4PPEA

Human rnf4 ring domain
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
66
structure length
66
Chain Sequence
RPSGTVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKNANTCPTCRKKINHKRYHPIYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase RNF4
publication title RNF4 interacts with both SUMO and nucleosomes to promote the DNA damage response.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 9
structure length 66
sequence length 66
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2014-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13639 zf-RING_2 Ring finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4ppeA00
4LADB 2MUMA 1T1HA 3EB5A 2L75A 2CKLB 4WA6A 1WESA 1X4UA 5C11A 2MIQA 4BBQA 4WZ3B 2QJ0A 4A0CD 1RMDA 1WGMA 2YQLA 3KNVA 2ECNA 1WEVA 4CA1A 2VPDA 2MNZA 2L5UA 2LQ6A 2ECWA 5FERA 5J3XA 4MSXA 3SHBA 4B86C 3LQJA 4AVXA 1WEMA 1HYIA 1CHCA 1XWHA 2KGIA 2LV9A 2CT2A 5G04B 2YW8A 2KR4A 2QICA 3DPLR 2KFTA 5TDRA 4GNEA 4S3OB 3NG2A 3M99A 2FUUA 2MA5A 2KREA 2CKLA 1Z2QA 1K2FA 1JOCA 4WZ0A 5B8DA 5LKZA 1U6GB 1WENA 2H0DB 4IC3A 1Z60A 4F52B 3SOWA 3T6RA 3PURA 2VP7A 2KWKA 1VD4A 5LKTA 3GL6A 2KGGA 4QF3A 4I7CA 4FK5A 1WEWA 2EA6A 2M85A 3M63A 2MD8C 2LDRA 5B76A 5FEYA 2C2LA 5JG6A 3PUQA 2E6RA 1BORA 3C5KA 1FBVA 2K4DA 5AIUA 2KYUA 5TRBA 2VJFB 2K16A 2VPGA 3MHSA 2LRIC 2JMIA 4FJCA 3N9OA 3M62A 4FO9A 2H0DA 3L1XA 5KH9A 4YC9A 2ECGA 3FL2A 2G45A 2YQMA 5D1LB 2NAAA 4N3WA 2YHOA 1LDJB 3RPGC 4A4CA 1WFKA 3O7AA 2JMJA 4UI9B 2LN0A 2L80A 2ECVA 2F6JA 3O35A 4ZQLA 2VJEB 1Z6UA 3HCTA 4LKAA 5D1MB 2EGPA 5LKUA 1ZBDB 2VJFA 4C9ZA 3N9NA 2M1RA 3SOXA 1X4JA 5LKXA 3N9QA 3GV4A 4R8PK 2RI7A 4N4FA 2YURA 5EYAF 3U5PA 3N9MA 3HCSA 3O34A 4B7YC 2L43A 1LDKC 3T7LA 1FP0A 3KV6A 2L0BA 1WILA 3QZVA 5B77A 4V3KC 1VYXA 4I7BA 2VPEA 4ZUXU 4FIPA 1N87A 4NN2A 3U5MA 4YADA 3PHDA 2KIZA 2CSYA 5B78A 3RPGB 2YT5A 4TKPB 4P5OB 4A4BA 4O64A 4AUQB 5AITA 1WEQA 2YYRA 4XI1A 4YATA 3LRQA 2MT5A 5DKAA 2KWJA 2YSJA 5LCWB 2LGVA 4UP5A 3RTRB 2XB1A 4Q6FA 2QIZA 1WIMA 2HYED 4GNDA 2MA6A 2C2VS 4X3GA 2HDPA 2K1JA 5TDWA 4CCGX 4MVTA 4PTBA 4LK9A 4LLBA 3L1ZB 4YABA 5C13A 5I3LA 3U5OA 3I2DA 4R7EA 4YBMA 4R2YA 3DQVR 3O36A 2YHNA 3O33A 1E4UA 3LQHA 1MM2A 2EODA 5B75A 4ZDTA 1DVPA 1X4IA 4L58A 5DINA 2YU4A 1HYJA 1V87A 2F42A 2ECTA 4YBTA 2YUCA 2G6QA 2MD7B 1WEEA 2JRJA 2F6NA 4W4UA 5TBNA 5H1TA 3ZPVE 3V43A 3LQIA 2KU3A 2M6MA 4AYCB 1WE9A 2VNFA 3ZVYA 4YAXA 4GNGA 2PNXA 3HTKC 5G0FA 3KQIA 4AP4A 2LXHC 2IDAA 3ZTGA 4PPEA 1WEOA 4IC2A 2D8SA 4UP0A 5KH7A 2Y43A 3O70A 2M3HA 3ZNIA 4V3LC 2E6SA 2KE1A 4L7XA 3ZYQA 2RSDA 4GB0A 4GNFA 2VPBA 1G25A 4YBSA 1VFYA 2KWNA 3IHPA 3N9LA 2ZETC 4QF2A 5H1VA 2LGKA 3MHHA 2XEUA 2VJEA 3SOUA 4WZ2A 1MM3A 2CSZA 3N9PA 4BHWA 2JMDA 2LGLA 2DX8A 2KWOA 3HCUA 2Y1NA 2Y1MA 1JM7B 1WEPA 2MNYA 3KV5A 1F62A 4AYCA 2ECIA 2LXPC 5B79A 3ZVZB 2FUIA 2ECJA 2OXQC 2FSAA 2PUYA 5D1KB 4I7DA 3ASLA 3EB6A 3L11A 2YREA 3ZPV1 5H9MA 2YSMA 3VK6A 1IYMA 5G05B 2K17A 5H1UA 3C6WA 5TABA 1WEUA 5FB1A 4S3OC 5KH3A 4LJNA 2UZGA 2LGGA 5FB0A 3O37A 2G43A 2AN6A 4A49A 1JM7A 2BAYA 2I50A 3U5NA
chains in the Genus database with same CATH superfamily
3KDEC 4LADB 2MUMA 1T1HA 3EB5A 2L75A 2B0OE 2CKLB 4WA6A 1WESA 1X4UA 2OWAA 5C11A 2MIQA 4BBQA 4WZ3B 5SVIA 2QJ0A 4A0CD 1RMDA 1WGMA 2XOZA 2YQLA 3KNVA 2ECNA 1WEVA 2XOYA 4CA1A 2VPDA 2MNZA 2L5UA 2LQ6A 2ECWA 2D8UA 5FERA 5J3XA 4MSXA 3SHBA 4B86C 3LQJA 4AVXA 1WEMA 1HYIA 1CHCA 1XWHA 2KGIA 2LV9A 2CT2A 5G04B 2YW8A 2EXUA 2KR4A 2QICA 3DPLR 2KFTA 5TDRA 4GNEA 4S3OB 3NG2A 3M99A 2FUUA 2MA5A 2KREA 2CKLA 3T9KA 1Z2QA 1K2FA 1JOCA 4WZ0A 5B8DA 3FJUB 5LKZA 2IQJA 1U6GB 1WENA 2H0DB 4IC3A 4OGEA 1Z60A 3M7KA 4F52B 3SOWA 3T6RA 3DDTA 3PURA 2VP7A 2KWKA 1VD4A 5LKTA 3GL6A 2KGGA 4QF3A 4I7CA 4FK5A 1WEWA 2EA6A 2M85A 3M63A 2MD8C 2LDRA 5B76A 5FEYA 3E2DA 2C2LA 2L7PA 5JG6A 3PUQA 2E6RA 1BORA 2FD4A 3FANA 3C5KA 5SVYA 2XOCA 1FBVA 2K4DA 5AIUA 2KYUA 2XP0A 2VJFB 2K16A 2VPGA 3MHSA 5TRBA 2LRIC 3LVQE 2JMIA 4FJCA 4Z0OA 3N9OA 3M62A 4FO9A 2H0DA 3L1XA 4O62A 5KH9A 4YC9A 5K3QA 2ECGA 3LJUX 3FL2A 2G45A 2YQMA 5D1LB 2NAAA 4N3WA 2YHOA 1LDJB 3LDYA 3RPGC 4A4CA 1WFKA 3O7AA 3O47A 2JMJA 2YVRA 4UI9B 2LN0A 2L80A 2ECVA 2F6JA 3O35A 4ZQLA 2VJEB 1Z6UA 3HCTA 4LKAA 5D1MB 2EGPA 5LKUA 1ZBDB 2VJFA 4C9ZA 2CONA 3N9NA 2M1RA 2CRRA 3SOXA 1X4JA 5LKXA 3N9QA 3GV4A 4R8PK 2RI7A 4N4FA 2YURA 5EYAF 3U5PA 3N9MA 3HCSA 3O34A 4B7YC 2L43A 1LDKC 3T7LA 1FP0A 3KV6A 2L0BA 1WILA 3QZVA 5B77A 4V3KC 1VYXA 2KKXA 4I7BA 2VPEA 2CSVA 4ZUXU 2JUNA 4FIPA 1N87A 2JM3A 4NN2A 2DJAA 3U5MA 4YADA 3PHDA 2KIZA 2CSYA 5B78A 3RPGB 2YT5A 3JUEA 4TKPB 4P5OB 3H7HA 4A4BA 3DWDA 2CRWA 3Q1DA 2MKEA 4O64A 4AUQB 2LAUA 5AITA 1WEQA 2YYRA 4XI1A 4YATA 3LRQA 1MBMA 2MT5A 5DKAA 2KWJA 2YSJA 5LCWB 2LGVA 4UP5A 3RTRB 2XB1A 3LVRE 2M13A 4Q6FA 2QIZA 1WIMA 2HYED 4GNDA 2MA6A 4F1PA 2C2VS 4X3GA 2HDPA 2K1JA 5TDWA 4CCGX 4MVTA 4PTBA 4LK9A 4LLBA 3SUBA 3L1ZB 4YABA 5C13A 5I3LA 3U5OA 3I2DA 4R7EA 4YBMA 1DCQA 4R2YA 3DQVR 3O36A 2YHNA 3O33A 1E4UA 3LQHA 1MM2A 2EODA 5B75A 4ZDTA 1DVPA 1X4IA 4Z0RA 4L58A 5DINA 2YU4A 1HYJA 1V87A 2F42A 2ECTA 2DSMA 4YBTA 2YUCA 2G6QA 2MD7B 1WEEA 2JRJA 2F6NA 4W4UA 5TBNA 5H1TA 3ZPVE 3V43A 3LQIA 3FEHA 2KU3A 2M6MA 4AYCB 1WE9A 2VNFA 3ZVYA 4YAXA 4GNGA 2PNXA 3HTKC 5G0FA 3KQIA 4AP4A 2LXHC 2IDAA 3ZTGA 4PPEA 1WEOA 4IC2A 2D8SA 4UP0A 5KH7A 2Y43A 3O70A 2M3HA 3ZNIA 2FFWA 4V3LC 2E6SA 2KE1A 4L7XA 3ZYQA 2RSDA 4GB0A 4GNFA 2VPBA 1G25A 4YBSA 1VFYA 2KWNA 3IHPA 3N9LA 2ZETC 4QF2A 5H1VA 2LGKA 3MHHA 2XEUA 2VJEA 3SOUA 4WZ2A 1MM3A 2CSZA 3FM8C 3N9PA 4BHWA 2JMDA 2LGLA 4OGCA 2DX8A 2KWOA 5SVXA 3HCUA 2Y1NA 2Y1MA 1JM7B 1WEPA 2MNYA 3KV5A 1F62A 4AYCA 2KKYA 2ECIA 2LXPC 5B79A 3ZVZB 3PLWA 2FUIA 2ECJA 2OXQC 2FSAA 2PUYA 5D1KB 4I7DA 4QQ4A 2EGMA 3ASLA 2E61A 3EB6A 3L11A 2YREA 3ZPV1 5H9MA 2YSMA 5SVIB 3VK6A 1IYMA 5G05B 2K17A 5H1UA 3C6WA 5TABA 1WEUA 5FB1A 4S3OC 2RR4A 3MDBC 5KH3A 4LJNA 2UZGA 2LGGA 5FB0A 3FAOA 3O37A 2G43A 2AN6A 4A49A 1JM7A 4H9DA 2BAYA 2I50A 2P57A 3U5NA
chains in the Genus database with same CATH topology
4LADB 2MUMA 1T1HA 3EB5A 2L75A 2CKLB 4WA6A 1WESA 1X4UA 5C11A 2MIQA 4BBQA 4WZ3B 2QJ0A 4A0CD 1RMDA 1WGMA 2YQLA 3KNVA 2ECNA 1WEVA 4CA1A 2VPDA 2MNZA 2L5UA 2LQ6A 2ECWA 5FERA 5J3XA 4MSXA 3SHBA 4B86C 3LQJA 4AVXA 1WEMA 1HYIA 1CHCA 1XWHA 2KGIA 2LV9A 2CT2A 5G04B 2YW8A 2KR4A 2QICA 3DPLR 2KFTA 5TDRA 4GNEA 4S3OB 3NG2A 3M99A 2FUUA 2MA5A 2KREA 2CKLA 1Z2QA 1K2FA 1JOCA 4WZ0A 5B8DA 5LKZA 1U6GB 1WENA 2H0DB 4IC3A 1Z60A 4F52B 3SOWA 3T6RA 3PURA 2VP7A 2KWKA 1VD4A 5LKTA 3GL6A 2KGGA 4QF3A 4I7CA 4FK5A 1WEWA 2EA6A 2M85A 3M63A 2MD8C 2LDRA 5B76A 5FEYA 2C2LA 5JG6A 3PUQA 2E6RA 1BORA 3C5KA 1FBVA 2K4DA 5AIUA 2KYUA 5TRBA 2VJFB 2K16A 2VPGA 3MHSA 2LRIC 2JMIA 4FJCA 3N9OA 3M62A 4FO9A 2H0DA 3L1XA 5KH9A 4YC9A 2ECGA 3FL2A 2G45A 2YQMA 5D1LB 2NAAA 4N3WA 2YHOA 1LDJB 3RPGC 4A4CA 1WFKA 3O7AA 2JMJA 4UI9B 2LN0A 2L80A 2ECVA 2F6JA 3O35A 4ZQLA 2VJEB 1Z6UA 3HCTA 4LKAA 5D1MB 2EGPA 5LKUA 1ZBDB 2VJFA 4C9ZA 3N9NA 2M1RA 3SOXA 1X4JA 5LKXA 3N9QA 3GV4A 4R8PK 2RI7A 4N4FA 2YURA 5EYAF 3U5PA 3N9MA 3HCSA 3O34A 4B7YC 2L43A 1LDKC 3T7LA 1FP0A 3KV6A 2L0BA 1WILA 3QZVA 5B77A 4V3KC 1VYXA 4I7BA 2VPEA 4ZUXU 4FIPA 1N87A 4NN2A 3U5MA 4YADA 3PHDA 2KIZA 2CSYA 5B78A 3RPGB 2YT5A 4TKPB 4P5OB 4A4BA 4O64A 4AUQB 5AITA 1WEQA 2YYRA 4XI1A 4YATA 3LRQA 2MT5A 5DKAA 2KWJA 2YSJA 5LCWB 2LGVA 4UP5A 3RTRB 2XB1A 4Q6FA 2QIZA 1WIMA 2HYED 4GNDA 2MA6A 2C2VS 4X3GA 2HDPA 2K1JA 5TDWA 4CCGX 4MVTA 4PTBA 4LK9A 4LLBA 3L1ZB 4YABA 5C13A 5I3LA 3U5OA 3I2DA 4R7EA 4YBMA 4R2YA 3DQVR 3O36A 2YHNA 3O33A 1E4UA 3LQHA 1MM2A 2EODA 5B75A 4ZDTA 1DVPA 1X4IA 4L58A 5DINA 2YU4A 1HYJA 1V87A 2F42A 2ECTA 4YBTA 2YUCA 2G6QA 2MD7B 1WEEA 2JRJA 2F6NA 4W4UA 5TBNA 5H1TA 3ZPVE 3V43A 3LQIA 2KU3A 2M6MA 4AYCB 1WE9A 2VNFA 3ZVYA 4YAXA 4GNGA 2PNXA 3HTKC 5G0FA 3KQIA 4AP4A 2LXHC 2IDAA 3ZTGA 4PPEA 1WEOA 4IC2A 2D8SA 4UP0A 5KH7A 2Y43A 3O70A 2M3HA 3ZNIA 4V3LC 2E6SA 2KE1A 4L7XA 3ZYQA 2RSDA 4GB0A 4GNFA 2VPBA 1G25A 4YBSA 1VFYA 2KWNA 3IHPA 3N9LA 2ZETC 4QF2A 5H1VA 2LGKA 3MHHA 2XEUA 2VJEA 3SOUA 4WZ2A 1MM3A 2CSZA 3N9PA 4BHWA 2JMDA 2LGLA 2DX8A 2KWOA 3HCUA 2Y1NA 2Y1MA 1JM7B 1WEPA 2MNYA 3KV5A 1F62A 4AYCA 2ECIA 2LXPC 5B79A 3ZVZB 2FUIA 2ECJA 2OXQC 2FSAA 2PUYA 5D1KB 4I7DA 3ASLA 3EB6A 3L11A 2YREA 3ZPV1 5H9MA 2YSMA 3VK6A 1IYMA 5G05B 2K17A 5H1UA 3C6WA 5TABA 1WEUA 5FB1A 4S3OC 5KH3A 4LJNA 2UZGA 2LGGA 5FB0A 3O37A 2G43A 2AN6A 4A49A 1JM7A 2BAYA 2I50A 3U5NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LAD B;  2MUM A;  1T1H A;  3EB5 A;  2L75 A;  2CKL B;  4WA6 A;  1WES A;  1X4U A;  5C11 A;  2MIQ A;  4BBQ A;  4WZ3 B;  2QJ0 A;  4A0C D;  1RMD A;  1WGM A;  2YQL A;  3KNV A;  2ECN A;  1WEV A;  4CA1 A;  2VPD A;  2MNZ A;  2L5U A;  2LQ6 A;  2ECW A;  5FER A;  5J3X A;  4MSX A;  3SHB A;  4B86 C;  3LQJ A;  4AVX A;  1WEM A;  1HYI A;  1CHC A;  1XWH A;  2KGI A;  2LV9 A;  2CT2 A;  5G04 B;  2YW8 A;  2KR4 A;  2QIC A;  3DPL R;  2KFT A;  5TDR A;  4GNE A;  4S3O B;  3NG2 A;  3M99 A;  2FUU A;  2MA5 A;  2KRE A;  2CKL A;  1Z2Q A;  1K2F A;  1JOC A;  4WZ0 A;  5B8D A;  5LKZ A;  1U6G B;  1WEN A;  2H0D B;  4IC3 A;  1Z60 A;  4F52 B;  3SOW A;  3T6R A;  3PUR A;  2VP7 A;  2KWK A;  1VD4 A;  5LKT A;  3GL6 A;  2KGG A;  4QF3 A;  4I7C A;  4FK5 A;  1WEW A;  2EA6 A;  2M85 A;  3M63 A;  2MD8 C;  2LDR A;  5B76 A;  5FEY A;  2C2L A;  5JG6 A;  3PUQ A;  2E6R A;  1BOR A;  3C5K A;  1FBV A;  2K4D A;  5AIU A;  2KYU A;  5TRB A;  2VJF B;  2K16 A;  2VPG A;  3MHS A;  2LRI C;  2JMI A;  4FJC A;  3N9O A;  3M62 A;  4FO9 A;  2H0D A;  3L1X A;  5KH9 A;  4YC9 A;  2ECG A;  3FL2 A;  2G45 A;  2YQM A;  5D1L B;  2NAA A;  4N3W A;  2YHO A;  1LDJ B;  3RPG C;  4A4C A;  1WFK A;  3O7A A;  2JMJ A;  4UI9 B;  2LN0 A;  2L80 A;  2ECV A;  2F6J A;  3O35 A;  4ZQL A;  2VJE B;  1Z6U A;  3HCT A;  4LKA A;  5D1M B;  2EGP A;  5LKU A;  1ZBD B;  2VJF A;  4C9Z A;  3N9N A;  2M1R A;  3SOX A;  1X4J A;  5LKX A;  3N9Q A;  3GV4 A;  4R8P K;  2RI7 A;  4N4F A;  2YUR A;  5EYA F;  3U5P A;  3N9M A;  3HCS A;  3O34 A;  4B7Y C;  2L43 A;  1LDK C;  3T7L A;  1FP0 A;  3KV6 A;  2L0B A;  1WIL A;  3QZV A;  5B77 A;  4V3K C;  1VYX A;  4I7B A;  2VPE A;  4ZUX U;  4FIP A;  1N87 A;  4NN2 A;  3U5M A;  4YAD A;  3PHD A;  2KIZ A;  2CSY A;  5B78 A;  3RPG B;  2YT5 A;  4TKP B;  4P5O B;  4A4B A;  4O64 A;  4AUQ B;  5AIT A;  1WEQ A;  2YYR A;  4XI1 A;  4YAT A;  3LRQ A;  2MT5 A;  5DKA A;  2KWJ A;  2YSJ A;  5LCW B;  2LGV A;  4UP5 A;  3RTR B;  2XB1 A;  4Q6F A;  2QIZ A;  1WIM A;  2HYE D;  4GND A;  2MA6 A;  2C2V S;  4X3G A;  2HDP A;  2K1J A;  5TDW A;  4CCG X;  4MVT A;  4PTB A;  4LK9 A;  4LLB A;  3L1Z B;  4YAB A;  5C13 A;  5I3L A;  3U5O A;  3I2D A;  4R7E A;  4YBM A;  4R2Y A;  3DQV R;  3O36 A;  2YHN A;  3O33 A;  1E4U A;  3LQH A;  1MM2 A;  2EOD A;  5B75 A;  4ZDT A;  1DVP A;  1X4I A;  4L58 A;  5DIN A;  2YU4 A;  1HYJ A;  1V87 A;  2F42 A;  2ECT A;  4YBT A;  2YUC A;  2G6Q A;  2MD7 B;  1WEE A;  2JRJ A;  2F6N A;  4W4U A;  5TBN A;  5H1T A;  3ZPV E;  3V43 A;  3LQI A;  2KU3 A;  2M6M A;  4AYC B;  1WE9 A;  2VNF A;  3ZVY A;  4YAX A;  4GNG A;  2PNX A;  3HTK C;  5G0F A;  3KQI A;  4AP4 A;  2LXH C;  2IDA A;  3ZTG A;  4PPE A;  1WEO A;  4IC2 A;  2D8S A;  4UP0 A;  5KH7 A;  2Y43 A;  3O70 A;  2M3H A;  3ZNI A;  4V3L C;  2E6S A;  2KE1 A;  4L7X A;  3ZYQ A;  2RSD A;  4GB0 A;  4GNF A;  2VPB A;  1G25 A;  4YBS A;  1VFY A;  2KWN A;  3IHP A;  3N9L A;  2ZET C;  4QF2 A;  5H1V A;  2LGK A;  3MHH A;  2XEU A;  2VJE A;  3SOU A;  4WZ2 A;  1MM3 A;  2CSZ A;  3N9P A;  4BHW A;  2JMD A;  2LGL A;  2DX8 A;  2KWO A;  3HCU A;  2Y1N A;  2Y1M A;  1JM7 B;  1WEP A;  2MNY A;  3KV5 A;  1F62 A;  4AYC A;  2ECI A;  2LXP C;  5B79 A;  3ZVZ B;  2FUI A;  2ECJ A;  2OXQ C;  2FSA A;  2PUY A;  5D1K B;  4I7D A;  3ASL A;  3EB6 A;  3L11 A;  2YRE A;  3ZPV 1;  5H9M A;  2YSM A;  3VK6 A;  1IYM A;  5G05 B;  2K17 A;  5H1U A;  3C6W A;  5TAB A;  1WEU A;  5FB1 A;  4S3O C;  5KH3 A;  4LJN A;  2UZG A;  2LGG A;  5FB0 A;  3O37 A;  2G43 A;  2AN6 A;  4A49 A;  1JM7 A;  2BAY A;  2I50 A;  3U5N A; 
#chains in the Genus database with same CATH topology
 3KDE C;  4LAD B;  2MUM A;  1T1H A;  3EB5 A;  2L75 A;  2B0O E;  2CKL B;  4WA6 A;  1WES A;  1X4U A;  2OWA A;  5C11 A;  2MIQ A;  4BBQ A;  4WZ3 B;  5SVI A;  2QJ0 A;  4A0C D;  1RMD A;  1WGM A;  2XOZ A;  2YQL A;  3KNV A;  2ECN A;  1WEV A;  2XOY A;  4CA1 A;  2VPD A;  2MNZ A;  2L5U A;  2LQ6 A;  2ECW A;  2D8U A;  5FER A;  5J3X A;  4MSX A;  3SHB A;  4B86 C;  3LQJ A;  4AVX A;  1WEM A;  1HYI A;  1CHC A;  1XWH A;  2KGI A;  2LV9 A;  2CT2 A;  5G04 B;  2YW8 A;  2EXU A;  2KR4 A;  2QIC A;  3DPL R;  2KFT A;  5TDR A;  4GNE A;  4S3O B;  3NG2 A;  3M99 A;  2FUU A;  2MA5 A;  2KRE A;  2CKL A;  3T9K A;  1Z2Q A;  1K2F A;  1JOC A;  4WZ0 A;  5B8D A;  3FJU B;  5LKZ A;  2IQJ A;  1U6G B;  1WEN A;  2H0D B;  4IC3 A;  4OGE A;  1Z60 A;  3M7K A;  4F52 B;  3SOW A;  3T6R A;  3DDT A;  3PUR A;  2VP7 A;  2KWK A;  1VD4 A;  5LKT A;  3GL6 A;  2KGG A;  4QF3 A;  4I7C A;  4FK5 A;  1WEW A;  2EA6 A;  2M85 A;  3M63 A;  2MD8 C;  2LDR A;  5B76 A;  5FEY A;  3E2D A;  2C2L A;  2L7P A;  5JG6 A;  3PUQ A;  2E6R A;  1BOR A;  2FD4 A;  3FAN A;  3C5K A;  5SVY A;  2XOC A;  1FBV A;  2K4D A;  5AIU A;  2KYU A;  2XP0 A;  2VJF B;  2K16 A;  2VPG A;  3MHS A;  5TRB A;  2LRI C;  3LVQ E;  2JMI A;  4FJC A;  4Z0O A;  3N9O A;  3M62 A;  4FO9 A;  2H0D A;  3L1X A;  4O62 A;  5KH9 A;  4YC9 A;  5K3Q A;  2ECG A;  3LJU X;  3FL2 A;  2G45 A;  2YQM A;  5D1L B;  2NAA A;  4N3W A;  2YHO A;  1LDJ B;  3LDY A;  3RPG C;  4A4C A;  1WFK A;  3O7A A;  3O47 A;  2JMJ A;  2YVR A;  4UI9 B;  2LN0 A;  2L80 A;  2ECV A;  2F6J A;  3O35 A;  4ZQL A;  2VJE B;  1Z6U A;  3HCT A;  4LKA A;  5D1M B;  2EGP A;  5LKU A;  1ZBD B;  2VJF A;  4C9Z A;  2CON A;  3N9N A;  2M1R A;  2CRR A;  3SOX A;  1X4J A;  5LKX A;  3N9Q A;  3GV4 A;  4R8P K;  2RI7 A;  4N4F A;  2YUR A;  5EYA F;  3U5P A;  3N9M A;  3HCS A;  3O34 A;  4B7Y C;  2L43 A;  1LDK C;  3T7L A;  1FP0 A;  3KV6 A;  2L0B A;  1WIL A;  3QZV A;  5B77 A;  4V3K C;  1VYX A;  2KKX A;  4I7B A;  2VPE A;  2CSV A;  4ZUX U;  2JUN A;  4FIP A;  1N87 A;  2JM3 A;  4NN2 A;  2DJA A;  3U5M A;  4YAD A;  3PHD A;  2KIZ A;  2CSY A;  5B78 A;  3RPG B;  2YT5 A;  3JUE A;  4TKP B;  4P5O B;  3H7H A;  4A4B A;  3DWD A;  2CRW A;  3Q1D A;  2MKE A;  4O64 A;  4AUQ B;  2LAU A;  5AIT A;  1WEQ A;  2YYR A;  4XI1 A;  4YAT A;  3LRQ A;  1MBM A;  2MT5 A;  5DKA A;  2KWJ A;  2YSJ A;  5LCW B;  2LGV A;  4UP5 A;  3RTR B;  2XB1 A;  3LVR E;  2M13 A;  4Q6F A;  2QIZ A;  1WIM A;  2HYE D;  4GND A;  2MA6 A;  4F1P A;  2C2V S;  4X3G A;  2HDP A;  2K1J A;  5TDW A;  4CCG X;  4MVT A;  4PTB A;  4LK9 A;  4LLB A;  3SUB A;  3L1Z B;  4YAB A;  5C13 A;  5I3L A;  3U5O A;  3I2D A;  4R7E A;  4YBM A;  1DCQ A;  4R2Y A;  3DQV R;  3O36 A;  2YHN A;  3O33 A;  1E4U A;  3LQH A;  1MM2 A;  2EOD A;  5B75 A;  4ZDT A;  1DVP A;  1X4I A;  4Z0R A;  4L58 A;  5DIN A;  2YU4 A;  1HYJ A;  1V87 A;  2F42 A;  2ECT A;  2DSM A;  4YBT A;  2YUC A;  2G6Q A;  2MD7 B;  1WEE A;  2JRJ A;  2F6N A;  4W4U A;  5TBN A;  5H1T A;  3ZPV E;  3V43 A;  3LQI A;  3FEH A;  2KU3 A;  2M6M A;  4AYC B;  1WE9 A;  2VNF A;  3ZVY A;  4YAX A;  4GNG A;  2PNX A;  3HTK C;  5G0F A;  3KQI A;  4AP4 A;  2LXH C;  2IDA A;  3ZTG A;  4PPE A;  1WEO A;  4IC2 A;  2D8S A;  4UP0 A;  5KH7 A;  2Y43 A;  3O70 A;  2M3H A;  3ZNI A;  2FFW A;  4V3L C;  2E6S A;  2KE1 A;  4L7X A;  3ZYQ A;  2RSD A;  4GB0 A;  4GNF A;  2VPB A;  1G25 A;  4YBS A;  1VFY A;  2KWN A;  3IHP A;  3N9L A;  2ZET C;  4QF2 A;  5H1V A;  2LGK A;  3MHH A;  2XEU A;  2VJE A;  3SOU A;  4WZ2 A;  1MM3 A;  2CSZ A;  3FM8 C;  3N9P A;  4BHW A;  2JMD A;  2LGL A;  4OGC A;  2DX8 A;  2KWO A;  5SVX A;  3HCU A;  2Y1N A;  2Y1M A;  1JM7 B;  1WEP A;  2MNY A;  3KV5 A;  1F62 A;  4AYC A;  2KKY A;  2ECI A;  2LXP C;  5B79 A;  3ZVZ B;  3PLW A;  2FUI A;  2ECJ A;  2OXQ C;  2FSA A;  2PUY A;  5D1K B;  4I7D A;  4QQ4 A;  2EGM A;  3ASL A;  2E61 A;  3EB6 A;  3L11 A;  2YRE A;  3ZPV 1;  5H9M A;  2YSM A;  5SVI B;  3VK6 A;  1IYM A;  5G05 B;  2K17 A;  5H1U A;  3C6W A;  5TAB A;  1WEU A;  5FB1 A;  4S3O C;  2RR4 A;  3MDB C;  5KH3 A;  4LJN A;  2UZG A;  2LGG A;  5FB0 A;  3FAO A;  3O37 A;  2G43 A;  2AN6 A;  4A49 A;  1JM7 A;  4H9D A;  2BAY A;  2I50 A;  2P57 A;  3U5N A; 
#chains in the Genus database with same CATH homology
 4LAD B;  2MUM A;  1T1H A;  3EB5 A;  2L75 A;  2CKL B;  4WA6 A;  1WES A;  1X4U A;  5C11 A;  2MIQ A;  4BBQ A;  4WZ3 B;  2QJ0 A;  4A0C D;  1RMD A;  1WGM A;  2YQL A;  3KNV A;  2ECN A;  1WEV A;  4CA1 A;  2VPD A;  2MNZ A;  2L5U A;  2LQ6 A;  2ECW A;  5FER A;  5J3X A;  4MSX A;  3SHB A;  4B86 C;  3LQJ A;  4AVX A;  1WEM A;  1HYI A;  1CHC A;  1XWH A;  2KGI A;  2LV9 A;  2CT2 A;  5G04 B;  2YW8 A;  2KR4 A;  2QIC A;  3DPL R;  2KFT A;  5TDR A;  4GNE A;  4S3O B;  3NG2 A;  3M99 A;  2FUU A;  2MA5 A;  2KRE A;  2CKL A;  1Z2Q A;  1K2F A;  1JOC A;  4WZ0 A;  5B8D A;  5LKZ A;  1U6G B;  1WEN A;  2H0D B;  4IC3 A;  1Z60 A;  4F52 B;  3SOW A;  3T6R A;  3PUR A;  2VP7 A;  2KWK A;  1VD4 A;  5LKT A;  3GL6 A;  2KGG A;  4QF3 A;  4I7C A;  4FK5 A;  1WEW A;  2EA6 A;  2M85 A;  3M63 A;  2MD8 C;  2LDR A;  5B76 A;  5FEY A;  2C2L A;  5JG6 A;  3PUQ A;  2E6R A;  1BOR A;  3C5K A;  1FBV A;  2K4D A;  5AIU A;  2KYU A;  5TRB A;  2VJF B;  2K16 A;  2VPG A;  3MHS A;  2LRI C;  2JMI A;  4FJC A;  3N9O A;  3M62 A;  4FO9 A;  2H0D A;  3L1X A;  5KH9 A;  4YC9 A;  2ECG A;  3FL2 A;  2G45 A;  2YQM A;  5D1L B;  2NAA A;  4N3W A;  2YHO A;  1LDJ B;  3RPG C;  4A4C A;  1WFK A;  3O7A A;  2JMJ A;  4UI9 B;  2LN0 A;  2L80 A;  2ECV A;  2F6J A;  3O35 A;  4ZQL A;  2VJE B;  1Z6U A;  3HCT A;  4LKA A;  5D1M B;  2EGP A;  5LKU A;  1ZBD B;  2VJF A;  4C9Z A;  3N9N A;  2M1R A;  3SOX A;  1X4J A;  5LKX A;  3N9Q A;  3GV4 A;  4R8P K;  2RI7 A;  4N4F A;  2YUR A;  5EYA F;  3U5P A;  3N9M A;  3HCS A;  3O34 A;  4B7Y C;  2L43 A;  1LDK C;  3T7L A;  1FP0 A;  3KV6 A;  2L0B A;  1WIL A;  3QZV A;  5B77 A;  4V3K C;  1VYX A;  4I7B A;  2VPE A;  4ZUX U;  4FIP A;  1N87 A;  4NN2 A;  3U5M A;  4YAD A;  3PHD A;  2KIZ A;  2CSY A;  5B78 A;  3RPG B;  2YT5 A;  4TKP B;  4P5O B;  4A4B A;  4O64 A;  4AUQ B;  5AIT A;  1WEQ A;  2YYR A;  4XI1 A;  4YAT A;  3LRQ A;  2MT5 A;  5DKA A;  2KWJ A;  2YSJ A;  5LCW B;  2LGV A;  4UP5 A;  3RTR B;  2XB1 A;  4Q6F A;  2QIZ A;  1WIM A;  2HYE D;  4GND A;  2MA6 A;  2C2V S;  4X3G A;  2HDP A;  2K1J A;  5TDW A;  4CCG X;  4MVT A;  4PTB A;  4LK9 A;  4LLB A;  3L1Z B;  4YAB A;  5C13 A;  5I3L A;  3U5O A;  3I2D A;  4R7E A;  4YBM A;  4R2Y A;  3DQV R;  3O36 A;  2YHN A;  3O33 A;  1E4U A;  3LQH A;  1MM2 A;  2EOD A;  5B75 A;  4ZDT A;  1DVP A;  1X4I A;  4L58 A;  5DIN A;  2YU4 A;  1HYJ A;  1V87 A;  2F42 A;  2ECT A;  4YBT A;  2YUC A;  2G6Q A;  2MD7 B;  1WEE A;  2JRJ A;  2F6N A;  4W4U A;  5TBN A;  5H1T A;  3ZPV E;  3V43 A;  3LQI A;  2KU3 A;  2M6M A;  4AYC B;  1WE9 A;  2VNF A;  3ZVY A;  4YAX A;  4GNG A;  2PNX A;  3HTK C;  5G0F A;  3KQI A;  4AP4 A;  2LXH C;  2IDA A;  3ZTG A;  4PPE A;  1WEO A;  4IC2 A;  2D8S A;  4UP0 A;  5KH7 A;  2Y43 A;  3O70 A;  2M3H A;  3ZNI A;  4V3L C;  2E6S A;  2KE1 A;  4L7X A;  3ZYQ A;  2RSD A;  4GB0 A;  4GNF A;  2VPB A;  1G25 A;  4YBS A;  1VFY A;  2KWN A;  3IHP A;  3N9L A;  2ZET C;  4QF2 A;  5H1V A;  2LGK A;  3MHH A;  2XEU A;  2VJE A;  3SOU A;  4WZ2 A;  1MM3 A;  2CSZ A;  3N9P A;  4BHW A;  2JMD A;  2LGL A;  2DX8 A;  2KWO A;  3HCU A;  2Y1N A;  2Y1M A;  1JM7 B;  1WEP A;  2MNY A;  3KV5 A;  1F62 A;  4AYC A;  2ECI A;  2LXP C;  5B79 A;  3ZVZ B;  2FUI A;  2ECJ A;  2OXQ C;  2FSA A;  2PUY A;  5D1K B;  4I7D A;  3ASL A;  3EB6 A;  3L11 A;  2YRE A;  3ZPV 1;  5H9M A;  2YSM A;  3VK6 A;  1IYM A;  5G05 B;  2K17 A;  5H1U A;  3C6W A;  5TAB A;  1WEU A;  5FB1 A;  4S3O C;  5KH3 A;  4LJN A;  2UZG A;  2LGG A;  5FB0 A;  3O37 A;  2G43 A;  2AN6 A;  4A49 A;  1JM7 A;  2BAY A;  2I50 A;  3U5N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...