3GV4A

Crystal structure of human hdac6 zinc finger domain and ubiquitin c-terminal peptide rlrgg
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
99
structure length
99
Chain Sequence
PLPWCPHLVAVCPIPAAGLDVTQPCGDCGTIQENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYVHHQALLDVKNIAHQNKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Histone deacetylase 6
publication title Crystal structure of human HDAC6 zinc finger domain and ubiquitin C-terminal peptide RLRGG
rcsb
source organism Homo sapiens
total genus 31
structure length 99
sequence length 99
ec nomenclature ec 3.5.1.98: Histone deacetylase.
pdb deposition date 2009-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3gv4A00
1VYXA 4ZDTA 3U5OA 2FUUA 4N4FA 5G0FA 3N9QA 3RPGC 2L5UA 5FB0A 1HYIA 3RPGB 2JRJA 4I7CA 1JM7B 2MNZA 4A4CA 4LADB 2E6SA 2G6QA 4FK5A 3KQIA 4PTBA 4LKAA 2EGPA 2LV9A 4I7BA 3PHDA 4CA1A 2XB1A 2KIZA 4AYCA 5TBNA 2YREA 4TKPB 4V3LC 4AUQB 1VFYA 1ZBDB 1X4JA 2VPDA 3DQVR 3M63A 2F6JA 2C2VS 4YBSA 3ZPVE 1VD4A 4BBQA 4AVXA 2L75A 5DKAA 2YQLA 4YBTA 2YW8A 2RSDA 3KV6A 4MVTA 4AYCB 2F42A 3ZTGA 4QF2A 2MA5A 2VJFA 2K17A 3NG2A 2MD8C 3GV4A 3C5KA 2L43A 2F6NA 3ZVYA 5B76A 2KWKA 4WZ0A 2EA6A 2LXPC 2OXQC 2YT5A 2YUCA 2YHNA 2CT2A 1Z2QA 4B7YC 2KGIA 3O34A 2Y1NA 1WEVA 5B8DA 4X3GA 2AN6A 2KGGA 4O64A 4YADA 2ECGA 2DX8A 5B79A 4P5OB 3N9LA 5B75A 4V3KC 4NN2A 2D8SA 4R8PK 5EYAF 3MHSA 4LK9A 4B86C 4BHWA 5LCWB 1WE9A 3ZVZB 4C9ZA 3KNVA 4S3OC 4YABA 3IHPA 3N9NA 2L80A 2Y43A 5LKXA 4S3OB 2I50A 3LQJA 3O70A 2MT5A 5H1TA 5H1VA 2YYRA 4PPEA 1JOCA 1WGMA 1CHCA 5KH3A 5AIUA 1X4IA 2RI7A 4N3WA 4UI9B 2ECWA 4IC2A 2G43A 3L1XA 2YU4A 1WILA 2ECJA 4UP0A 1WEPA 3DPLR 3EB5A 3LQIA 3N9PA 2YSJA 3M62A 2LDRA 2KWOA 2M6MA 2UZGA 1FP0A 2M85A 3HCTA 2VJEA 3MHHA 3O37A 1MM3A 2YSMA 5DINA 3SOUA 2JMDA 4WZ3B 5C11A 4I7DA 3FL2A 2LN0A 4YC9A 2LXHC 2MD7B 2KYUA 3QZVA 5KH9A 4YATA 3ZYQA 1XWHA 3O35A 2VJEB 5TABA 2ECNA 2LGLA 1DVPA 2MA6A 2K1JA 4YBMA 3KV5A 3HTKC 4GNFA 1U6GB 1WEQA 2HYED 1K2FA 2BAYA 1HYJA 5D1MB 2KREA 3O36A 2H0DA 1F62A 5FEYA 2ZETC 2KWJA 5I3LA 5LKZA 4FO9A 2CSYA 2VJFB 3N9MA 1LDKC 4Q6FA 3I2DA 4IC3A 3C6WA 5TDWA 1WIMA 5D1KB 2MNYA 4W4UA 1V87A 2LQ6A 2ECIA 2KE1A 2H0DB 5TRBA 2LGVA 2YURA 3M99A 3O7AA 4LLBA 4ZQLA 3ZPV1 5G05B 1N87A 4L7XA 1G25A 5JG6A 2KU3A 3LRQA 5C13A 5G04B 2VPEA 3ZNIA 2LGKA 2VPBA 2LGGA 1JM7A 1WEUA 5LKTA 4CCGX 5LKUA 5KH7A 2FUIA 1LDJB 1T1HA 4A0CD 2ECTA 3PUQA 2VPGA 5D1LB 2JMIA 4MSXA 3VK6A 3SOWA 4GNEA 4WA6A 3PURA 3EB6A 3HCUA 4F52B 2K4DA 2EODA 1WESA 5FB1A 2HDPA 3SHBA 3O33A 2KWNA 5AITA 5J3XA 4XI1A 1MM2A 3V43A 2M1RA 2JMJA 4UP5A 3L11A 2QIZA 3HCSA 2FSAA 2QICA 1IYMA 3L1ZB 4ZUXU 5H9MA 1RMDA 3T7LA 1WFKA 5B77A 1WEWA 2KR4A 2NAAA 1FBVA 3RTRB 2MIQA 1Z60A 4FIPA 2QJ0A 4GB0A 2VNFA 2E6RA 3ASLA 1WEOA 4GNDA 5FERA 2PUYA 2MUMA 1E4UA 4L58A 4GNGA 3LQHA 2YQMA 5TDRA 3U5NA 2CKLA 2PNXA 3U5PA 4YAXA 3N9OA 2IDAA 2LRIC 2G45A 4R7EA 2L0BA 2K16A 4AP4A 2KFTA 2CSZA 4A49A 2XEUA 1BORA 4FJCA 1WEEA 2VP7A 2CKLB 5H1UA 2Y1MA 3T6RA 1X4UA 4QF3A 2YHOA 4WZ2A 1Z6UA 2C2LA 3U5MA 5B78A 2ECVA 3SOXA 1WENA 4A4BA 3GL6A 4LJNA 4R2YA 2M3HA 1WEMA
chains in the Genus database with same CATH superfamily
1VYXA 4ZDTA 3U5OA 2FUUA 4N4FA 5G0FA 3N9QA 5K3QA 3RPGC 2CRWA 2L5UA 5FB0A 1HYIA 3RPGB 2JRJA 4I7CA 1JM7B 2MNZA 4A4CA 4LADB 2E6SA 3PLWA 2G6QA 4FK5A 3KQIA 4PTBA 4LKAA 2EGPA 2LV9A 4I7BA 3PHDA 4CA1A 2XB1A 2KIZA 4AYCA 5TBNA 2EXUA 2YREA 4TKPB 4OGCA 4V3LC 4AUQB 3E2DA 1VFYA 1ZBDB 1X4JA 2VPDA 3DQVR 3M63A 2F6JA 2IQJA 2C2VS 2CSVA 4YBSA 3ZPVE 4H9DA 1VD4A 4BBQA 2MKEA 4AVXA 2L75A 5DKAA 2YQLA 2JUNA 4YBTA 2YW8A 2RSDA 2FFWA 3KV6A 4MVTA 3M7KA 4AYCB 2F42A 3ZTGA 4QF2A 2MA5A 2JM3A 2VJFA 2K17A 3NG2A 2MD8C 3GV4A 3C5KA 2L43A 2F6NA 3ZVYA 5B76A 2KWKA 3FAOA 2EA6A 3FJUB 4WZ0A 2LXPC 2OXQC 2YT5A 2CRRA 2YUCA 3DDTA 2YHNA 2CT2A 1Z2QA 4B7YC 2KGIA 3FEHA 3O34A 2Y1NA 1WEVA 5B8DA 2YVRA 4X3GA 2RR4A 2AN6A 3LJUX 2KGGA 4O64A 4YADA 2ECGA 2DX8A 5B79A 4P5OB 3N9LA 5B75A 4V3KC 4NN2A 2D8SA 4R8PK 5EYAF 3MHSA 4LK9A 4B86C 4BHWA 5LCWB 1WE9A 3ZVZB 4C9ZA 3KNVA 4S3OC 4YABA 2XOZA 3IHPA 3N9NA 2L80A 2Y43A 5LKXA 4S3OB 2I50A 3LQJA 3O70A 2KKYA 2MT5A 5H1TA 5H1VA 2YYRA 4PPEA 1JOCA 1WGMA 1CHCA 5KH3A 5AIUA 1X4IA 2RI7A 4N3WA 4UI9B 4O62A 2ECWA 3JUEA 4IC2A 3Q1DA 4Z0RA 2G43A 2L7PA 3L1XA 2YU4A 2P57A 1WILA 2ECJA 4UP0A 1WEPA 3DPLR 3EB5A 3LQIA 3FM8C 3N9PA 2YSJA 3M62A 2LDRA 2KWOA 2M6MA 2UZGA 1FP0A 3FANA 2M85A 2XP0A 3HCTA 2VJEA 3MHHA 3O37A 1MM3A 2YSMA 5DINA 3SOUA 2CONA 2JMDA 4WZ3B 5C11A 4I7DA 3FL2A 2LN0A 4YC9A 2LXHC 2MD7B 2KYUA 3QZVA 3T9KA 5KH9A 4YATA 3ZYQA 1XWHA 3O35A 2VJEB 5TABA 2ECNA 2LGLA 2LAUA 1DVPA 5SVYA 2MA6A 2K1JA 4YBMA 3KV5A 1DCQA 3HTKC 4GNFA 1U6GB 1WEQA 2HYED 1K2FA 2BAYA 1HYJA 5D1MB 2KREA 3O36A 2H0DA 1F62A 5FEYA 2ZETC 2KWJA 5I3LA 5LKZA 4FO9A 2CSYA 2VJFB 3N9MA 1LDKC 4Q6FA 2XOCA 3I2DA 4IC3A 3C6WA 2FD4A 5TDWA 1WIMA 3H7HA 5D1KB 2MNYA 4W4UA 1V87A 2LQ6A 3MDBC 2ECIA 2KE1A 2H0DB 2OWAA 1MBMA 5TRBA 2LGVA 2YURA 3M99A 3O7AA 3LVQE 4LLBA 4ZQLA 3ZPV1 5G05B 1N87A 4L7XA 1G25A 5JG6A 2KU3A 3LRQA 5C13A 5G04B 2VPEA 3ZNIA 2LGKA 2VPBA 2LGGA 1JM7A 1WEUA 5LKTA 4CCGX 5LKUA 5KH7A 2FUIA 1LDJB 1T1HA 4A0CD 2B0OE 2ECTA 3PUQA 2VPGA 5D1LB 2JMIA 4MSXA 3VK6A 3SOWA 4GNEA 4WA6A 3PURA 3EB6A 3HCUA 4F52B 2K4DA 2EODA 1WESA 5FB1A 2HDPA 3SHBA 3O33A 2KWNA 3KDEC 5AITA 5J3XA 4XI1A 1MM2A 3V43A 2M1RA 2JMJA 4UP5A 3L11A 2QIZA 3HCSA 2E61A 2FSAA 2QICA 2DSMA 1IYMA 3L1ZB 3SUBA 4ZUXU 5H9MA 1RMDA 3T7LA 1WFKA 2D8UA 5B77A 1WEWA 2KR4A 5SVIA 2NAAA 1FBVA 3RTRB 4F1PA 2MIQA 1Z60A 4FIPA 2QJ0A 4GB0A 2VNFA 2E6RA 3ASLA 1WEOA 4GNDA 5FERA 3DWDA 3LDYA 2PUYA 3O47A 2MUMA 1E4UA 4L58A 4GNGA 2DJAA 2EGMA 3LQHA 2YQMA 5TDRA 4OGEA 3U5NA 4Z0OA 5SVIB 2CKLA 2PNXA 3U5PA 4YAXA 3N9OA 2IDAA 2KKXA 2LRIC 2G45A 4R7EA 3LVRE 2L0BA 2K16A 4AP4A 2KFTA 2CSZA 4A49A 2XEUA 1BORA 4FJCA 1WEEA 2VP7A 2M13A 2CKLB 5H1UA 2Y1MA 3T6RA 1X4UA 4QF3A 2YHOA 4WZ2A 1Z6UA 2C2LA 3U5MA 5B78A 2ECVA 3SOXA 1WENA 4A4BA 2XOYA 3GL6A 4LJNA 4QQ4A 4R2YA 2M3HA 1WEMA 5SVXA
chains in the Genus database with same CATH topology
1VYXA 4ZDTA 3U5OA 2FUUA 4N4FA 5G0FA 3N9QA 3RPGC 2L5UA 5FB0A 1HYIA 3RPGB 2JRJA 4I7CA 1JM7B 2MNZA 4A4CA 4LADB 2E6SA 2G6QA 4FK5A 3KQIA 4PTBA 4LKAA 2EGPA 2LV9A 4I7BA 3PHDA 4CA1A 2XB1A 2KIZA 4AYCA 5TBNA 2YREA 4TKPB 4V3LC 4AUQB 1VFYA 1ZBDB 1X4JA 2VPDA 3DQVR 3M63A 2F6JA 2C2VS 4YBSA 3ZPVE 1VD4A 4BBQA 4AVXA 2L75A 5DKAA 2YQLA 4YBTA 2YW8A 2RSDA 3KV6A 4MVTA 4AYCB 2F42A 3ZTGA 4QF2A 2MA5A 2VJFA 2K17A 3NG2A 2MD8C 3GV4A 3C5KA 2L43A 2F6NA 3ZVYA 5B76A 2KWKA 4WZ0A 2EA6A 2LXPC 2OXQC 2YT5A 2YUCA 2YHNA 2CT2A 1Z2QA 4B7YC 2KGIA 3O34A 2Y1NA 1WEVA 5B8DA 4X3GA 2AN6A 2KGGA 4O64A 4YADA 2ECGA 2DX8A 5B79A 4P5OB 3N9LA 5B75A 4V3KC 4NN2A 2D8SA 4R8PK 5EYAF 3MHSA 4LK9A 4B86C 4BHWA 5LCWB 1WE9A 3ZVZB 4C9ZA 3KNVA 4S3OC 4YABA 3IHPA 3N9NA 2L80A 2Y43A 5LKXA 4S3OB 2I50A 3LQJA 3O70A 2MT5A 5H1TA 5H1VA 2YYRA 4PPEA 1JOCA 1WGMA 1CHCA 5KH3A 5AIUA 1X4IA 2RI7A 4N3WA 4UI9B 2ECWA 4IC2A 2G43A 3L1XA 2YU4A 1WILA 2ECJA 4UP0A 1WEPA 3DPLR 3EB5A 3LQIA 3N9PA 2YSJA 3M62A 2LDRA 2KWOA 2M6MA 2UZGA 1FP0A 2M85A 3HCTA 2VJEA 3MHHA 3O37A 1MM3A 2YSMA 5DINA 3SOUA 2JMDA 4WZ3B 5C11A 4I7DA 3FL2A 2LN0A 4YC9A 2LXHC 2MD7B 2KYUA 3QZVA 5KH9A 4YATA 3ZYQA 1XWHA 3O35A 2VJEB 5TABA 2ECNA 2LGLA 1DVPA 2MA6A 2K1JA 4YBMA 3KV5A 3HTKC 4GNFA 1U6GB 1WEQA 2HYED 1K2FA 2BAYA 1HYJA 5D1MB 2KREA 3O36A 2H0DA 1F62A 5FEYA 2ZETC 2KWJA 5I3LA 5LKZA 4FO9A 2CSYA 2VJFB 3N9MA 1LDKC 4Q6FA 3I2DA 4IC3A 3C6WA 5TDWA 1WIMA 5D1KB 2MNYA 4W4UA 1V87A 2LQ6A 2ECIA 2KE1A 2H0DB 5TRBA 2LGVA 2YURA 3M99A 3O7AA 4LLBA 4ZQLA 3ZPV1 5G05B 1N87A 4L7XA 1G25A 5JG6A 2KU3A 3LRQA 5C13A 5G04B 2VPEA 3ZNIA 2LGKA 2VPBA 2LGGA 1JM7A 1WEUA 5LKTA 4CCGX 5LKUA 5KH7A 2FUIA 1LDJB 1T1HA 4A0CD 2ECTA 3PUQA 2VPGA 5D1LB 2JMIA 4MSXA 3VK6A 3SOWA 4GNEA 4WA6A 3PURA 3EB6A 3HCUA 4F52B 2K4DA 2EODA 1WESA 5FB1A 2HDPA 3SHBA 3O33A 2KWNA 5AITA 5J3XA 4XI1A 1MM2A 3V43A 2M1RA 2JMJA 4UP5A 3L11A 2QIZA 3HCSA 2FSAA 2QICA 1IYMA 3L1ZB 4ZUXU 5H9MA 1RMDA 3T7LA 1WFKA 5B77A 1WEWA 2KR4A 2NAAA 1FBVA 3RTRB 2MIQA 1Z60A 4FIPA 2QJ0A 4GB0A 2VNFA 2E6RA 3ASLA 1WEOA 4GNDA 5FERA 2PUYA 2MUMA 1E4UA 4L58A 4GNGA 3LQHA 2YQMA 5TDRA 3U5NA 2CKLA 2PNXA 3U5PA 4YAXA 3N9OA 2IDAA 2LRIC 2G45A 4R7EA 2L0BA 2K16A 4AP4A 2KFTA 2CSZA 4A49A 2XEUA 1BORA 4FJCA 1WEEA 2VP7A 2CKLB 5H1UA 2Y1MA 3T6RA 1X4UA 4QF3A 2YHOA 4WZ2A 1Z6UA 2C2LA 3U5MA 5B78A 2ECVA 3SOXA 1WENA 4A4BA 3GL6A 4LJNA 4R2YA 2M3HA 1WEMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VYX A;  4ZDT A;  3U5O A;  2FUU A;  4N4F A;  5G0F A;  3N9Q A;  3RPG C;  2L5U A;  5FB0 A;  1HYI A;  3RPG B;  2JRJ A;  4I7C A;  1JM7 B;  2MNZ A;  4A4C A;  4LAD B;  2E6S A;  2G6Q A;  4FK5 A;  3KQI A;  4PTB A;  4LKA A;  2EGP A;  2LV9 A;  4I7B A;  3PHD A;  4CA1 A;  2XB1 A;  2KIZ A;  4AYC A;  5TBN A;  2YRE A;  4TKP B;  4V3L C;  4AUQ B;  1VFY A;  1ZBD B;  1X4J A;  2VPD A;  3DQV R;  3M63 A;  2F6J A;  2C2V S;  4YBS A;  3ZPV E;  1VD4 A;  4BBQ A;  4AVX A;  2L75 A;  5DKA A;  2YQL A;  4YBT A;  2YW8 A;  2RSD A;  3KV6 A;  4MVT A;  4AYC B;  2F42 A;  3ZTG A;  4QF2 A;  2MA5 A;  2VJF A;  2K17 A;  3NG2 A;  2MD8 C;  3GV4 A;  3C5K A;  2L43 A;  2F6N A;  3ZVY A;  5B76 A;  2KWK A;  4WZ0 A;  2EA6 A;  2LXP C;  2OXQ C;  2YT5 A;  2YUC A;  2YHN A;  2CT2 A;  1Z2Q A;  4B7Y C;  2KGI A;  3O34 A;  2Y1N A;  1WEV A;  5B8D A;  4X3G A;  2AN6 A;  2KGG A;  4O64 A;  4YAD A;  2ECG A;  2DX8 A;  5B79 A;  4P5O B;  3N9L A;  5B75 A;  4V3K C;  4NN2 A;  2D8S A;  4R8P K;  5EYA F;  3MHS A;  4LK9 A;  4B86 C;  4BHW A;  5LCW B;  1WE9 A;  3ZVZ B;  4C9Z A;  3KNV A;  4S3O C;  4YAB A;  3IHP A;  3N9N A;  2L80 A;  2Y43 A;  5LKX A;  4S3O B;  2I50 A;  3LQJ A;  3O70 A;  2MT5 A;  5H1T A;  5H1V A;  2YYR A;  4PPE A;  1JOC A;  1WGM A;  1CHC A;  5KH3 A;  5AIU A;  1X4I A;  2RI7 A;  4N3W A;  4UI9 B;  2ECW A;  4IC2 A;  2G43 A;  3L1X A;  2YU4 A;  1WIL A;  2ECJ A;  4UP0 A;  1WEP A;  3DPL R;  3EB5 A;  3LQI A;  3N9P A;  2YSJ A;  3M62 A;  2LDR A;  2KWO A;  2M6M A;  2UZG A;  1FP0 A;  2M85 A;  3HCT A;  2VJE A;  3MHH A;  3O37 A;  1MM3 A;  2YSM A;  5DIN A;  3SOU A;  2JMD A;  4WZ3 B;  5C11 A;  4I7D A;  3FL2 A;  2LN0 A;  4YC9 A;  2LXH C;  2MD7 B;  2KYU A;  3QZV A;  5KH9 A;  4YAT A;  3ZYQ A;  1XWH A;  3O35 A;  2VJE B;  5TAB A;  2ECN A;  2LGL A;  1DVP A;  2MA6 A;  2K1J A;  4YBM A;  3KV5 A;  3HTK C;  4GNF A;  1U6G B;  1WEQ A;  2HYE D;  1K2F A;  2BAY A;  1HYJ A;  5D1M B;  2KRE A;  3O36 A;  2H0D A;  1F62 A;  5FEY A;  2ZET C;  2KWJ A;  5I3L A;  5LKZ A;  4FO9 A;  2CSY A;  2VJF B;  3N9M A;  1LDK C;  4Q6F A;  3I2D A;  4IC3 A;  3C6W A;  5TDW A;  1WIM A;  5D1K B;  2MNY A;  4W4U A;  1V87 A;  2LQ6 A;  2ECI A;  2KE1 A;  2H0D B;  5TRB A;  2LGV A;  2YUR A;  3M99 A;  3O7A A;  4LLB A;  4ZQL A;  3ZPV 1;  5G05 B;  1N87 A;  4L7X A;  1G25 A;  5JG6 A;  2KU3 A;  3LRQ A;  5C13 A;  5G04 B;  2VPE A;  3ZNI A;  2LGK A;  2VPB A;  2LGG A;  1JM7 A;  1WEU A;  5LKT A;  4CCG X;  5LKU A;  5KH7 A;  2FUI A;  1LDJ B;  1T1H A;  4A0C D;  2ECT A;  3PUQ A;  2VPG A;  5D1L B;  2JMI A;  4MSX A;  3VK6 A;  3SOW A;  4GNE A;  4WA6 A;  3PUR A;  3EB6 A;  3HCU A;  4F52 B;  2K4D A;  2EOD A;  1WES A;  5FB1 A;  2HDP A;  3SHB A;  3O33 A;  2KWN A;  5AIT A;  5J3X A;  4XI1 A;  1MM2 A;  3V43 A;  2M1R A;  2JMJ A;  4UP5 A;  3L11 A;  2QIZ A;  3HCS A;  2FSA A;  2QIC A;  1IYM A;  3L1Z B;  4ZUX U;  5H9M A;  1RMD A;  3T7L A;  1WFK A;  5B77 A;  1WEW A;  2KR4 A;  2NAA A;  1FBV A;  3RTR B;  2MIQ A;  1Z60 A;  4FIP A;  2QJ0 A;  4GB0 A;  2VNF A;  2E6R A;  3ASL A;  1WEO A;  4GND A;  5FER A;  2PUY A;  2MUM A;  1E4U A;  4L58 A;  4GNG A;  3LQH A;  2YQM A;  5TDR A;  3U5N A;  2CKL A;  2PNX A;  3U5P A;  4YAX A;  3N9O A;  2IDA A;  2LRI C;  2G45 A;  4R7E A;  2L0B A;  2K16 A;  4AP4 A;  2KFT A;  2CSZ A;  4A49 A;  2XEU A;  1BOR A;  4FJC A;  1WEE A;  2VP7 A;  2CKL B;  5H1U A;  2Y1M A;  3T6R A;  1X4U A;  4QF3 A;  2YHO A;  4WZ2 A;  1Z6U A;  2C2L A;  3U5M A;  5B78 A;  2ECV A;  3SOX A;  1WEN A;  4A4B A;  3GL6 A;  4LJN A;  4R2Y A;  2M3H A;  1WEM A; 
#chains in the Genus database with same CATH topology
 1VYX A;  4ZDT A;  3U5O A;  2FUU A;  4N4F A;  5G0F A;  3N9Q A;  5K3Q A;  3RPG C;  2CRW A;  2L5U A;  5FB0 A;  1HYI A;  3RPG B;  2JRJ A;  4I7C A;  1JM7 B;  2MNZ A;  4A4C A;  4LAD B;  2E6S A;  3PLW A;  2G6Q A;  4FK5 A;  3KQI A;  4PTB A;  4LKA A;  2EGP A;  2LV9 A;  4I7B A;  3PHD A;  4CA1 A;  2XB1 A;  2KIZ A;  4AYC A;  5TBN A;  2EXU A;  2YRE A;  4TKP B;  4OGC A;  4V3L C;  4AUQ B;  3E2D A;  1VFY A;  1ZBD B;  1X4J A;  2VPD A;  3DQV R;  3M63 A;  2F6J A;  2IQJ A;  2C2V S;  2CSV A;  4YBS A;  3ZPV E;  4H9D A;  1VD4 A;  4BBQ A;  2MKE A;  4AVX A;  2L75 A;  5DKA A;  2YQL A;  2JUN A;  4YBT A;  2YW8 A;  2RSD A;  2FFW A;  3KV6 A;  4MVT A;  3M7K A;  4AYC B;  2F42 A;  3ZTG A;  4QF2 A;  2MA5 A;  2JM3 A;  2VJF A;  2K17 A;  3NG2 A;  2MD8 C;  3GV4 A;  3C5K A;  2L43 A;  2F6N A;  3ZVY A;  5B76 A;  2KWK A;  3FAO A;  2EA6 A;  3FJU B;  4WZ0 A;  2LXP C;  2OXQ C;  2YT5 A;  2CRR A;  2YUC A;  3DDT A;  2YHN A;  2CT2 A;  1Z2Q A;  4B7Y C;  2KGI A;  3FEH A;  3O34 A;  2Y1N A;  1WEV A;  5B8D A;  2YVR A;  4X3G A;  2RR4 A;  2AN6 A;  3LJU X;  2KGG A;  4O64 A;  4YAD A;  2ECG A;  2DX8 A;  5B79 A;  4P5O B;  3N9L A;  5B75 A;  4V3K C;  4NN2 A;  2D8S A;  4R8P K;  5EYA F;  3MHS A;  4LK9 A;  4B86 C;  4BHW A;  5LCW B;  1WE9 A;  3ZVZ B;  4C9Z A;  3KNV A;  4S3O C;  4YAB A;  2XOZ A;  3IHP A;  3N9N A;  2L80 A;  2Y43 A;  5LKX A;  4S3O B;  2I50 A;  3LQJ A;  3O70 A;  2KKY A;  2MT5 A;  5H1T A;  5H1V A;  2YYR A;  4PPE A;  1JOC A;  1WGM A;  1CHC A;  5KH3 A;  5AIU A;  1X4I A;  2RI7 A;  4N3W A;  4UI9 B;  4O62 A;  2ECW A;  3JUE A;  4IC2 A;  3Q1D A;  4Z0R A;  2G43 A;  2L7P A;  3L1X A;  2YU4 A;  2P57 A;  1WIL A;  2ECJ A;  4UP0 A;  1WEP A;  3DPL R;  3EB5 A;  3LQI A;  3FM8 C;  3N9P A;  2YSJ A;  3M62 A;  2LDR A;  2KWO A;  2M6M A;  2UZG A;  1FP0 A;  3FAN A;  2M85 A;  2XP0 A;  3HCT A;  2VJE A;  3MHH A;  3O37 A;  1MM3 A;  2YSM A;  5DIN A;  3SOU A;  2CON A;  2JMD A;  4WZ3 B;  5C11 A;  4I7D A;  3FL2 A;  2LN0 A;  4YC9 A;  2LXH C;  2MD7 B;  2KYU A;  3QZV A;  3T9K A;  5KH9 A;  4YAT A;  3ZYQ A;  1XWH A;  3O35 A;  2VJE B;  5TAB A;  2ECN A;  2LGL A;  2LAU A;  1DVP A;  5SVY A;  2MA6 A;  2K1J A;  4YBM A;  3KV5 A;  1DCQ A;  3HTK C;  4GNF A;  1U6G B;  1WEQ A;  2HYE D;  1K2F A;  2BAY A;  1HYJ A;  5D1M B;  2KRE A;  3O36 A;  2H0D A;  1F62 A;  5FEY A;  2ZET C;  2KWJ A;  5I3L A;  5LKZ A;  4FO9 A;  2CSY A;  2VJF B;  3N9M A;  1LDK C;  4Q6F A;  2XOC A;  3I2D A;  4IC3 A;  3C6W A;  2FD4 A;  5TDW A;  1WIM A;  3H7H A;  5D1K B;  2MNY A;  4W4U A;  1V87 A;  2LQ6 A;  3MDB C;  2ECI A;  2KE1 A;  2H0D B;  2OWA A;  1MBM A;  5TRB A;  2LGV A;  2YUR A;  3M99 A;  3O7A A;  3LVQ E;  4LLB A;  4ZQL A;  3ZPV 1;  5G05 B;  1N87 A;  4L7X A;  1G25 A;  5JG6 A;  2KU3 A;  3LRQ A;  5C13 A;  5G04 B;  2VPE A;  3ZNI A;  2LGK A;  2VPB A;  2LGG A;  1JM7 A;  1WEU A;  5LKT A;  4CCG X;  5LKU A;  5KH7 A;  2FUI A;  1LDJ B;  1T1H A;  4A0C D;  2B0O E;  2ECT A;  3PUQ A;  2VPG A;  5D1L B;  2JMI A;  4MSX A;  3VK6 A;  3SOW A;  4GNE A;  4WA6 A;  3PUR A;  3EB6 A;  3HCU A;  4F52 B;  2K4D A;  2EOD A;  1WES A;  5FB1 A;  2HDP A;  3SHB A;  3O33 A;  2KWN A;  3KDE C;  5AIT A;  5J3X A;  4XI1 A;  1MM2 A;  3V43 A;  2M1R A;  2JMJ A;  4UP5 A;  3L11 A;  2QIZ A;  3HCS A;  2E61 A;  2FSA A;  2QIC A;  2DSM A;  1IYM A;  3L1Z B;  3SUB A;  4ZUX U;  5H9M A;  1RMD A;  3T7L A;  1WFK A;  2D8U A;  5B77 A;  1WEW A;  2KR4 A;  5SVI A;  2NAA A;  1FBV A;  3RTR B;  4F1P A;  2MIQ A;  1Z60 A;  4FIP A;  2QJ0 A;  4GB0 A;  2VNF A;  2E6R A;  3ASL A;  1WEO A;  4GND A;  5FER A;  3DWD A;  3LDY A;  2PUY A;  3O47 A;  2MUM A;  1E4U A;  4L58 A;  4GNG A;  2DJA A;  2EGM A;  3LQH A;  2YQM A;  5TDR A;  4OGE A;  3U5N A;  4Z0O A;  5SVI B;  2CKL A;  2PNX A;  3U5P A;  4YAX A;  3N9O A;  2IDA A;  2KKX A;  2LRI C;  2G45 A;  4R7E A;  3LVR E;  2L0B A;  2K16 A;  4AP4 A;  2KFT A;  2CSZ A;  4A49 A;  2XEU A;  1BOR A;  4FJC A;  1WEE A;  2VP7 A;  2M13 A;  2CKL B;  5H1U A;  2Y1M A;  3T6R A;  1X4U A;  4QF3 A;  2YHO A;  4WZ2 A;  1Z6U A;  2C2L A;  3U5M A;  5B78 A;  2ECV A;  3SOX A;  1WEN A;  4A4B A;  2XOY A;  3GL6 A;  4LJN A;  4QQ4 A;  4R2Y A;  2M3H A;  1WEM A;  5SVX A; 
#chains in the Genus database with same CATH homology
 1VYX A;  4ZDT A;  3U5O A;  2FUU A;  4N4F A;  5G0F A;  3N9Q A;  3RPG C;  2L5U A;  5FB0 A;  1HYI A;  3RPG B;  2JRJ A;  4I7C A;  1JM7 B;  2MNZ A;  4A4C A;  4LAD B;  2E6S A;  2G6Q A;  4FK5 A;  3KQI A;  4PTB A;  4LKA A;  2EGP A;  2LV9 A;  4I7B A;  3PHD A;  4CA1 A;  2XB1 A;  2KIZ A;  4AYC A;  5TBN A;  2YRE A;  4TKP B;  4V3L C;  4AUQ B;  1VFY A;  1ZBD B;  1X4J A;  2VPD A;  3DQV R;  3M63 A;  2F6J A;  2C2V S;  4YBS A;  3ZPV E;  1VD4 A;  4BBQ A;  4AVX A;  2L75 A;  5DKA A;  2YQL A;  4YBT A;  2YW8 A;  2RSD A;  3KV6 A;  4MVT A;  4AYC B;  2F42 A;  3ZTG A;  4QF2 A;  2MA5 A;  2VJF A;  2K17 A;  3NG2 A;  2MD8 C;  3GV4 A;  3C5K A;  2L43 A;  2F6N A;  3ZVY A;  5B76 A;  2KWK A;  4WZ0 A;  2EA6 A;  2LXP C;  2OXQ C;  2YT5 A;  2YUC A;  2YHN A;  2CT2 A;  1Z2Q A;  4B7Y C;  2KGI A;  3O34 A;  2Y1N A;  1WEV A;  5B8D A;  4X3G A;  2AN6 A;  2KGG A;  4O64 A;  4YAD A;  2ECG A;  2DX8 A;  5B79 A;  4P5O B;  3N9L A;  5B75 A;  4V3K C;  4NN2 A;  2D8S A;  4R8P K;  5EYA F;  3MHS A;  4LK9 A;  4B86 C;  4BHW A;  5LCW B;  1WE9 A;  3ZVZ B;  4C9Z A;  3KNV A;  4S3O C;  4YAB A;  3IHP A;  3N9N A;  2L80 A;  2Y43 A;  5LKX A;  4S3O B;  2I50 A;  3LQJ A;  3O70 A;  2MT5 A;  5H1T A;  5H1V A;  2YYR A;  4PPE A;  1JOC A;  1WGM A;  1CHC A;  5KH3 A;  5AIU A;  1X4I A;  2RI7 A;  4N3W A;  4UI9 B;  2ECW A;  4IC2 A;  2G43 A;  3L1X A;  2YU4 A;  1WIL A;  2ECJ A;  4UP0 A;  1WEP A;  3DPL R;  3EB5 A;  3LQI A;  3N9P A;  2YSJ A;  3M62 A;  2LDR A;  2KWO A;  2M6M A;  2UZG A;  1FP0 A;  2M85 A;  3HCT A;  2VJE A;  3MHH A;  3O37 A;  1MM3 A;  2YSM A;  5DIN A;  3SOU A;  2JMD A;  4WZ3 B;  5C11 A;  4I7D A;  3FL2 A;  2LN0 A;  4YC9 A;  2LXH C;  2MD7 B;  2KYU A;  3QZV A;  5KH9 A;  4YAT A;  3ZYQ A;  1XWH A;  3O35 A;  2VJE B;  5TAB A;  2ECN A;  2LGL A;  1DVP A;  2MA6 A;  2K1J A;  4YBM A;  3KV5 A;  3HTK C;  4GNF A;  1U6G B;  1WEQ A;  2HYE D;  1K2F A;  2BAY A;  1HYJ A;  5D1M B;  2KRE A;  3O36 A;  2H0D A;  1F62 A;  5FEY A;  2ZET C;  2KWJ A;  5I3L A;  5LKZ A;  4FO9 A;  2CSY A;  2VJF B;  3N9M A;  1LDK C;  4Q6F A;  3I2D A;  4IC3 A;  3C6W A;  5TDW A;  1WIM A;  5D1K B;  2MNY A;  4W4U A;  1V87 A;  2LQ6 A;  2ECI A;  2KE1 A;  2H0D B;  5TRB A;  2LGV A;  2YUR A;  3M99 A;  3O7A A;  4LLB A;  4ZQL A;  3ZPV 1;  5G05 B;  1N87 A;  4L7X A;  1G25 A;  5JG6 A;  2KU3 A;  3LRQ A;  5C13 A;  5G04 B;  2VPE A;  3ZNI A;  2LGK A;  2VPB A;  2LGG A;  1JM7 A;  1WEU A;  5LKT A;  4CCG X;  5LKU A;  5KH7 A;  2FUI A;  1LDJ B;  1T1H A;  4A0C D;  2ECT A;  3PUQ A;  2VPG A;  5D1L B;  2JMI A;  4MSX A;  3VK6 A;  3SOW A;  4GNE A;  4WA6 A;  3PUR A;  3EB6 A;  3HCU A;  4F52 B;  2K4D A;  2EOD A;  1WES A;  5FB1 A;  2HDP A;  3SHB A;  3O33 A;  2KWN A;  5AIT A;  5J3X A;  4XI1 A;  1MM2 A;  3V43 A;  2M1R A;  2JMJ A;  4UP5 A;  3L11 A;  2QIZ A;  3HCS A;  2FSA A;  2QIC A;  1IYM A;  3L1Z B;  4ZUX U;  5H9M A;  1RMD A;  3T7L A;  1WFK A;  5B77 A;  1WEW A;  2KR4 A;  2NAA A;  1FBV A;  3RTR B;  2MIQ A;  1Z60 A;  4FIP A;  2QJ0 A;  4GB0 A;  2VNF A;  2E6R A;  3ASL A;  1WEO A;  4GND A;  5FER A;  2PUY A;  2MUM A;  1E4U A;  4L58 A;  4GNG A;  3LQH A;  2YQM A;  5TDR A;  3U5N A;  2CKL A;  2PNX A;  3U5P A;  4YAX A;  3N9O A;  2IDA A;  2LRI C;  2G45 A;  4R7E A;  2L0B A;  2K16 A;  4AP4 A;  2KFT A;  2CSZ A;  4A49 A;  2XEU A;  1BOR A;  4FJC A;  1WEE A;  2VP7 A;  2CKL B;  5H1U A;  2Y1M A;  3T6R A;  1X4U A;  4QF3 A;  2YHO A;  4WZ2 A;  1Z6U A;  2C2L A;  3U5M A;  5B78 A;  2ECV A;  3SOX A;  1WEN A;  4A4B A;  3GL6 A;  4LJN A;  4R2Y A;  2M3H A;  1WEM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...