4PPEA

Human rnf4 ring domain
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
66
structure length
66
Chain Sequence
RPSGTVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKNANTCPTCRKKINHKRYHPIYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase RNF4
publication title RNF4 interacts with both SUMO and nucleosomes to promote the DNA damage response.
pubmed doi rcsb
source organism Homo sapiens
total genus 9
structure length 66
sequence length 66
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2014-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13639 zf-RING_2 Ring finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4ppeA00
3RTRB 2MA5A 2KWOA 2D8SA 1VD4A 1HYIA 3PURA 4I7CA 3GV4A 2E6RA 4IC2A 4LK9A 1IYMA 4A49A 3O35A 2YSMA 4YC9A 1WEEA 2VPEA 1Z2QA 2VP7A 4WZ3B 4B7YC 2M1RA 2YW8A 2PUYA 1MM2A 2CSYA 5FB0A 4TKPB 5G0FA 4FIPA 3M99A 2NAAA 2FSAA 4WZ2A 2LXPC 4YADA 2ECTA 1WESA 5G04B 2K4DA 2Y43A 2VJEA 2JMIA 4PPEA 3ZPV1 1LDKC 4I7DA 2E6SA 4LJNA 5D1LB 2CT2A 3U5PA 2JMJA 5LCWB 2G6QA 2MNZA 4A0CD 1X4IA 5B77A 3ASLA 2KWKA 3ZTGA 1WEMA 4A4BA 1WEPA 2LDRA 3HTKC 2H0DA 4WA6A 5D1KB 2KYUA 5B75A 2YHOA 2MD7B 4AUQB 1X4JA 2AN6A 4AYCA 2F6NA 2YT5A 3LQIA 4GNDA 3KQIA 1DVPA 2KU3A 1WFKA 4A4CA 2YSJA 4L7XA 3U5NA 2F42A 1WE9A 2M6MA 5JG6A 4L58A 3ZPVE 3N9NA 1VYXA 3ZVYA 2EA6A 4YATA 2KR4A 4BHWA 3O7AA 2YHNA 5D1MB 2QJ0A 3I2DA 2YUCA 2K1JA 3N9MA 2KGIA 2MNYA 3EB5A 5B8DA 3VK6A 5H9MA 4FK5A 3U5OA 1JM7A 4LADB 1WGMA 5FB1A 1Z60A 2KGGA 4IC3A 2KIZA 2G45A 1CHCA 3N9QA 3O37A 4R7EA 2UZGA 4S3OC 1FBVA 5LKTA 4YBTA 2JMDA 4N3WA 4WZ0A 1JM7B 3O33A 1HYJA 2YYRA 3C6WA 4MSXA 3DQVR 4QF2A 1WEWA 3QZVA 3O70A 2LRIC 2HDPA 2HYED 4AP4A 2MD8C 4R8PK 2LXHC 5J3XA 4AVXA 3PUQA 4YBMA 2YURA 1G25A 3T6RA 4UP5A 5I3LA 4ZUXU 1MM3A 4F52B 4Q6FA 2LGLA 3SOWA 5TDWA 1WENA 2CKLB 3GL6A 2I50A 5C13A 5LKZA 2ECNA 2MIQA 3KV6A 3ZYQA 2MUMA 2YREA 4O64A 3M62A 5EYAF 1RMDA 5DINA 2LN0A 4GB0A 4BBQA 2QICA 3L11A 2M3HA 2MA6A 3FL2A 3HCUA 4C9ZA 1WEOA 2M85A 3HCSA 3SHBA 5TBNA 1F62A 2VJFB 4YABA 3NG2A 4LKAA 3KNVA 2YU4A 2EGPA 2Y1MA 3SOXA 1T1HA 4NN2A 2OXQC 3L1XA 4GNEA 4ZDTA 4S3OB 4YAXA 3LRQA 3IHPA 5B76A 4P5OB 3LQJA 2G43A 2BAYA 2ECJA 2C2LA 2YQMA 1U6GB 4LLBA 3M63A 5LKXA 5TRBA 1FP0A 3KV5A 1X4UA 4PTBA 4B86C 5TABA 2LGGA 2LGKA 2VPBA 4V3KC 1XWHA 3RPGB 2VNFA 2KREA 1V87A 5B79A 5KH9A 2QIZA 2KWNA 4UP0A 1LDJB 2Y1NA 2L0BA 2ECVA 4X3GA 5FERA 2KFTA 2K16A 2VPGA 3U5MA 2CKLA 4CA1A 3HCTA 4I7BA 2XB1A 4FJCA 3RPGC 5B78A 4W4UA 2XEUA 1JOCA 2L5UA 3T7LA 1K2FA 2ECIA 2PNXA 4N4FA 4UI9B 2L80A 5H1UA 2K17A 1WILA 5AITA 2LGVA 3C5KA 1WEUA 5FEYA 5KH3A 2CSZA 3LQHA 2VJFA 2YQLA 5G05B 3O36A 3SOUA 2FUIA 5KH7A 1WEQA 3MHHA 1N87A 3N9OA 2L75A 2KE1A 3V43A 4CCGX 2VJEB 5H1TA 2KWJA 3L1ZB 2ECWA 5DKAA 4GNFA 2VPDA 4ZQLA 2LV9A 5AIUA 2F6JA 4QF3A 1WEVA 2IDAA 4FO9A 1WIMA 2EODA 1BORA 3O34A 4YBSA 2ECGA 3ZVZB 2L43A 2DX8A 1E4UA 2RI7A 1VFYA 5LKUA 3EB6A 5H1VA 2H0DB 3PHDA 4GNGA 4R2YA 5C11A 3N9PA 1Z6UA 4AYCB 2FUUA 2RSDA 3DPLR 5TDRA 3ZNIA 2MT5A 3N9LA 4XI1A 2C2VS 1ZBDB 4MVTA 2LQ6A 4V3LC 2ZETC 2JRJA 3MHSA
chains in the Genus database with same CATH superfamily
3O47A 3RTRB 2MA5A 2KWOA 2D8SA 1VD4A 1HYIA 2LAUA 3PURA 4I7CA 4OGCA 3GV4A 2E6RA 4IC2A 4F1PA 4LK9A 3JUEA 1IYMA 4A49A 3FM8C 3O35A 2YSMA 4YC9A 1WEEA 2VPEA 2IQJA 1Z2QA 2VP7A 4WZ3B 4B7YC 2M1RA 2EGMA 2YW8A 2PUYA 1MM2A 2CSYA 5FB0A 4TKPB 5G0FA 4FIPA 3M99A 2NAAA 2FSAA 2L7PA 2LXPC 4WZ2A 4YADA 2ECTA 1WESA 5G04B 2K4DA 2Y43A 2VJEA 2JMIA 4PPEA 3ZPV1 1LDKC 4I7DA 2CRRA 2E6SA 4LJNA 5D1LB 2CT2A 3U5PA 2JMJA 5LCWB 2G6QA 2MNZA 4A0CD 1X4IA 5B77A 3ASLA 2KWKA 2JM3A 3ZTGA 1WEMA 4A4BA 1WEPA 2LDRA 4QQ4A 3HTKC 2H0DA 4WA6A 2M13A 5D1KB 2KYUA 2KKYA 5B75A 2YHOA 2MD7B 5SVIB 4AUQB 3FAOA 1X4JA 2AN6A 4AYCA 2F6NA 3Q1DA 2YT5A 3LQIA 4GNDA 3KQIA 1DVPA 2KU3A 1WFKA 4A4CA 2YSJA 4L7XA 3U5NA 2F42A 1WE9A 2M6MA 5JG6A 3FEHA 4L58A 3ZPVE 3N9NA 1VYXA 3ZVYA 2EA6A 2E61A 4YATA 2KR4A 4BHWA 2FFWA 3O7AA 2YHNA 5D1MB 2QJ0A 3I2DA 2YUCA 2K1JA 3N9MA 2KGIA 2MNYA 3EB5A 5B8DA 3VK6A 5H9MA 4FK5A 3U5OA 1JM7A 4OGEA 4LADB 1WGMA 5FB1A 1Z60A 2KGGA 4IC3A 2KIZA 2CRWA 2G45A 1CHCA 3N9QA 3O37A 4O62A 4R7EA 2UZGA 4S3OC 3LJUX 1FBVA 5LKTA 4YBTA 2JMDA 4N3WA 4WZ0A 1JM7B 3O33A 1HYJA 2YYRA 3C6WA 4MSXA 2XOZA 3DQVR 4QF2A 2DSMA 1WEWA 3QZVA 3O70A 2FD4A 2LRIC 2HDPA 2HYED 4AP4A 2MD8C 4R8PK 5SVYA 2LXHC 5J3XA 4AVXA 3PUQA 4YBMA 2YURA 1MBMA 1G25A 3T6RA 4UP5A 5I3LA 4ZUXU 1MM3A 2YVRA 4F52B 4Q6FA 2LGLA 2RR4A 3SOWA 2XOYA 5SVIA 5TDWA 1WENA 2CKLB 3GL6A 2I50A 5C13A 5LKZA 2ECNA 2P57A 2MIQA 3KV6A 3ZYQA 2MUMA 2YREA 4O64A 3M62A 2XP0A 3LVRE 5EYAF 1RMDA 5DINA 2EXUA 2LN0A 4GB0A 3FJUB 4BBQA 3LDYA 2QICA 3FANA 3L11A 2M3HA 2MA6A 3FL2A 3HCUA 4C9ZA 1WEOA 2M85A 3HCSA 3SHBA 5TBNA 1F62A 2VJFB 4YABA 3NG2A 3E2DA 4LKAA 3KNVA 2YU4A 2EGPA 2Y1MA 3SOXA 1T1HA 4NN2A 2OXQC 3L1XA 4GNEA 4ZDTA 4S3OB 4YAXA 3LRQA 3IHPA 5SVXA 5B76A 4P5OB 3LQJA 2G43A 2BAYA 2ECJA 2C2LA 2YQMA 1U6GB 4LLBA 3M63A 5LKXA 5TRBA 1FP0A 3KV5A 5K3QA 1X4UA 4PTBA 4B86C 5TABA 2LGGA 2LGKA 2VPBA 4V3KC 1XWHA 3RPGB 2VNFA 2KREA 1V87A 2D8UA 5KH9A 2QIZA 5B79A 3SUBA 2KWNA 4UP0A 1LDJB 2Y1NA 2L0BA 2ECVA 4X3GA 5FERA 2KFTA 2K16A 2VPGA 3U5MA 2CKLA 4CA1A 3HCTA 4I7BA 2XB1A 4FJCA 3RPGC 5B78A 4W4UA 2XEUA 1JOCA 2L5UA 3T7LA 1K2FA 2ECIA 2PNXA 4N4FA 4UI9B 2L80A 5H1UA 2K17A 4Z0OA 1WILA 5AITA 2LGVA 3C5KA 1WEUA 5FEYA 1DCQA 3DDTA 5KH3A 2CSZA 2KKXA 3LQHA 3T9KA 3M7KA 2VJFA 2YQLA 5G05B 2CONA 3MDBC 3O36A 3SOUA 2FUIA 5KH7A 1WEQA 3MHHA 1N87A 2JUNA 4Z0RA 3N9OA 2L75A 2KE1A 3V43A 3H7HA 4CCGX 2VJEB 5H1TA 2KWJA 3L1ZB 2ECWA 5DKAA 4GNFA 2VPDA 4ZQLA 2LV9A 5AIUA 2F6JA 2MKEA 4QF3A 1WEVA 4H9DA 2IDAA 4FO9A 1WIMA 2EODA 1BORA 3O34A 4YBSA 3KDEC 2ECGA 3ZVZB 2L43A 2DX8A 3DWDA 1E4UA 2RI7A 1VFYA 5LKUA 3EB6A 5H1VA 2H0DB 3PHDA 2DJAA 4GNGA 4R2YA 5C11A 3LVQE 2CSVA 3N9PA 1Z6UA 4AYCB 2FUUA 2XOCA 2RSDA 3DPLR 3PLWA 5TDRA 3ZNIA 2MT5A 3N9LA 4XI1A 2B0OE 2C2VS 1ZBDB 4MVTA 2LQ6A 4V3LC 2OWAA 2ZETC 2JRJA 3MHSA
chains in the Genus database with same CATH topology
3RTRB 2MA5A 2KWOA 2D8SA 1VD4A 1HYIA 3PURA 4I7CA 3GV4A 2E6RA 4IC2A 4LK9A 1IYMA 4A49A 3O35A 2YSMA 4YC9A 1WEEA 2VPEA 1Z2QA 2VP7A 4WZ3B 4B7YC 2M1RA 2YW8A 2PUYA 1MM2A 2CSYA 5FB0A 4TKPB 5G0FA 4FIPA 3M99A 2NAAA 2FSAA 4WZ2A 2LXPC 4YADA 2ECTA 1WESA 5G04B 2K4DA 2Y43A 2VJEA 2JMIA 4PPEA 3ZPV1 1LDKC 4I7DA 2E6SA 4LJNA 5D1LB 2CT2A 3U5PA 2JMJA 5LCWB 2G6QA 2MNZA 4A0CD 1X4IA 5B77A 3ASLA 2KWKA 3ZTGA 1WEMA 4A4BA 1WEPA 2LDRA 3HTKC 2H0DA 4WA6A 5D1KB 2KYUA 5B75A 2YHOA 2MD7B 4AUQB 1X4JA 2AN6A 4AYCA 2F6NA 2YT5A 3LQIA 4GNDA 3KQIA 1DVPA 2KU3A 1WFKA 4A4CA 2YSJA 4L7XA 3U5NA 2F42A 1WE9A 2M6MA 5JG6A 4L58A 3ZPVE 3N9NA 1VYXA 3ZVYA 2EA6A 4YATA 2KR4A 4BHWA 3O7AA 2YHNA 5D1MB 2QJ0A 3I2DA 2YUCA 2K1JA 3N9MA 2KGIA 2MNYA 3EB5A 5B8DA 3VK6A 5H9MA 4FK5A 3U5OA 1JM7A 4LADB 1WGMA 5FB1A 1Z60A 2KGGA 4IC3A 2KIZA 2G45A 1CHCA 3N9QA 3O37A 4R7EA 2UZGA 4S3OC 1FBVA 5LKTA 4YBTA 2JMDA 4N3WA 4WZ0A 1JM7B 3O33A 1HYJA 2YYRA 3C6WA 4MSXA 3DQVR 4QF2A 1WEWA 3QZVA 3O70A 2LRIC 2HDPA 2HYED 4AP4A 2MD8C 4R8PK 2LXHC 5J3XA 4AVXA 3PUQA 4YBMA 2YURA 1G25A 3T6RA 4UP5A 5I3LA 4ZUXU 1MM3A 4F52B 4Q6FA 2LGLA 3SOWA 5TDWA 1WENA 2CKLB 3GL6A 2I50A 5C13A 5LKZA 2ECNA 2MIQA 3KV6A 3ZYQA 2MUMA 2YREA 4O64A 3M62A 5EYAF 1RMDA 5DINA 2LN0A 4GB0A 4BBQA 2QICA 3L11A 2M3HA 2MA6A 3FL2A 3HCUA 4C9ZA 1WEOA 2M85A 3HCSA 3SHBA 5TBNA 1F62A 2VJFB 4YABA 3NG2A 4LKAA 3KNVA 2YU4A 2EGPA 2Y1MA 3SOXA 1T1HA 4NN2A 2OXQC 3L1XA 4GNEA 4ZDTA 4S3OB 4YAXA 3LRQA 3IHPA 5B76A 4P5OB 3LQJA 2G43A 2BAYA 2ECJA 2C2LA 2YQMA 1U6GB 4LLBA 3M63A 5LKXA 5TRBA 1FP0A 3KV5A 1X4UA 4PTBA 4B86C 5TABA 2LGGA 2LGKA 2VPBA 4V3KC 1XWHA 3RPGB 2VNFA 2KREA 1V87A 5B79A 5KH9A 2QIZA 2KWNA 4UP0A 1LDJB 2Y1NA 2L0BA 2ECVA 4X3GA 5FERA 2KFTA 2K16A 2VPGA 3U5MA 2CKLA 4CA1A 3HCTA 4I7BA 2XB1A 4FJCA 3RPGC 5B78A 4W4UA 2XEUA 1JOCA 2L5UA 3T7LA 1K2FA 2ECIA 2PNXA 4N4FA 4UI9B 2L80A 5H1UA 2K17A 1WILA 5AITA 2LGVA 3C5KA 1WEUA 5FEYA 5KH3A 2CSZA 3LQHA 2VJFA 2YQLA 5G05B 3O36A 3SOUA 2FUIA 5KH7A 1WEQA 3MHHA 1N87A 3N9OA 2L75A 2KE1A 3V43A 4CCGX 2VJEB 5H1TA 2KWJA 3L1ZB 2ECWA 5DKAA 4GNFA 2VPDA 4ZQLA 2LV9A 5AIUA 2F6JA 4QF3A 1WEVA 2IDAA 4FO9A 1WIMA 2EODA 1BORA 3O34A 4YBSA 2ECGA 3ZVZB 2L43A 2DX8A 1E4UA 2RI7A 1VFYA 5LKUA 3EB6A 5H1VA 2H0DB 3PHDA 4GNGA 4R2YA 5C11A 3N9PA 1Z6UA 4AYCB 2FUUA 2RSDA 3DPLR 5TDRA 3ZNIA 2MT5A 3N9LA 4XI1A 2C2VS 1ZBDB 4MVTA 2LQ6A 4V3LC 2ZETC 2JRJA 3MHSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RTR B;  2MA5 A;  2KWO A;  2D8S A;  1VD4 A;  1HYI A;  3PUR A;  4I7C A;  3GV4 A;  2E6R A;  4IC2 A;  4LK9 A;  1IYM A;  4A49 A;  3O35 A;  2YSM A;  4YC9 A;  1WEE A;  2VPE A;  1Z2Q A;  2VP7 A;  4WZ3 B;  4B7Y C;  2M1R A;  2YW8 A;  2PUY A;  1MM2 A;  2CSY A;  5FB0 A;  4TKP B;  5G0F A;  4FIP A;  3M99 A;  2NAA A;  2FSA A;  4WZ2 A;  2LXP C;  4YAD A;  2ECT A;  1WES A;  5G04 B;  2K4D A;  2Y43 A;  2VJE A;  2JMI A;  4PPE A;  3ZPV 1;  1LDK C;  4I7D A;  2E6S A;  4LJN A;  5D1L B;  2CT2 A;  3U5P A;  2JMJ A;  5LCW B;  2G6Q A;  2MNZ A;  4A0C D;  1X4I A;  5B77 A;  3ASL A;  2KWK A;  3ZTG A;  1WEM A;  4A4B A;  1WEP A;  2LDR A;  3HTK C;  2H0D A;  4WA6 A;  5D1K B;  2KYU A;  5B75 A;  2YHO A;  2MD7 B;  4AUQ B;  1X4J A;  2AN6 A;  4AYC A;  2F6N A;  2YT5 A;  3LQI A;  4GND A;  3KQI A;  1DVP A;  2KU3 A;  1WFK A;  4A4C A;  2YSJ A;  4L7X A;  3U5N A;  2F42 A;  1WE9 A;  2M6M A;  5JG6 A;  4L58 A;  3ZPV E;  3N9N A;  1VYX A;  3ZVY A;  2EA6 A;  4YAT A;  2KR4 A;  4BHW A;  3O7A A;  2YHN A;  5D1M B;  2QJ0 A;  3I2D A;  2YUC A;  2K1J A;  3N9M A;  2KGI A;  2MNY A;  3EB5 A;  5B8D A;  3VK6 A;  5H9M A;  4FK5 A;  3U5O A;  1JM7 A;  4LAD B;  1WGM A;  5FB1 A;  1Z60 A;  2KGG A;  4IC3 A;  2KIZ A;  2G45 A;  1CHC A;  3N9Q A;  3O37 A;  4R7E A;  2UZG A;  4S3O C;  1FBV A;  5LKT A;  4YBT A;  2JMD A;  4N3W A;  4WZ0 A;  1JM7 B;  3O33 A;  1HYJ A;  2YYR A;  3C6W A;  4MSX A;  3DQV R;  4QF2 A;  1WEW A;  3QZV A;  3O70 A;  2LRI C;  2HDP A;  2HYE D;  4AP4 A;  2MD8 C;  4R8P K;  2LXH C;  5J3X A;  4AVX A;  3PUQ A;  4YBM A;  2YUR A;  1G25 A;  3T6R A;  4UP5 A;  5I3L A;  4ZUX U;  1MM3 A;  4F52 B;  4Q6F A;  2LGL A;  3SOW A;  5TDW A;  1WEN A;  2CKL B;  3GL6 A;  2I50 A;  5C13 A;  5LKZ A;  2ECN A;  2MIQ A;  3KV6 A;  3ZYQ A;  2MUM A;  2YRE A;  4O64 A;  3M62 A;  5EYA F;  1RMD A;  5DIN A;  2LN0 A;  4GB0 A;  4BBQ A;  2QIC A;  3L11 A;  2M3H A;  2MA6 A;  3FL2 A;  3HCU A;  4C9Z A;  1WEO A;  2M85 A;  3HCS A;  3SHB A;  5TBN A;  1F62 A;  2VJF B;  4YAB A;  3NG2 A;  4LKA A;  3KNV A;  2YU4 A;  2EGP A;  2Y1M A;  3SOX A;  1T1H A;  4NN2 A;  2OXQ C;  3L1X A;  4GNE A;  4ZDT A;  4S3O B;  4YAX A;  3LRQ A;  3IHP A;  5B76 A;  4P5O B;  3LQJ A;  2G43 A;  2BAY A;  2ECJ A;  2C2L A;  2YQM A;  1U6G B;  4LLB A;  3M63 A;  5LKX A;  5TRB A;  1FP0 A;  3KV5 A;  1X4U A;  4PTB A;  4B86 C;  5TAB A;  2LGG A;  2LGK A;  2VPB A;  4V3K C;  1XWH A;  3RPG B;  2VNF A;  2KRE A;  1V87 A;  5B79 A;  5KH9 A;  2QIZ A;  2KWN A;  4UP0 A;  1LDJ B;  2Y1N A;  2L0B A;  2ECV A;  4X3G A;  5FER A;  2KFT A;  2K16 A;  2VPG A;  3U5M A;  2CKL A;  4CA1 A;  3HCT A;  4I7B A;  2XB1 A;  4FJC A;  3RPG C;  5B78 A;  4W4U A;  2XEU A;  1JOC A;  2L5U A;  3T7L A;  1K2F A;  2ECI A;  2PNX A;  4N4F A;  4UI9 B;  2L80 A;  5H1U A;  2K17 A;  1WIL A;  5AIT A;  2LGV A;  3C5K A;  1WEU A;  5FEY A;  5KH3 A;  2CSZ A;  3LQH A;  2VJF A;  2YQL A;  5G05 B;  3O36 A;  3SOU A;  2FUI A;  5KH7 A;  1WEQ A;  3MHH A;  1N87 A;  3N9O A;  2L75 A;  2KE1 A;  3V43 A;  4CCG X;  2VJE B;  5H1T A;  2KWJ A;  3L1Z B;  2ECW A;  5DKA A;  4GNF A;  2VPD A;  4ZQL A;  2LV9 A;  5AIU A;  2F6J A;  4QF3 A;  1WEV A;  2IDA A;  4FO9 A;  1WIM A;  2EOD A;  1BOR A;  3O34 A;  4YBS A;  2ECG A;  3ZVZ B;  2L43 A;  2DX8 A;  1E4U A;  2RI7 A;  1VFY A;  5LKU A;  3EB6 A;  5H1V A;  2H0D B;  3PHD A;  4GNG A;  4R2Y A;  5C11 A;  3N9P A;  1Z6U A;  4AYC B;  2FUU A;  2RSD A;  3DPL R;  5TDR A;  3ZNI A;  2MT5 A;  3N9L A;  4XI1 A;  2C2V S;  1ZBD B;  4MVT A;  2LQ6 A;  4V3L C;  2ZET C;  2JRJ A;  3MHS A; 
#chains in the Genus database with same CATH topology
 3O47 A;  3RTR B;  2MA5 A;  2KWO A;  2D8S A;  1VD4 A;  1HYI A;  2LAU A;  3PUR A;  4I7C A;  4OGC A;  3GV4 A;  2E6R A;  4IC2 A;  4F1P A;  4LK9 A;  3JUE A;  1IYM A;  4A49 A;  3FM8 C;  3O35 A;  2YSM A;  4YC9 A;  1WEE A;  2VPE A;  2IQJ A;  1Z2Q A;  2VP7 A;  4WZ3 B;  4B7Y C;  2M1R A;  2EGM A;  2YW8 A;  2PUY A;  1MM2 A;  2CSY A;  5FB0 A;  4TKP B;  5G0F A;  4FIP A;  3M99 A;  2NAA A;  2FSA A;  2L7P A;  2LXP C;  4WZ2 A;  4YAD A;  2ECT A;  1WES A;  5G04 B;  2K4D A;  2Y43 A;  2VJE A;  2JMI A;  4PPE A;  3ZPV 1;  1LDK C;  4I7D A;  2CRR A;  2E6S A;  4LJN A;  5D1L B;  2CT2 A;  3U5P A;  2JMJ A;  5LCW B;  2G6Q A;  2MNZ A;  4A0C D;  1X4I A;  5B77 A;  3ASL A;  2KWK A;  2JM3 A;  3ZTG A;  1WEM A;  4A4B A;  1WEP A;  2LDR A;  4QQ4 A;  3HTK C;  2H0D A;  4WA6 A;  2M13 A;  5D1K B;  2KYU A;  2KKY A;  5B75 A;  2YHO A;  2MD7 B;  5SVI B;  4AUQ B;  3FAO A;  1X4J A;  2AN6 A;  4AYC A;  2F6N A;  3Q1D A;  2YT5 A;  3LQI A;  4GND A;  3KQI A;  1DVP A;  2KU3 A;  1WFK A;  4A4C A;  2YSJ A;  4L7X A;  3U5N A;  2F42 A;  1WE9 A;  2M6M A;  5JG6 A;  3FEH A;  4L58 A;  3ZPV E;  3N9N A;  1VYX A;  3ZVY A;  2EA6 A;  2E61 A;  4YAT A;  2KR4 A;  4BHW A;  2FFW A;  3O7A A;  2YHN A;  5D1M B;  2QJ0 A;  3I2D A;  2YUC A;  2K1J A;  3N9M A;  2KGI A;  2MNY A;  3EB5 A;  5B8D A;  3VK6 A;  5H9M A;  4FK5 A;  3U5O A;  1JM7 A;  4OGE A;  4LAD B;  1WGM A;  5FB1 A;  1Z60 A;  2KGG A;  4IC3 A;  2KIZ A;  2CRW A;  2G45 A;  1CHC A;  3N9Q A;  3O37 A;  4O62 A;  4R7E A;  2UZG A;  4S3O C;  3LJU X;  1FBV A;  5LKT A;  4YBT A;  2JMD A;  4N3W A;  4WZ0 A;  1JM7 B;  3O33 A;  1HYJ A;  2YYR A;  3C6W A;  4MSX A;  2XOZ A;  3DQV R;  4QF2 A;  2DSM A;  1WEW A;  3QZV A;  3O70 A;  2FD4 A;  2LRI C;  2HDP A;  2HYE D;  4AP4 A;  2MD8 C;  4R8P K;  5SVY A;  2LXH C;  5J3X A;  4AVX A;  3PUQ A;  4YBM A;  2YUR A;  1MBM A;  1G25 A;  3T6R A;  4UP5 A;  5I3L A;  4ZUX U;  1MM3 A;  2YVR A;  4F52 B;  4Q6F A;  2LGL A;  2RR4 A;  3SOW A;  2XOY A;  5SVI A;  5TDW A;  1WEN A;  2CKL B;  3GL6 A;  2I50 A;  5C13 A;  5LKZ A;  2ECN A;  2P57 A;  2MIQ A;  3KV6 A;  3ZYQ A;  2MUM A;  2YRE A;  4O64 A;  3M62 A;  2XP0 A;  3LVR E;  5EYA F;  1RMD A;  5DIN A;  2EXU A;  2LN0 A;  4GB0 A;  3FJU B;  4BBQ A;  3LDY A;  2QIC A;  3FAN A;  3L11 A;  2M3H A;  2MA6 A;  3FL2 A;  3HCU A;  4C9Z A;  1WEO A;  2M85 A;  3HCS A;  3SHB A;  5TBN A;  1F62 A;  2VJF B;  4YAB A;  3NG2 A;  3E2D A;  4LKA A;  3KNV A;  2YU4 A;  2EGP A;  2Y1M A;  3SOX A;  1T1H A;  4NN2 A;  2OXQ C;  3L1X A;  4GNE A;  4ZDT A;  4S3O B;  4YAX A;  3LRQ A;  3IHP A;  5SVX A;  5B76 A;  4P5O B;  3LQJ A;  2G43 A;  2BAY A;  2ECJ A;  2C2L A;  2YQM A;  1U6G B;  4LLB A;  3M63 A;  5LKX A;  5TRB A;  1FP0 A;  3KV5 A;  5K3Q A;  1X4U A;  4PTB A;  4B86 C;  5TAB A;  2LGG A;  2LGK A;  2VPB A;  4V3K C;  1XWH A;  3RPG B;  2VNF A;  2KRE A;  1V87 A;  2D8U A;  5KH9 A;  2QIZ A;  5B79 A;  3SUB A;  2KWN A;  4UP0 A;  1LDJ B;  2Y1N A;  2L0B A;  2ECV A;  4X3G A;  5FER A;  2KFT A;  2K16 A;  2VPG A;  3U5M A;  2CKL A;  4CA1 A;  3HCT A;  4I7B A;  2XB1 A;  4FJC A;  3RPG C;  5B78 A;  4W4U A;  2XEU A;  1JOC A;  2L5U A;  3T7L A;  1K2F A;  2ECI A;  2PNX A;  4N4F A;  4UI9 B;  2L80 A;  5H1U A;  2K17 A;  4Z0O A;  1WIL A;  5AIT A;  2LGV A;  3C5K A;  1WEU A;  5FEY A;  1DCQ A;  3DDT A;  5KH3 A;  2CSZ A;  2KKX A;  3LQH A;  3T9K A;  3M7K A;  2VJF A;  2YQL A;  5G05 B;  2CON A;  3MDB C;  3O36 A;  3SOU A;  2FUI A;  5KH7 A;  1WEQ A;  3MHH A;  1N87 A;  2JUN A;  4Z0R A;  3N9O A;  2L75 A;  2KE1 A;  3V43 A;  3H7H A;  4CCG X;  2VJE B;  5H1T A;  2KWJ A;  3L1Z B;  2ECW A;  5DKA A;  4GNF A;  2VPD A;  4ZQL A;  2LV9 A;  5AIU A;  2F6J A;  2MKE A;  4QF3 A;  1WEV A;  4H9D A;  2IDA A;  4FO9 A;  1WIM A;  2EOD A;  1BOR A;  3O34 A;  4YBS A;  3KDE C;  2ECG A;  3ZVZ B;  2L43 A;  2DX8 A;  3DWD A;  1E4U A;  2RI7 A;  1VFY A;  5LKU A;  3EB6 A;  5H1V A;  2H0D B;  3PHD A;  2DJA A;  4GNG A;  4R2Y A;  5C11 A;  3LVQ E;  2CSV A;  3N9P A;  1Z6U A;  4AYC B;  2FUU A;  2XOC A;  2RSD A;  3DPL R;  3PLW A;  5TDR A;  3ZNI A;  2MT5 A;  3N9L A;  4XI1 A;  2B0O E;  2C2V S;  1ZBD B;  4MVT A;  2LQ6 A;  4V3L C;  2OWA A;  2ZET C;  2JRJ A;  3MHS A; 
#chains in the Genus database with same CATH homology
 3RTR B;  2MA5 A;  2KWO A;  2D8S A;  1VD4 A;  1HYI A;  3PUR A;  4I7C A;  3GV4 A;  2E6R A;  4IC2 A;  4LK9 A;  1IYM A;  4A49 A;  3O35 A;  2YSM A;  4YC9 A;  1WEE A;  2VPE A;  1Z2Q A;  2VP7 A;  4WZ3 B;  4B7Y C;  2M1R A;  2YW8 A;  2PUY A;  1MM2 A;  2CSY A;  5FB0 A;  4TKP B;  5G0F A;  4FIP A;  3M99 A;  2NAA A;  2FSA A;  4WZ2 A;  2LXP C;  4YAD A;  2ECT A;  1WES A;  5G04 B;  2K4D A;  2Y43 A;  2VJE A;  2JMI A;  4PPE A;  3ZPV 1;  1LDK C;  4I7D A;  2E6S A;  4LJN A;  5D1L B;  2CT2 A;  3U5P A;  2JMJ A;  5LCW B;  2G6Q A;  2MNZ A;  4A0C D;  1X4I A;  5B77 A;  3ASL A;  2KWK A;  3ZTG A;  1WEM A;  4A4B A;  1WEP A;  2LDR A;  3HTK C;  2H0D A;  4WA6 A;  5D1K B;  2KYU A;  5B75 A;  2YHO A;  2MD7 B;  4AUQ B;  1X4J A;  2AN6 A;  4AYC A;  2F6N A;  2YT5 A;  3LQI A;  4GND A;  3KQI A;  1DVP A;  2KU3 A;  1WFK A;  4A4C A;  2YSJ A;  4L7X A;  3U5N A;  2F42 A;  1WE9 A;  2M6M A;  5JG6 A;  4L58 A;  3ZPV E;  3N9N A;  1VYX A;  3ZVY A;  2EA6 A;  4YAT A;  2KR4 A;  4BHW A;  3O7A A;  2YHN A;  5D1M B;  2QJ0 A;  3I2D A;  2YUC A;  2K1J A;  3N9M A;  2KGI A;  2MNY A;  3EB5 A;  5B8D A;  3VK6 A;  5H9M A;  4FK5 A;  3U5O A;  1JM7 A;  4LAD B;  1WGM A;  5FB1 A;  1Z60 A;  2KGG A;  4IC3 A;  2KIZ A;  2G45 A;  1CHC A;  3N9Q A;  3O37 A;  4R7E A;  2UZG A;  4S3O C;  1FBV A;  5LKT A;  4YBT A;  2JMD A;  4N3W A;  4WZ0 A;  1JM7 B;  3O33 A;  1HYJ A;  2YYR A;  3C6W A;  4MSX A;  3DQV R;  4QF2 A;  1WEW A;  3QZV A;  3O70 A;  2LRI C;  2HDP A;  2HYE D;  4AP4 A;  2MD8 C;  4R8P K;  2LXH C;  5J3X A;  4AVX A;  3PUQ A;  4YBM A;  2YUR A;  1G25 A;  3T6R A;  4UP5 A;  5I3L A;  4ZUX U;  1MM3 A;  4F52 B;  4Q6F A;  2LGL A;  3SOW A;  5TDW A;  1WEN A;  2CKL B;  3GL6 A;  2I50 A;  5C13 A;  5LKZ A;  2ECN A;  2MIQ A;  3KV6 A;  3ZYQ A;  2MUM A;  2YRE A;  4O64 A;  3M62 A;  5EYA F;  1RMD A;  5DIN A;  2LN0 A;  4GB0 A;  4BBQ A;  2QIC A;  3L11 A;  2M3H A;  2MA6 A;  3FL2 A;  3HCU A;  4C9Z A;  1WEO A;  2M85 A;  3HCS A;  3SHB A;  5TBN A;  1F62 A;  2VJF B;  4YAB A;  3NG2 A;  4LKA A;  3KNV A;  2YU4 A;  2EGP A;  2Y1M A;  3SOX A;  1T1H A;  4NN2 A;  2OXQ C;  3L1X A;  4GNE A;  4ZDT A;  4S3O B;  4YAX A;  3LRQ A;  3IHP A;  5B76 A;  4P5O B;  3LQJ A;  2G43 A;  2BAY A;  2ECJ A;  2C2L A;  2YQM A;  1U6G B;  4LLB A;  3M63 A;  5LKX A;  5TRB A;  1FP0 A;  3KV5 A;  1X4U A;  4PTB A;  4B86 C;  5TAB A;  2LGG A;  2LGK A;  2VPB A;  4V3K C;  1XWH A;  3RPG B;  2VNF A;  2KRE A;  1V87 A;  5B79 A;  5KH9 A;  2QIZ A;  2KWN A;  4UP0 A;  1LDJ B;  2Y1N A;  2L0B A;  2ECV A;  4X3G A;  5FER A;  2KFT A;  2K16 A;  2VPG A;  3U5M A;  2CKL A;  4CA1 A;  3HCT A;  4I7B A;  2XB1 A;  4FJC A;  3RPG C;  5B78 A;  4W4U A;  2XEU A;  1JOC A;  2L5U A;  3T7L A;  1K2F A;  2ECI A;  2PNX A;  4N4F A;  4UI9 B;  2L80 A;  5H1U A;  2K17 A;  1WIL A;  5AIT A;  2LGV A;  3C5K A;  1WEU A;  5FEY A;  5KH3 A;  2CSZ A;  3LQH A;  2VJF A;  2YQL A;  5G05 B;  3O36 A;  3SOU A;  2FUI A;  5KH7 A;  1WEQ A;  3MHH A;  1N87 A;  3N9O A;  2L75 A;  2KE1 A;  3V43 A;  4CCG X;  2VJE B;  5H1T A;  2KWJ A;  3L1Z B;  2ECW A;  5DKA A;  4GNF A;  2VPD A;  4ZQL A;  2LV9 A;  5AIU A;  2F6J A;  4QF3 A;  1WEV A;  2IDA A;  4FO9 A;  1WIM A;  2EOD A;  1BOR A;  3O34 A;  4YBS A;  2ECG A;  3ZVZ B;  2L43 A;  2DX8 A;  1E4U A;  2RI7 A;  1VFY A;  5LKU A;  3EB6 A;  5H1V A;  2H0D B;  3PHD A;  4GNG A;  4R2Y A;  5C11 A;  3N9P A;  1Z6U A;  4AYC B;  2FUU A;  2RSD A;  3DPL R;  5TDR A;  3ZNI A;  2MT5 A;  3N9L A;  4XI1 A;  2C2V S;  1ZBD B;  4MVT A;  2LQ6 A;  4V3L C;  2ZET C;  2JRJ A;  3MHS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...