3SOUA 4QF2A 3KV5A 1VD4A 3ZNIA 1DCQA 4C9ZA 2L7PA 3N9MA 1WEQA 2IQJA 2XOCA 5I3LA 2LGVA 3C6WA 1BORA 4FIPA 4A4BA 4ZQLA 2E6RA 2ECTA 3Q1DA 2JMDA 3SOWA 2M1RA 5SVIA 3O33A 1WEOA 2CRWA 5FERA 5H1UA 2LN0A 3LDYA 2C2LA 2JMIA 1FP0A 2Y1MA 2CSYA 2LAUA 2CONA 1Z2QA 1DVPA 1MM3A 3ZVYA 3FEHA 5LKXA 2FFWA 4I7BA 2MUMA 2YURA 2YHOA 1HYIA 2VPDA 3T9KA 2YSMA 2L80A 5LKZA 2YQMA 4GNGA 3QZVA 3KDEC 2EGMA 1U6GB 5B77A 1IYMA 3HCSA 2LDRA 3LVQE 2VNFA 2EODA 5AITA 3ZVZB 2ECVA 3MHHA 5D1MB 2QICA 4V3LC 4MVTA 3RTRB 5G04B 2CKLB 1X4UA 3KV6A 2BAYA 4S3OC 2D8SA 2EA6A 3JUEA 2ECWA 2PNXA 3ASLA 3PUQA 4I7CA 2KGGA 2KFTA 2ZETC 4O62A 5B75A 3T6RA 3HCUA 2XOYA 2FUUA 2VJFA 4A4CA 4WZ2A 2KKXA 2XP0A 2XEUA 5EYAF 4R8PK 2YSJA 4AVXA 5J3XA 5G0FA 3U5NA 4QQ4A 4V3KC 1MBMA 2VP7A 2NAAA 4L7XA 2HYED 1LDKC 2M6MA 2YYRA 1WEWA 4LK9A 3O70A 2CSZA 2F42A 3O35A 3M63A 2ECIA 4YC9A 4GNDA 4LJNA 2CSVA 4PTBA 2F6JA 5DINA 3V43A 2KYUA 5DKAA 5H9MA 2LRIC 2G43A 1WE9A 2OXQC 5B8DA 2VJEB 4I7DA 1X4JA 3PHDA 2D8UA 4GNFA 2E61A 2K4DA 4QF3A 2RI7A 3N9OA 5LKUA 3RPGB 4LKAA 1V87A 2H0DB 4BHWA 4YBTA 1HYJA 2IDAA 2L5UA 3H7HA 5K3QA 4YBMA 5H1TA 2VPGA 4IC3A 2LV9A 4CCGX 3NG2A 3ZPVE 1K2FA 5SVXA 1JM7B 2H0DA
chains in the Genus database with same CATH topology
2QJ0A 2VPBA 2EGPA 4MSXA 4AP4A 2Y43A 3ZTGA 2DX8A 2ECJA 2VJEA 3HTKC 2I50A 4X3GA 2K16A 4YBSA 1VFYA 4R7EA 1WEVA 1T1HA 3KNVA 4O64A 3KQIA 5KH7A 4WZ3B 1WIMA 3L11A 2G6QA 3DQVR 5B78A 2KE1A 4UI9B 4NN2A 5JG6A 1Z60A 4PPEA 1MM2A 5C11A 5AIUA 2MA6A 1WEMA 4YABA 2LGLA 2KIZA 2LXHC 4UP0A 4AYCA 1CHCA 4W4UA 1WEUA 1WGMA 2UZGA 1WESA 2L43A 2FUIA 1JM7A 5B79A 3C5KA 3U5PA 4GNEA 2LXPC 3PURA 2YU4A 3EB6A 4FJCA 4IC2A 1RMDA 3ZPV1 3HCTA 4TKPB 3GL6A 4BBQA 5H1VA 3SOXA 4FO9A 2LQ6A 4AUQB 3O36A 5TDWA 2MNYA 3LQIA 4CA1A 2PUYA 4A49A 4WA6A 3GV4A 3LRQA 4N4FA 1X4IA 3FL2A 2VPEA 5TBNA 3EB5A 2QIZA 3IHPA 4AYCB 2AN6A 2RSDA 1Z6UA 5TABA 2KWJA 4WZ0A 3VK6A 5KH9A 4B86C 1WEPA 2KREA 2KR4A 3SHBA 4R2YA 3N9PA 2VJFB 4N3WA 4YADA 1XWHA 2YUCA 3U5MA 2MNZA 1WFKA 4FK5A 5KH3A 5C13A 3DPLR 5LCWB 3L1ZB 2MA5A 5TDRA 1JOCA 5FB1A 5FB0A 4LLBA 2CKLA 4A0CD 2M3HA 2MIQA 2LGGA 2HDPA 5D1KB 2KU3A 2MT5A 2KWKA 1LDJB 3LQHA 2F6NA 2E6SA 4B7YC 3N9LA 2YHNA 1WILA 2YW8A 2L75A 2ECNA 2YREA 5LKTA 3ZYQA 2C2VS 1G25A 5TRBA 2K1JA 2YQLA 4P5OB 2L0BA 3L1XA 2ECGA 1WENA 5B76A 3MHSA 2CT2A 2KWNA 3O34A 2LGKA 3LQJA 4ZDTA 4LADB 1VYXA 3U5OA 4XI1A 5D1LB 3M99A 4GB0A 1N87A 2JRJA 4L58A 5G05B 4YATA 2M85A 3O7AA 4Q6FA 4UP5A 2KGIA 4F52B 4YAXA 3N9QA 2Y1NA 4S3OB 2XB1A 2JMJA 3RPGC 2K17A 3T7LA 1F62A 2MD7B 1FBVA 4ZUXU 1E4UA 1ZBDB 1WEEA 5FEYA 3O37A 2MD8C 3M62A 2FSAA 2KWOA 2G45A 2YT5A 3I2DA 3N9NA 3SOUA 4QF2A 3KV5A 1VD4A 3ZNIA 4C9ZA 3N9MA 1WEQA 5I3LA 2LGVA 3C6WA 1BORA 4FIPA 4A4BA 4ZQLA 2E6RA 2ECTA 2JMDA 3SOWA 2M1RA 3O33A 1WEOA 5FERA 5H1UA 2LN0A 2C2LA 2JMIA 1FP0A 2Y1MA 2CSYA 1Z2QA 1DVPA 1MM3A 3ZVYA 5LKXA 4I7BA 2MUMA 2YURA 2YHOA 1HYIA 2VPDA 2YSMA 2L80A 5LKZA 2YQMA 4GNGA 3QZVA 1U6GB 5B77A 1IYMA 3HCSA 2LDRA 2VNFA 2EODA 5AITA 3ZVZB 2ECVA 3MHHA 5D1MB 2QICA 4V3LC 4MVTA 3RTRB 5G04B 2CKLB 1X4UA 3KV6A 2BAYA 4S3OC 2D8SA 2EA6A 2ECWA 2PNXA 3ASLA 3PUQA 4I7CA 2KGGA 2KFTA 2ZETC 5B75A 3T6RA 3HCUA 2FUUA 2VJFA 4A4CA 4WZ2A 2XEUA 5EYAF 4R8PK 2YSJA 4AVXA 5J3XA 5G0FA 3U5NA 4V3KC 2VP7A 2NAAA 4L7XA 2HYED 1LDKC 2M6MA 2YYRA 1WEWA 4LK9A 3O70A 2CSZA 2F42A 3O35A 3M63A 2ECIA 4YC9A 4GNDA 4LJNA 4PTBA 2F6JA 5DINA 3V43A 2KYUA 5DKAA 5H9MA 2LRIC 2G43A 5B8DA 1WE9A 2OXQC 2VJEB 4I7DA 1X4JA 3PHDA 4GNFA 2K4DA 4QF3A 2RI7A 3N9OA 5LKUA 3RPGB 4LKAA 1V87A 2H0DB 4BHWA 4YBTA 1HYJA 2IDAA 2L5UA 4YBMA 5H1TA 2VPGA 4IC3A 2LV9A 4CCGX 3NG2A 3ZPVE 1K2FA 1JM7B 2H0DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QJ0 A;  2VPB A;  2EGP A;  4MSX A;  4AP4 A;  2Y43 A;  3ZTG A;  2DX8 A;  2ECJ A;  2VJE A;  3HTK C;  2I50 A;  4X3G A;  2K16 A;  4YBS A;  1VFY A;  4R7E A;  1WEV A;  1T1H A;  3KNV A;  4O64 A;  3KQI A;  5KH7 A;  4WZ3 B;  1WIM A;  3L11 A;  2G6Q A;  3DQV R;  5B78 A;  2KE1 A;  4UI9 B;  4NN2 A;  5JG6 A;  1Z60 A;  4PPE A;  1MM2 A;  5C11 A;  5AIU A;  2MA6 A;  1WEM A;  4YAB A;  2LGL A;  2KIZ A;  2LXH C;  4UP0 A;  4AYC A;  1CHC A;  4W4U A;  1WEU A;  1WGM A;  2UZG A;  1WES A;  2L43 A;  2FUI A;  1JM7 A;  5B79 A;  3C5K A;  3U5P A;  4GNE A;  2LXP C;  3PUR A;  2YU4 A;  3EB6 A;  4FJC A;  4IC2 A;  1RMD A;  3ZPV 1;  3HCT A;  4TKP B;  3GL6 A;  4BBQ A;  5H1V A;  3SOX A;  4FO9 A;  2LQ6 A;  4AUQ B;  3O36 A;  5TDW A;  2MNY A;  3LQI A;  4CA1 A;  2PUY A;  4A49 A;  4WA6 A;  3GV4 A;  3LRQ A;  4N4F A;  1X4I A;  3FL2 A;  2VPE A;  5TBN A;  3EB5 A;  2QIZ A;  3IHP A;  4AYC B;  2AN6 A;  2RSD A;  1Z6U A;  5TAB A;  2KWJ A;  4WZ0 A;  3VK6 A;  5KH9 A;  4B86 C;  1WEP A;  2KRE A;  2KR4 A;  3SHB A;  4R2Y A;  3N9P A;  2VJF B;  4N3W A;  4YAD A;  1XWH A;  2YUC A;  3U5M A;  2MNZ A;  1WFK A;  4FK5 A;  5KH3 A;  5C13 A;  3DPL R;  5LCW B;  3L1Z B;  2MA5 A;  5TDR A;  1JOC A;  5FB1 A;  5FB0 A;  4LLB A;  2CKL A;  4A0C D;  2M3H A;  2MIQ A;  2LGG A;  2HDP A;  5D1K B;  2KU3 A;  2MT5 A;  2KWK A;  1LDJ B;  3LQH A;  2F6N A;  2E6S A;  4B7Y C;  3N9L A;  2YHN A;  1WIL A;  2YW8 A;  2L75 A;  2ECN A;  2YRE A;  5LKT A;  3ZYQ A;  2C2V S;  1G25 A;  5TRB A;  2K1J A;  2YQL A;  4P5O B;  2L0B A;  3L1X A;  2ECG A;  1WEN A;  5B76 A;  3MHS A;  2CT2 A;  2KWN A;  3O34 A;  2LGK A;  3LQJ A;  4ZDT A;  4LAD B;  1VYX A;  3U5O A;  4XI1 A;  5D1L B;  3M99 A;  4GB0 A;  1N87 A;  2JRJ A;  4L58 A;  5G05 B;  4YAT A;  2M85 A;  3O7A A;  4Q6F A;  4UP5 A;  2KGI A;  4F52 B;  4YAX A;  3N9Q A;  2Y1N A;  4S3O B;  2XB1 A;  2JMJ A;  3RPG C;  2K17 A;  3T7L A;  1F62 A;  2MD7 B;  1FBV A;  4ZUX U;  1E4U A;  1ZBD B;  1WEE A;  5FEY A;  3O37 A;  2MD8 C;  3M62 A;  2FSA A;  2KWO A;  2G45 A;  2YT5 A;  3I2D A;  3N9N A;  3SOU A;  4QF2 A;  3KV5 A;  1VD4 A;  3ZNI A;  4C9Z A;  3N9M A;  1WEQ A;  5I3L A;  2LGV A;  3C6W A;  1BOR A;  4FIP A;  4A4B A;  4ZQL A;  2E6R A;  2ECT A;  2JMD A;  3SOW A;  2M1R A;  3O33 A;  1WEO A;  5FER A;  5H1U A;  2LN0 A;  2C2L A;  2JMI A;  1FP0 A;  2Y1M A;  2CSY A;  1Z2Q A;  1DVP A;  1MM3 A;  3ZVY A;  5LKX A;  4I7B A;  2MUM A;  2YUR A;  2YHO A;  1HYI A;  2VPD A;  2YSM A;  2L80 A;  5LKZ A;  2YQM A;  4GNG A;  3QZV A;  1U6G B;  5B77 A;  1IYM A;  3HCS A;  2LDR A;  2VNF A;  2EOD A;  5AIT A;  3ZVZ B;  2ECV A;  3MHH A;  5D1M B;  2QIC A;  4V3L C;  4MVT A;  3RTR B;  5G04 B;  2CKL B;  1X4U A;  3KV6 A;  2BAY A;  4S3O C;  2D8S A;  2EA6 A;  2ECW A;  2PNX A;  3ASL A;  3PUQ A;  4I7C A;  2KGG A;  2KFT A;  2ZET C;  5B75 A;  3T6R A;  3HCU A;  2FUU A;  2VJF A;  4A4C A;  4WZ2 A;  2XEU A;  5EYA F;  4R8P K;  2YSJ A;  4AVX A;  5J3X A;  5G0F A;  3U5N A;  4V3K C;  2VP7 A;  2NAA A;  4L7X A;  2HYE D;  1LDK C;  2M6M A;  2YYR A;  1WEW A;  4LK9 A;  3O70 A;  2CSZ A;  2F42 A;  3O35 A;  3M63 A;  2ECI A;  4YC9 A;  4GND A;  4LJN A;  4PTB A;  2F6J A;  5DIN A;  3V43 A;  2KYU A;  5DKA A;  5H9M A;  2LRI C;  2G43 A;  5B8D A;  1WE9 A;  2OXQ C;  2VJE B;  4I7D A;  1X4J A;  3PHD A;  4GNF A;  2K4D A;  4QF3 A;  2RI7 A;  3N9O A;  5LKU A;  3RPG B;  4LKA A;  1V87 A;  2H0D B;  4BHW A;  4YBT A;  1HYJ A;  2IDA A;  2L5U A;  4YBM A;  5H1T A;  2VPG A;  4IC3 A;  2LV9 A;  4CCG X;  3NG2 A;  3ZPV E;  1K2F A;  1JM7 B;  2H0D A; 
#chains in the Genus database with same CATH topology
 2QJ0 A;  2VPB A;  2EGP A;  4MSX A;  4AP4 A;  3DDT A;  2Y43 A;  3ZTG A;  2DX8 A;  2ECJ A;  2VJE A;  3HTK C;  2I50 A;  4X3G A;  2K16 A;  4YBS A;  1VFY A;  4R7E A;  2DJA A;  1WEV A;  1T1H A;  3KNV A;  4O64 A;  3KQI A;  5KH7 A;  4WZ3 B;  3E2D A;  1WIM A;  3L11 A;  2G6Q A;  3DQV R;  5B78 A;  2KE1 A;  4UI9 B;  4NN2 A;  5JG6 A;  1Z60 A;  4PPE A;  1MM2 A;  2KKY A;  5C11 A;  5AIU A;  2MA6 A;  1WEM A;  3DWD A;  4YAB A;  2LGL A;  2KIZ A;  2LXH C;  4UP0 A;  4AYC A;  2RR4 A;  1CHC A;  4W4U A;  1WEU A;  1WGM A;  2UZG A;  1WES A;  2L43 A;  2FUI A;  1JM7 A;  5B79 A;  3C5K A;  3U5P A;  4GNE A;  3O47 A;  2LXP C;  3PUR A;  2YU4 A;  3EB6 A;  4FJC A;  4IC2 A;  1RMD A;  2FD4 A;  3ZPV 1;  3HCT A;  2JUN A;  4TKP B;  3GL6 A;  4BBQ A;  5H1V A;  3SOX A;  4FO9 A;  3M7K A;  2LQ6 A;  2B0O E;  2P57 A;  4F1P A;  4AUQ B;  3O36 A;  5TDW A;  2MNY A;  3LQI A;  4Z0R A;  4CA1 A;  2PUY A;  4A49 A;  4WA6 A;  3GV4 A;  3LRQ A;  4N4F A;  1X4I A;  3FL2 A;  3SUB A;  2VPE A;  5TBN A;  3EB5 A;  4Z0O A;  2XOZ A;  2QIZ A;  3LVR E;  3IHP A;  4AYC B;  2AN6 A;  2RSD A;  1Z6U A;  5TAB A;  2KWJ A;  4WZ0 A;  3VK6 A;  5KH9 A;  4B86 C;  1WEP A;  2JM3 A;  3MDB C;  2KRE A;  2KR4 A;  5SVI B;  3SHB A;  4R2Y A;  3N9P A;  2VJF B;  4N3W A;  4YAD A;  1XWH A;  2YUC A;  3U5M A;  2MNZ A;  1WFK A;  4FK5 A;  5KH3 A;  5C13 A;  3DPL R;  5LCW B;  3L1Z B;  2MA5 A;  5TDR A;  5SVY A;  5FB1 A;  5FB0 A;  1JOC A;  4LLB A;  2CKL A;  4A0C D;  2M3H A;  2MIQ A;  2LGG A;  2HDP A;  5D1K B;  2KU3 A;  3FAN A;  2MT5 A;  2KWK A;  1LDJ B;  3LQH A;  2F6N A;  2E6S A;  4B7Y C;  3N9L A;  2YHN A;  3FAO A;  1WIL A;  2YW8 A;  3FJU B;  2L75 A;  2ECN A;  2YRE A;  5LKT A;  3ZYQ A;  2C2V S;  1G25 A;  5TRB A;  2K1J A;  2YQL A;  4P5O B;  2L0B A;  3L1X A;  4H9D A;  2ECG A;  1WEN A;  2DSM A;  5B76 A;  3MHS A;  2CT2 A;  2KWN A;  3LJU X;  3O34 A;  2LGK A;  3LQJ A;  2YVR A;  4ZDT A;  2CRR A;  4LAD B;  1VYX A;  3U5O A;  4XI1 A;  4GB0 A;  5D1L B;  3M99 A;  2EXU A;  1N87 A;  2JRJ A;  4L58 A;  5G05 B;  4YAT A;  4OGE A;  2M85 A;  3O7A A;  4Q6F A;  4UP5 A;  2KGI A;  4F52 B;  4YAX A;  3N9Q A;  2Y1N A;  4S3O B;  3PLW A;  2XB1 A;  2JMJ A;  2MKE A;  3RPG C;  3FM8 C;  2K17 A;  3T7L A;  1F62 A;  2MD7 B;  1FBV A;  4ZUX U;  1E4U A;  1ZBD B;  1WEE A;  2OWA A;  5FEY A;  3O37 A;  2MD8 C;  4OGC A;  3M62 A;  2M13 A;  2FSA A;  2KWO A;  2G45 A;  2YT5 A;  3I2D A;  3N9N A;  3SOU A;  4QF2 A;  3KV5 A;  1VD4 A;  3ZNI A;  1DCQ A;  4C9Z A;  2L7P A;  3N9M A;  1WEQ A;  2IQJ A;  2XOC A;  5I3L A;  2LGV A;  3C6W A;  1BOR A;  4FIP A;  4A4B A;  4ZQL A;  2E6R A;  2ECT A;  3Q1D A;  2JMD A;  3SOW A;  2M1R A;  5SVI A;  3O33 A;  1WEO A;  2CRW A;  5FER A;  5H1U A;  2LN0 A;  3LDY A;  2C2L A;  2JMI A;  1FP0 A;  2Y1M A;  2CSY A;  2LAU A;  2CON A;  1Z2Q A;  1DVP A;  1MM3 A;  3ZVY A;  3FEH A;  5LKX A;  2FFW A;  4I7B A;  2MUM A;  2YUR A;  2YHO A;  1HYI A;  2VPD A;  3T9K A;  2YSM A;  2L80 A;  5LKZ A;  2YQM A;  4GNG A;  3QZV A;  3KDE C;  2EGM A;  1U6G B;  5B77 A;  1IYM A;  3HCS A;  2LDR A;  3LVQ E;  2VNF A;  2EOD A;  5AIT A;  3ZVZ B;  2ECV A;  3MHH A;  5D1M B;  2QIC A;  4V3L C;  4MVT A;  3RTR B;  5G04 B;  2CKL B;  1X4U A;  3KV6 A;  2BAY A;  4S3O C;  2D8S A;  2EA6 A;  3JUE A;  2ECW A;  2PNX A;  3ASL A;  3PUQ A;  4I7C A;  2KGG A;  2KFT A;  2ZET C;  4O62 A;  5B75 A;  3T6R A;  3HCU A;  2XOY A;  2FUU A;  2VJF A;  4A4C A;  4WZ2 A;  2KKX A;  2XP0 A;  2XEU A;  5EYA F;  4R8P K;  2YSJ A;  4AVX A;  5J3X A;  5G0F A;  3U5N A;  4QQ4 A;  4V3K C;  1MBM A;  2VP7 A;  2NAA A;  4L7X A;  2HYE D;  1LDK C;  2M6M A;  2YYR A;  1WEW A;  4LK9 A;  3O70 A;  2CSZ A;  2F42 A;  3O35 A;  3M63 A;  2ECI A;  4YC9 A;  4GND A;  4LJN A;  2CSV A;  4PTB A;  2F6J A;  5DIN A;  3V43 A;  2KYU A;  5DKA A;  5H9M A;  2LRI C;  2G43 A;  1WE9 A;  2OXQ C;  5B8D A;  2VJE B;  4I7D A;  1X4J A;  3PHD A;  2D8U A;  4GNF A;  2E61 A;  2K4D A;  4QF3 A;  2RI7 A;  3N9O A;  5LKU A;  3RPG B;  4LKA A;  1V87 A;  2H0D B;  4BHW A;  4YBT A;  1HYJ A;  2IDA A;  2L5U A;  3H7H A;  5K3Q A;  4YBM A;  5H1T A;  2VPG A;  4IC3 A;  2LV9 A;  4CCG X;  3NG2 A;  3ZPV E;  1K2F A;  5SVX A;  1JM7 B;  2H0D A; 
#chains in the Genus database with same CATH homology
 2QJ0 A;  2VPB A;  2EGP A;  4MSX A;  4AP4 A;  2Y43 A;  3ZTG A;  2DX8 A;  2ECJ A;  2VJE A;  3HTK C;  2I50 A;  4X3G A;  2K16 A;  4YBS A;  1VFY A;  4R7E A;  1WEV A;  1T1H A;  3KNV A;  4O64 A;  3KQI A;  5KH7 A;  4WZ3 B;  1WIM A;  3L11 A;  2G6Q A;  3DQV R;  5B78 A;  2KE1 A;  4UI9 B;  4NN2 A;  5JG6 A;  1Z60 A;  4PPE A;  1MM2 A;  5C11 A;  5AIU A;  2MA6 A;  1WEM A;  4YAB A;  2LGL A;  2KIZ A;  2LXH C;  4UP0 A;  4AYC A;  1CHC A;  4W4U A;  1WEU A;  1WGM A;  2UZG A;  1WES A;  2L43 A;  2FUI A;  1JM7 A;  5B79 A;  3C5K A;  3U5P A;  4GNE A;  2LXP C;  3PUR A;  2YU4 A;  3EB6 A;  4FJC A;  4IC2 A;  1RMD A;  3ZPV 1;  3HCT A;  4TKP B;  3GL6 A;  4BBQ A;  5H1V A;  3SOX A;  4FO9 A;  2LQ6 A;  4AUQ B;  3O36 A;  5TDW A;  2MNY A;  3LQI A;  4CA1 A;  2PUY A;  4A49 A;  4WA6 A;  3GV4 A;  3LRQ A;  4N4F A;  1X4I A;  3FL2 A;  2VPE A;  5TBN A;  3EB5 A;  2QIZ A;  3IHP A;  4AYC B;  2AN6 A;  2RSD A;  1Z6U A;  5TAB A;  2KWJ A;  4WZ0 A;  3VK6 A;  5KH9 A;  4B86 C;  1WEP A;  2KRE A;  2KR4 A;  3SHB A;  4R2Y A;  3N9P A;  2VJF B;  4N3W A;  4YAD A;  1XWH A;  2YUC A;  3U5M A;  2MNZ A;  1WFK A;  4FK5 A;  5KH3 A;  5C13 A;  3DPL R;  5LCW B;  3L1Z B;  2MA5 A;  5TDR A;  1JOC A;  5FB1 A;  5FB0 A;  4LLB A;  2CKL A;  4A0C D;  2M3H A;  2MIQ A;  2LGG A;  2HDP A;  5D1K B;  2KU3 A;  2MT5 A;  2KWK A;  1LDJ B;  3LQH A;  2F6N A;  2E6S A;  4B7Y C;  3N9L A;  2YHN A;  1WIL A;  2YW8 A;  2L75 A;  2ECN A;  2YRE A;  5LKT A;  3ZYQ A;  2C2V S;  1G25 A;  5TRB A;  2K1J A;  2YQL A;  4P5O B;  2L0B A;  3L1X A;  2ECG A;  1WEN A;  5B76 A;  3MHS A;  2CT2 A;  2KWN A;  3O34 A;  2LGK A;  3LQJ A;  4ZDT A;  4LAD B;  1VYX A;  3U5O A;  4XI1 A;  5D1L B;  3M99 A;  4GB0 A;  1N87 A;  2JRJ A;  4L58 A;  5G05 B;  4YAT A;  2M85 A;  3O7A A;  4Q6F A;  4UP5 A;  2KGI A;  4F52 B;  4YAX A;  3N9Q A;  2Y1N A;  4S3O B;  2XB1 A;  2JMJ A;  3RPG C;  2K17 A;  3T7L A;  1F62 A;  2MD7 B;  1FBV A;  4ZUX U;  1E4U A;  1ZBD B;  1WEE A;  5FEY A;  3O37 A;  2MD8 C;  3M62 A;  2FSA A;  2KWO A;  2G45 A;  2YT5 A;  3I2D A;  3N9N A;  3SOU A;  4QF2 A;  3KV5 A;  1VD4 A;  3ZNI A;  4C9Z A;  3N9M A;  1WEQ A;  5I3L A;  2LGV A;  3C6W A;  1BOR A;  4FIP A;  4A4B A;  4ZQL A;  2E6R A;  2ECT A;  2JMD A;  3SOW A;  2M1R A;  3O33 A;  1WEO A;  5FER A;  5H1U A;  2LN0 A;  2C2L A;  2JMI A;  1FP0 A;  2Y1M A;  2CSY A;  1Z2Q A;  1DVP A;  1MM3 A;  3ZVY A;  5LKX A;  4I7B A;  2MUM A;  2YUR A;  2YHO A;  1HYI A;  2VPD A;  2YSM A;  2L80 A;  5LKZ A;  2YQM A;  4GNG A;  3QZV A;  1U6G B;  5B77 A;  1IYM A;  3HCS A;  2LDR A;  2VNF A;  2EOD A;  5AIT A;  3ZVZ B;  2ECV A;  3MHH A;  5D1M B;  2QIC A;  4V3L C;  4MVT A;  3RTR B;  5G04 B;  2CKL B;  1X4U A;  3KV6 A;  2BAY A;  4S3O C;  2D8S A;  2EA6 A;  2ECW A;  2PNX A;  3ASL A;  3PUQ A;  4I7C A;  2KGG A;  2KFT A;  2ZET C;  5B75 A;  3T6R A;  3HCU A;  2FUU A;  2VJF A;  4A4C A;  4WZ2 A;  2XEU A;  5EYA F;  4R8P K;  2YSJ A;  4AVX A;  5J3X A;  5G0F A;  3U5N A;  4V3K C;  2VP7 A;  2NAA A;  4L7X A;  2HYE D;  1LDK C;  2M6M A;  2YYR A;  1WEW A;  4LK9 A;  3O70 A;  2CSZ A;  2F42 A;  3O35 A;  3M63 A;  2ECI A;  4YC9 A;  4GND A;  4LJN A;  4PTB A;  2F6J A;  5DIN A;  3V43 A;  2KYU A;  5DKA A;  5H9M A;  2LRI C;  2G43 A;  5B8D A;  1WE9 A;  2OXQ C;  2VJE B;  4I7D A;  1X4J A;  3PHD A;  4GNF A;  2K4D A;  4QF3 A;  2RI7 A;  3N9O A;  5LKU A;  3RPG B;  4LKA A;  1V87 A;  2H0D B;  4BHW A;  4YBT A;  1HYJ A;  2IDA A;  2L5U A;  4YBM A;  5H1T A;  2VPG A;  4IC3 A;  2LV9 A;  4CCG X;  3NG2 A;  3ZPV E;  1K2F A;  1JM7 B;  2H0D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...