3GV4A

Crystal structure of human hdac6 zinc finger domain and ubiquitin c-terminal peptide rlrgg
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
99
structure length
99
Chain Sequence
PLPWCPHLVAVCPIPAAGLDVTQPCGDCGTIQENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYVHHQALLDVKNIAHQNKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human HDAC6 zinc finger domain and ubiquitin C-terminal peptide RLRGG
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Histone deacetylase 6
total genus 31
structure length 99
sequence length 99
ec nomenclature ec 3.5.1.98: Histone deacetylase.
pdb deposition date 2009-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3gv4A00
2MIQA 2MNZA 1WGMA 4LJNA 5C11A 2HDPA 4F52B 1Z2QA 1FBVA 5EYAF 2K1JA 2DX8A 4ZUXU 2Y43A 2D8SA 2MD8C 1WEVA 2AN6A 3I2DA 2H0DA 3LRQA 3O70A 3M63A 1LDKC 2RSDA 4W4UA 3ZYQA 2C2LA 1WE9A 5B76A 3MHHA 3PURA 3O35A 3C5KA 5LCWB 5G0FA 2RI7A 1WENA 2PNXA 3RTRB 2CSYA 2KWKA 5H1VA 2VPEA 2KWOA 4I7BA 2F42A 2YU4A 5KH7A 4AUQB 3MHSA 2K16A 2LGKA 5D1MB 1WEOA 3GV4A 2MA6A 2LGGA 1X4JA 2K17A 5C13A 4AYCB 2MUMA 2LGLA 1HYJA 2KE1A 1FP0A 2E6SA 3HCUA 5KH3A 2MT5A 3U5OA 2NAAA 4UI9B 2YQLA 2E6RA 1F62A 2KIZA 2OXQC 5D1LB 4GNDA 3PUQA 3HCTA 5AITA 1WEEA 5TDWA 3EB5A 2M6MA 2ZETC 5B77A 4GB0A 3HTKC 1WFKA 2G6QA 2BAYA 5G05B 4BBQA 5AIUA 2ECVA 5DINA 2VPBA 3T7LA 3O36A 2G45A 2QJ0A 5LKUA 2YQMA 2YUCA 2MA5A 2UZGA 2YSJA 4TKPB 4GNFA 2VNFA 3N9QA 2EODA 2JMJA 1IYMA 5LKTA 4V3KC 5B79A 4YBTA 1XWHA 3N9OA 2KWJA 2CSZA 1JM7B 2EA6A 4LADB 1N87A 4YAXA 4XI1A 4S3OB 3U5MA 4MVTA 4NN2A 4FK5A 3U5PA 3L1XA 4AYCA 2ECIA 1WEWA 3SOXA 2KGGA 2VJFA 2KYUA 1LDJB 3KV5A 1CHCA 4N4FA 1Z60A 4FJCA 2YHOA 5J3XA 2KWNA 2L0BA 2JRJA 4GNEA 1E4UA 4B86C 2FSAA 2VJEB 1WIMA 3VK6A 5B75A 4WZ0A 2HYED 3V43A 5H1TA 3SHBA 4A4CA 5KH9A 2ECJA 2LQ6A 2YREA 3M62A 2M85A 2VPGA 4ZDTA 2QIZA 3QZVA 1HYIA 3SOUA 4PTBA 1BORA 1VYXA 5H1UA 3KQIA 5LKXA 4L7XA 2LDRA 2YW8A 2VJFB 4A49A 3C6WA 4N3WA 4O64A 5H9MA 4LKAA 1DVPA 2YT5A 5FEYA 3EB6A 3ZPVE 2H0DB 4C9ZA 4YBMA 3LQJA 2XEUA 1RMDA 4FIPA 2LRIC 4LLBA 2F6JA 2EGPA 3SOWA 3LQIA 5DKAA 4A0CD 3ZTGA 1WEPA 2CKLA 2MNYA 3N9PA 4BHWA 3O7AA 3L11A 4QF2A 1MM3A 4YBSA 2F6NA 5B78A 4IC3A 2L43A 2KGIA 1WILA 4UP0A 1V87A 3O34A 3FL2A 2G43A 4WZ2A 5TRBA 2YSMA 2ECWA 5FB1A 2LXHC 2KFTA 4YADA 3T6RA 3PHDA 1T1HA 2ECTA 1VD4A 2Y1MA 2L5UA 3ASLA 2ECGA 3RPGC 1WEQA 1WEUA 4UP5A 1ZBDB 2CKLB 1X4IA 2LV9A 2IDAA 5I3LA 2M1RA 1MM2A 3L1ZB 2VJEA 2LGVA 5B8DA 4R8PK 3DPLR 4Q6FA 1G25A 4LK9A 4A4BA 1VFYA 2KREA 3HCSA 4AVXA 3KV6A 2L75A 2YURA 4YABA 3GL6A 1X4UA 2CT2A 3N9MA 2JMDA 4AP4A 3DQVR 3ZNIA 2KU3A 3RPGB 2L80A 5D1KB 3NG2A 1WESA 3M99A 2MD7B 2YYRA 4MSXA 4V3LC 1K2FA 4FO9A 1U6GB 3LQHA 4IC2A 2Y1NA 5FB0A 3ZVYA 2C2VS 3KNVA 5FERA 2JMIA 4L58A 2LN0A 2FUUA 4WA6A 4WZ3B 2YHNA 3N9NA 4R7EA 3N9LA 1WEMA 2KR4A 2ECNA 3IHPA 4GNGA 2K4DA 4CCGX 4S3OC 4QF3A 5TBNA 5TABA 2VPDA 2VP7A 3ZVZB 3ZPV1 1JOCA 2XB1A 5LKZA 2LXPC 2M3HA 2QICA 1Z6UA 4P5OB 4X3GA 2FUIA 4R2YA 4PPEA 4B7YC 3O37A 4I7DA 4CA1A 5G04B 2I50A 4ZQLA 3O33A 3U5NA 4YC9A 1JM7A 5JG6A 4I7CA 4YATA 5TDRA 2PUYA
chains in the Genus database with same CATH superfamily
2MIQA 2MNZA 1WGMA 2FD4A 3FEHA 4LJNA 5C11A 2HDPA 4F52B 1Z2QA 1FBVA 5EYAF 2K1JA 2JUNA 2M13A 3H7HA 2OWAA 2DX8A 4ZUXU 2Y43A 2D8SA 2MD8C 1WEVA 2AN6A 3I2DA 2H0DA 2L7PA 2E61A 3LRQA 3O70A 3M63A 1LDKC 2RSDA 4W4UA 3ZYQA 2C2LA 1WE9A 5B76A 3MHHA 3PURA 2B0OE 2FFWA 3O35A 3Q1DA 3C5KA 5LCWB 5G0FA 2RI7A 1WENA 2PNXA 3RTRB 2CSYA 2KWKA 5H1VA 2VPEA 2KWOA 4I7BA 2F42A 2YU4A 5KH7A 4AUQB 3MHSA 3SUBA 2K16A 2LGKA 5D1MB 1WEOA 3GV4A 2MA6A 2LGGA 3M7KA 5SVXA 1X4JA 2K17A 5C13A 4AYCB 2MUMA 2LGLA 1HYJA 2KE1A 1FP0A 2E6SA 3HCUA 2CSVA 2EXUA 4O62A 5KH3A 2MT5A 3U5OA 2NAAA 4UI9B 2YQLA 2E6RA 2P57A 1F62A 2KIZA 2OXQC 5D1LB 4GNDA 3PUQA 3HCTA 5AITA 1WEEA 5TDWA 4Z0RA 3EB5A 2M6MA 2ZETC 5B77A 4GB0A 3HTKC 1WFKA 2G6QA 2BAYA 5G05B 4BBQA 5AIUA 2ECVA 5DINA 2VPBA 3T7LA 4QQ4A 3O36A 2G45A 2QJ0A 5LKUA 2YQMA 2LAUA 2YUCA 2MA5A 2UZGA 2YSJA 4TKPB 4GNFA 2VNFA 3N9QA 2EODA 2JMJA 3MDBC 1IYMA 5LKTA 4V3KC 5B79A 4YBTA 1XWHA 3N9OA 2KWJA 2CSZA 1JM7B 2CRWA 2EA6A 3FJUB 4LADB 1N87A 4YAXA 3O47A 4XI1A 4S3OB 3U5MA 4MVTA 2KKXA 2RR4A 4NN2A 4FK5A 3U5PA 3DWDA 3L1XA 4AYCA 2ECIA 1WEWA 3SOXA 3FAOA 2KGGA 2VJFA 2KYUA 1LDJB 3KV5A 1CHCA 4N4FA 1Z60A 4FJCA 2YHOA 5J3XA 2KWNA 2L0BA 2JRJA 4GNEA 1E4UA 4B86C 2FSAA 2VJEB 1WIMA 3VK6A 4OGEA 5B75A 2CONA 2XOCA 2CRRA 4WZ0A 3FM8C 2HYED 3T9KA 3V43A 2EGMA 5H1TA 3SHBA 5SVYA 4A4CA 5KH9A 2ECJA 2LQ6A 2YREA 3M62A 2M85A 2VPGA 4ZDTA 2QIZA 3QZVA 1HYIA 3SOUA 3JUEA 1MBMA 4PTBA 3FANA 1BORA 1VYXA 5H1UA 2KKYA 3KQIA 5LKXA 4L7XA 2LDRA 2YW8A 2VJFB 4A49A 3C6WA 4N3WA 4O64A 5H9MA 4LKAA 1DVPA 2YT5A 5FEYA 4OGCA 3EB6A 3ZPVE 2H0DB 4C9ZA 4YBMA 3LQJA 2XEUA 1RMDA 3E2DA 4H9DA 4FIPA 1DCQA 2LRIC 4LLBA 2F6JA 2EGPA 3SOWA 3LQIA 2MKEA 5DKAA 4A0CD 3ZTGA 3LVQE 1WEPA 2CKLA 2MNYA 3N9PA 2XOZA 4BHWA 3O7AA 3L11A 4QF2A 5SVIB 1MM3A 4YBSA 2F6NA 5B78A 4IC3A 2L43A 2KGIA 2JM3A 1WILA 4UP0A 1V87A 3O34A 3FL2A 2G43A 4WZ2A 5TRBA 2YSMA 2ECWA 5FB1A 2LXHC 2KFTA 4YADA 3T6RA 3LDYA 3PHDA 1T1HA 2ECTA 1VD4A 2Y1MA 2L5UA 2DSMA 3ASLA 2YVRA 2IQJA 2ECGA 3RPGC 1WEQA 1WEUA 4UP5A 1ZBDB 2CKLB 3LJUX 1X4IA 2LV9A 2IDAA 5I3LA 2M1RA 1MM2A 3L1ZB 2VJEA 2LGVA 5B8DA 4R8PK 3DPLR 4Q6FA 1G25A 4LK9A 4A4BA 1VFYA 2KREA 3HCSA 4AVXA 3KV6A 2L75A 2YURA 4YABA 3GL6A 1X4UA 2CT2A 3N9MA 2JMDA 5SVIA 4AP4A 3DQVR 3ZNIA 2KU3A 3RPGB 2L80A 5D1KB 3NG2A 1WESA 3M99A 2MD7B 2YYRA 4MSXA 4V3LC 1K2FA 2XOYA 4FO9A 1U6GB 3LQHA 4IC2A 2Y1NA 3DDTA 5FB0A 3ZVYA 2XP0A 2C2VS 3KNVA 5FERA 3LVRE 2JMIA 4L58A 2LN0A 2FUUA 4WA6A 4WZ3B 2YHNA 3N9NA 4R7EA 3N9LA 3KDEC 1WEMA 2KR4A 2ECNA 3IHPA 4GNGA 4F1PA 2K4DA 2DJAA 3PLWA 4CCGX 4S3OC 5K3QA 4QF3A 5TBNA 5TABA 2VPDA 2VP7A 3ZVZB 3ZPV1 1JOCA 2XB1A 5LKZA 2LXPC 2M3HA 2QICA 1Z6UA 4Z0OA 4P5OB 4X3GA 2FUIA 4R2YA 4PPEA 4B7YC 3O37A 4I7DA 4CA1A 5G04B 2D8UA 2I50A 4ZQLA 3O33A 3U5NA 4YC9A 1JM7A 5JG6A 4I7CA 4YATA 5TDRA 2PUYA
chains in the Genus database with same CATH topology
2MIQA 2MNZA 1WGMA 4LJNA 5C11A 2HDPA 4F52B 1Z2QA 1FBVA 5EYAF 2K1JA 2DX8A 4ZUXU 2Y43A 2D8SA 2MD8C 1WEVA 2AN6A 3I2DA 2H0DA 3LRQA 3O70A 3M63A 1LDKC 2RSDA 4W4UA 3ZYQA 2C2LA 1WE9A 5B76A 3MHHA 3PURA 3O35A 3C5KA 5LCWB 5G0FA 2RI7A 1WENA 2PNXA 3RTRB 2CSYA 2KWKA 5H1VA 2VPEA 2KWOA 4I7BA 2F42A 2YU4A 5KH7A 4AUQB 3MHSA 2K16A 2LGKA 5D1MB 1WEOA 3GV4A 2MA6A 2LGGA 1X4JA 2K17A 5C13A 4AYCB 2MUMA 2LGLA 1HYJA 2KE1A 1FP0A 2E6SA 3HCUA 5KH3A 2MT5A 3U5OA 2NAAA 4UI9B 2YQLA 2E6RA 1F62A 2KIZA 2OXQC 5D1LB 4GNDA 3PUQA 3HCTA 5AITA 1WEEA 5TDWA 3EB5A 2M6MA 2ZETC 5B77A 4GB0A 3HTKC 1WFKA 2G6QA 2BAYA 5G05B 4BBQA 5AIUA 2ECVA 5DINA 2VPBA 3T7LA 3O36A 2G45A 2QJ0A 5LKUA 2YQMA 2YUCA 2MA5A 2UZGA 2YSJA 4TKPB 4GNFA 2VNFA 3N9QA 2EODA 2JMJA 1IYMA 5LKTA 4V3KC 5B79A 4YBTA 1XWHA 3N9OA 2KWJA 2CSZA 1JM7B 2EA6A 4LADB 1N87A 4YAXA 4XI1A 4S3OB 3U5MA 4MVTA 4NN2A 4FK5A 3U5PA 3L1XA 4AYCA 2ECIA 1WEWA 3SOXA 2KGGA 2VJFA 2KYUA 1LDJB 3KV5A 1CHCA 4N4FA 1Z60A 4FJCA 2YHOA 5J3XA 2KWNA 2L0BA 2JRJA 4GNEA 1E4UA 4B86C 2FSAA 2VJEB 1WIMA 3VK6A 5B75A 4WZ0A 2HYED 3V43A 5H1TA 3SHBA 4A4CA 5KH9A 2ECJA 2LQ6A 2YREA 3M62A 2M85A 2VPGA 4ZDTA 2QIZA 3QZVA 1HYIA 3SOUA 4PTBA 1BORA 1VYXA 5H1UA 3KQIA 5LKXA 4L7XA 2LDRA 2YW8A 2VJFB 4A49A 3C6WA 4N3WA 4O64A 5H9MA 4LKAA 1DVPA 2YT5A 5FEYA 3EB6A 3ZPVE 2H0DB 4C9ZA 4YBMA 3LQJA 2XEUA 1RMDA 4FIPA 2LRIC 4LLBA 2F6JA 2EGPA 3SOWA 3LQIA 5DKAA 4A0CD 3ZTGA 1WEPA 2CKLA 2MNYA 3N9PA 4BHWA 3O7AA 3L11A 4QF2A 1MM3A 4YBSA 2F6NA 5B78A 4IC3A 2L43A 2KGIA 1WILA 4UP0A 1V87A 3O34A 3FL2A 2G43A 4WZ2A 5TRBA 2YSMA 2ECWA 5FB1A 2LXHC 2KFTA 4YADA 3T6RA 3PHDA 1T1HA 2ECTA 1VD4A 2Y1MA 2L5UA 3ASLA 2ECGA 3RPGC 1WEQA 1WEUA 4UP5A 1ZBDB 2CKLB 1X4IA 2LV9A 2IDAA 5I3LA 2M1RA 1MM2A 3L1ZB 2VJEA 2LGVA 5B8DA 4R8PK 3DPLR 4Q6FA 1G25A 4LK9A 4A4BA 1VFYA 2KREA 3HCSA 4AVXA 3KV6A 2L75A 2YURA 4YABA 3GL6A 1X4UA 2CT2A 3N9MA 2JMDA 4AP4A 3DQVR 3ZNIA 2KU3A 3RPGB 2L80A 5D1KB 3NG2A 1WESA 3M99A 2MD7B 2YYRA 4MSXA 4V3LC 1K2FA 4FO9A 1U6GB 3LQHA 4IC2A 2Y1NA 5FB0A 3ZVYA 2C2VS 3KNVA 5FERA 2JMIA 4L58A 2LN0A 2FUUA 4WA6A 4WZ3B 2YHNA 3N9NA 4R7EA 3N9LA 1WEMA 2KR4A 2ECNA 3IHPA 4GNGA 2K4DA 4CCGX 4S3OC 4QF3A 5TBNA 5TABA 2VPDA 2VP7A 3ZVZB 3ZPV1 1JOCA 2XB1A 5LKZA 2LXPC 2M3HA 2QICA 1Z6UA 4P5OB 4X3GA 2FUIA 4R2YA 4PPEA 4B7YC 3O37A 4I7DA 4CA1A 5G04B 2I50A 4ZQLA 3O33A 3U5NA 4YC9A 1JM7A 5JG6A 4I7CA 4YATA 5TDRA 2PUYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MIQ A;  2MNZ A;  1WGM A;  4LJN A;  5C11 A;  2HDP A;  4F52 B;  1Z2Q A;  1FBV A;  5EYA F;  2K1J A;  2DX8 A;  4ZUX U;  2Y43 A;  2D8S A;  2MD8 C;  1WEV A;  2AN6 A;  3I2D A;  2H0D A;  3LRQ A;  3O70 A;  3M63 A;  1LDK C;  2RSD A;  4W4U A;  3ZYQ A;  2C2L A;  1WE9 A;  5B76 A;  3MHH A;  3PUR A;  3O35 A;  3C5K A;  5LCW B;  5G0F A;  2RI7 A;  1WEN A;  2PNX A;  3RTR B;  2CSY A;  2KWK A;  5H1V A;  2VPE A;  2KWO A;  4I7B A;  2F42 A;  2YU4 A;  5KH7 A;  4AUQ B;  3MHS A;  2K16 A;  2LGK A;  5D1M B;  1WEO A;  3GV4 A;  2MA6 A;  2LGG A;  1X4J A;  2K17 A;  5C13 A;  4AYC B;  2MUM A;  2LGL A;  1HYJ A;  2KE1 A;  1FP0 A;  2E6S A;  3HCU A;  5KH3 A;  2MT5 A;  3U5O A;  2NAA A;  4UI9 B;  2YQL A;  2E6R A;  1F62 A;  2KIZ A;  2OXQ C;  5D1L B;  4GND A;  3PUQ A;  3HCT A;  5AIT A;  1WEE A;  5TDW A;  3EB5 A;  2M6M A;  2ZET C;  5B77 A;  4GB0 A;  3HTK C;  1WFK A;  2G6Q A;  2BAY A;  5G05 B;  4BBQ A;  5AIU A;  2ECV A;  5DIN A;  2VPB A;  3T7L A;  3O36 A;  2G45 A;  2QJ0 A;  5LKU A;  2YQM A;  2YUC A;  2MA5 A;  2UZG A;  2YSJ A;  4TKP B;  4GNF A;  2VNF A;  3N9Q A;  2EOD A;  2JMJ A;  1IYM A;  5LKT A;  4V3K C;  5B79 A;  4YBT A;  1XWH A;  3N9O A;  2KWJ A;  2CSZ A;  1JM7 B;  2EA6 A;  4LAD B;  1N87 A;  4YAX A;  4XI1 A;  4S3O B;  3U5M A;  4MVT A;  4NN2 A;  4FK5 A;  3U5P A;  3L1X A;  4AYC A;  2ECI A;  1WEW A;  3SOX A;  2KGG A;  2VJF A;  2KYU A;  1LDJ B;  3KV5 A;  1CHC A;  4N4F A;  1Z60 A;  4FJC A;  2YHO A;  5J3X A;  2KWN A;  2L0B A;  2JRJ A;  4GNE A;  1E4U A;  4B86 C;  2FSA A;  2VJE B;  1WIM A;  3VK6 A;  5B75 A;  4WZ0 A;  2HYE D;  3V43 A;  5H1T A;  3SHB A;  4A4C A;  5KH9 A;  2ECJ A;  2LQ6 A;  2YRE A;  3M62 A;  2M85 A;  2VPG A;  4ZDT A;  2QIZ A;  3QZV A;  1HYI A;  3SOU A;  4PTB A;  1BOR A;  1VYX A;  5H1U A;  3KQI A;  5LKX A;  4L7X A;  2LDR A;  2YW8 A;  2VJF B;  4A49 A;  3C6W A;  4N3W A;  4O64 A;  5H9M A;  4LKA A;  1DVP A;  2YT5 A;  5FEY A;  3EB6 A;  3ZPV E;  2H0D B;  4C9Z A;  4YBM A;  3LQJ A;  2XEU A;  1RMD A;  4FIP A;  2LRI C;  4LLB A;  2F6J A;  2EGP A;  3SOW A;  3LQI A;  5DKA A;  4A0C D;  3ZTG A;  1WEP A;  2CKL A;  2MNY A;  3N9P A;  4BHW A;  3O7A A;  3L11 A;  4QF2 A;  1MM3 A;  4YBS A;  2F6N A;  5B78 A;  4IC3 A;  2L43 A;  2KGI A;  1WIL A;  4UP0 A;  1V87 A;  3O34 A;  3FL2 A;  2G43 A;  4WZ2 A;  5TRB A;  2YSM A;  2ECW A;  5FB1 A;  2LXH C;  2KFT A;  4YAD A;  3T6R A;  3PHD A;  1T1H A;  2ECT A;  1VD4 A;  2Y1M A;  2L5U A;  3ASL A;  2ECG A;  3RPG C;  1WEQ A;  1WEU A;  4UP5 A;  1ZBD B;  2CKL B;  1X4I A;  2LV9 A;  2IDA A;  5I3L A;  2M1R A;  1MM2 A;  3L1Z B;  2VJE A;  2LGV A;  5B8D A;  4R8P K;  3DPL R;  4Q6F A;  1G25 A;  4LK9 A;  4A4B A;  1VFY A;  2KRE A;  3HCS A;  4AVX A;  3KV6 A;  2L75 A;  2YUR A;  4YAB A;  3GL6 A;  1X4U A;  2CT2 A;  3N9M A;  2JMD A;  4AP4 A;  3DQV R;  3ZNI A;  2KU3 A;  3RPG B;  2L80 A;  5D1K B;  3NG2 A;  1WES A;  3M99 A;  2MD7 B;  2YYR A;  4MSX A;  4V3L C;  1K2F A;  4FO9 A;  1U6G B;  3LQH A;  4IC2 A;  2Y1N A;  5FB0 A;  3ZVY A;  2C2V S;  3KNV A;  5FER A;  2JMI A;  4L58 A;  2LN0 A;  2FUU A;  4WA6 A;  4WZ3 B;  2YHN A;  3N9N A;  4R7E A;  3N9L A;  1WEM A;  2KR4 A;  2ECN A;  3IHP A;  4GNG A;  2K4D A;  4CCG X;  4S3O C;  4QF3 A;  5TBN A;  5TAB A;  2VPD A;  2VP7 A;  3ZVZ B;  3ZPV 1;  1JOC A;  2XB1 A;  5LKZ A;  2LXP C;  2M3H A;  2QIC A;  1Z6U A;  4P5O B;  4X3G A;  2FUI A;  4R2Y A;  4PPE A;  4B7Y C;  3O37 A;  4I7D A;  4CA1 A;  5G04 B;  2I50 A;  4ZQL A;  3O33 A;  3U5N A;  4YC9 A;  1JM7 A;  5JG6 A;  4I7C A;  4YAT A;  5TDR A;  2PUY A; 
#chains in the Genus database with same CATH topology
 2MIQ A;  2MNZ A;  1WGM A;  2FD4 A;  3FEH A;  4LJN A;  5C11 A;  2HDP A;  4F52 B;  1Z2Q A;  1FBV A;  5EYA F;  2K1J A;  2JUN A;  2M13 A;  3H7H A;  2OWA A;  2DX8 A;  4ZUX U;  2Y43 A;  2D8S A;  2MD8 C;  1WEV A;  2AN6 A;  3I2D A;  2H0D A;  2L7P A;  2E61 A;  3LRQ A;  3O70 A;  3M63 A;  1LDK C;  2RSD A;  4W4U A;  3ZYQ A;  2C2L A;  1WE9 A;  5B76 A;  3MHH A;  3PUR A;  2B0O E;  2FFW A;  3O35 A;  3Q1D A;  3C5K A;  5LCW B;  5G0F A;  2RI7 A;  1WEN A;  2PNX A;  3RTR B;  2CSY A;  2KWK A;  5H1V A;  2VPE A;  2KWO A;  4I7B A;  2F42 A;  2YU4 A;  5KH7 A;  4AUQ B;  3MHS A;  3SUB A;  2K16 A;  2LGK A;  5D1M B;  1WEO A;  3GV4 A;  2MA6 A;  2LGG A;  3M7K A;  5SVX A;  1X4J A;  2K17 A;  5C13 A;  4AYC B;  2MUM A;  2LGL A;  1HYJ A;  2KE1 A;  1FP0 A;  2E6S A;  3HCU A;  2CSV A;  2EXU A;  4O62 A;  5KH3 A;  2MT5 A;  3U5O A;  2NAA A;  4UI9 B;  2YQL A;  2E6R A;  2P57 A;  1F62 A;  2KIZ A;  2OXQ C;  5D1L B;  4GND A;  3PUQ A;  3HCT A;  5AIT A;  1WEE A;  5TDW A;  4Z0R A;  3EB5 A;  2M6M A;  2ZET C;  5B77 A;  4GB0 A;  3HTK C;  1WFK A;  2G6Q A;  2BAY A;  5G05 B;  4BBQ A;  5AIU A;  2ECV A;  5DIN A;  2VPB A;  3T7L A;  4QQ4 A;  3O36 A;  2G45 A;  2QJ0 A;  5LKU A;  2YQM A;  2LAU A;  2YUC A;  2MA5 A;  2UZG A;  2YSJ A;  4TKP B;  4GNF A;  2VNF A;  3N9Q A;  2EOD A;  2JMJ A;  3MDB C;  1IYM A;  5LKT A;  4V3K C;  5B79 A;  4YBT A;  1XWH A;  3N9O A;  2KWJ A;  2CSZ A;  1JM7 B;  2CRW A;  2EA6 A;  3FJU B;  4LAD B;  1N87 A;  4YAX A;  3O47 A;  4XI1 A;  4S3O B;  3U5M A;  4MVT A;  2KKX A;  2RR4 A;  4NN2 A;  4FK5 A;  3U5P A;  3DWD A;  3L1X A;  4AYC A;  2ECI A;  1WEW A;  3SOX A;  3FAO A;  2KGG A;  2VJF A;  2KYU A;  1LDJ B;  3KV5 A;  1CHC A;  4N4F A;  1Z60 A;  4FJC A;  2YHO A;  5J3X A;  2KWN A;  2L0B A;  2JRJ A;  4GNE A;  1E4U A;  4B86 C;  2FSA A;  2VJE B;  1WIM A;  3VK6 A;  4OGE A;  5B75 A;  2CON A;  2XOC A;  2CRR A;  4WZ0 A;  3FM8 C;  2HYE D;  3T9K A;  3V43 A;  2EGM A;  5H1T A;  3SHB A;  5SVY A;  4A4C A;  5KH9 A;  2ECJ A;  2LQ6 A;  2YRE A;  3M62 A;  2M85 A;  2VPG A;  4ZDT A;  2QIZ A;  3QZV A;  1HYI A;  3SOU A;  3JUE A;  1MBM A;  4PTB A;  3FAN A;  1BOR A;  1VYX A;  5H1U A;  2KKY A;  3KQI A;  5LKX A;  4L7X A;  2LDR A;  2YW8 A;  2VJF B;  4A49 A;  3C6W A;  4N3W A;  4O64 A;  5H9M A;  4LKA A;  1DVP A;  2YT5 A;  5FEY A;  4OGC A;  3EB6 A;  3ZPV E;  2H0D B;  4C9Z A;  4YBM A;  3LQJ A;  2XEU A;  1RMD A;  3E2D A;  4H9D A;  4FIP A;  1DCQ A;  2LRI C;  4LLB A;  2F6J A;  2EGP A;  3SOW A;  3LQI A;  2MKE A;  5DKA A;  4A0C D;  3ZTG A;  3LVQ E;  1WEP A;  2CKL A;  2MNY A;  3N9P A;  2XOZ A;  4BHW A;  3O7A A;  3L11 A;  4QF2 A;  5SVI B;  1MM3 A;  4YBS A;  2F6N A;  5B78 A;  4IC3 A;  2L43 A;  2KGI A;  2JM3 A;  1WIL A;  4UP0 A;  1V87 A;  3O34 A;  3FL2 A;  2G43 A;  4WZ2 A;  5TRB A;  2YSM A;  2ECW A;  5FB1 A;  2LXH C;  2KFT A;  4YAD A;  3T6R A;  3LDY A;  3PHD A;  1T1H A;  2ECT A;  1VD4 A;  2Y1M A;  2L5U A;  2DSM A;  3ASL A;  2YVR A;  2IQJ A;  2ECG A;  3RPG C;  1WEQ A;  1WEU A;  4UP5 A;  1ZBD B;  2CKL B;  3LJU X;  1X4I A;  2LV9 A;  2IDA A;  5I3L A;  2M1R A;  1MM2 A;  3L1Z B;  2VJE A;  2LGV A;  5B8D A;  4R8P K;  3DPL R;  4Q6F A;  1G25 A;  4LK9 A;  4A4B A;  1VFY A;  2KRE A;  3HCS A;  4AVX A;  3KV6 A;  2L75 A;  2YUR A;  4YAB A;  3GL6 A;  1X4U A;  2CT2 A;  3N9M A;  2JMD A;  5SVI A;  4AP4 A;  3DQV R;  3ZNI A;  2KU3 A;  3RPG B;  2L80 A;  5D1K B;  3NG2 A;  1WES A;  3M99 A;  2MD7 B;  2YYR A;  4MSX A;  4V3L C;  1K2F A;  2XOY A;  4FO9 A;  1U6G B;  3LQH A;  4IC2 A;  2Y1N A;  3DDT A;  5FB0 A;  3ZVY A;  2XP0 A;  2C2V S;  3KNV A;  5FER A;  3LVR E;  2JMI A;  4L58 A;  2LN0 A;  2FUU A;  4WA6 A;  4WZ3 B;  2YHN A;  3N9N A;  4R7E A;  3N9L A;  3KDE C;  1WEM A;  2KR4 A;  2ECN A;  3IHP A;  4GNG A;  4F1P A;  2K4D A;  2DJA A;  3PLW A;  4CCG X;  4S3O C;  5K3Q A;  4QF3 A;  5TBN A;  5TAB A;  2VPD A;  2VP7 A;  3ZVZ B;  3ZPV 1;  1JOC A;  2XB1 A;  5LKZ A;  2LXP C;  2M3H A;  2QIC A;  1Z6U A;  4Z0O A;  4P5O B;  4X3G A;  2FUI A;  4R2Y A;  4PPE A;  4B7Y C;  3O37 A;  4I7D A;  4CA1 A;  5G04 B;  2D8U A;  2I50 A;  4ZQL A;  3O33 A;  3U5N A;  4YC9 A;  1JM7 A;  5JG6 A;  4I7C A;  4YAT A;  5TDR A;  2PUY A; 
#chains in the Genus database with same CATH homology
 2MIQ A;  2MNZ A;  1WGM A;  4LJN A;  5C11 A;  2HDP A;  4F52 B;  1Z2Q A;  1FBV A;  5EYA F;  2K1J A;  2DX8 A;  4ZUX U;  2Y43 A;  2D8S A;  2MD8 C;  1WEV A;  2AN6 A;  3I2D A;  2H0D A;  3LRQ A;  3O70 A;  3M63 A;  1LDK C;  2RSD A;  4W4U A;  3ZYQ A;  2C2L A;  1WE9 A;  5B76 A;  3MHH A;  3PUR A;  3O35 A;  3C5K A;  5LCW B;  5G0F A;  2RI7 A;  1WEN A;  2PNX A;  3RTR B;  2CSY A;  2KWK A;  5H1V A;  2VPE A;  2KWO A;  4I7B A;  2F42 A;  2YU4 A;  5KH7 A;  4AUQ B;  3MHS A;  2K16 A;  2LGK A;  5D1M B;  1WEO A;  3GV4 A;  2MA6 A;  2LGG A;  1X4J A;  2K17 A;  5C13 A;  4AYC B;  2MUM A;  2LGL A;  1HYJ A;  2KE1 A;  1FP0 A;  2E6S A;  3HCU A;  5KH3 A;  2MT5 A;  3U5O A;  2NAA A;  4UI9 B;  2YQL A;  2E6R A;  1F62 A;  2KIZ A;  2OXQ C;  5D1L B;  4GND A;  3PUQ A;  3HCT A;  5AIT A;  1WEE A;  5TDW A;  3EB5 A;  2M6M A;  2ZET C;  5B77 A;  4GB0 A;  3HTK C;  1WFK A;  2G6Q A;  2BAY A;  5G05 B;  4BBQ A;  5AIU A;  2ECV A;  5DIN A;  2VPB A;  3T7L A;  3O36 A;  2G45 A;  2QJ0 A;  5LKU A;  2YQM A;  2YUC A;  2MA5 A;  2UZG A;  2YSJ A;  4TKP B;  4GNF A;  2VNF A;  3N9Q A;  2EOD A;  2JMJ A;  1IYM A;  5LKT A;  4V3K C;  5B79 A;  4YBT A;  1XWH A;  3N9O A;  2KWJ A;  2CSZ A;  1JM7 B;  2EA6 A;  4LAD B;  1N87 A;  4YAX A;  4XI1 A;  4S3O B;  3U5M A;  4MVT A;  4NN2 A;  4FK5 A;  3U5P A;  3L1X A;  4AYC A;  2ECI A;  1WEW A;  3SOX A;  2KGG A;  2VJF A;  2KYU A;  1LDJ B;  3KV5 A;  1CHC A;  4N4F A;  1Z60 A;  4FJC A;  2YHO A;  5J3X A;  2KWN A;  2L0B A;  2JRJ A;  4GNE A;  1E4U A;  4B86 C;  2FSA A;  2VJE B;  1WIM A;  3VK6 A;  5B75 A;  4WZ0 A;  2HYE D;  3V43 A;  5H1T A;  3SHB A;  4A4C A;  5KH9 A;  2ECJ A;  2LQ6 A;  2YRE A;  3M62 A;  2M85 A;  2VPG A;  4ZDT A;  2QIZ A;  3QZV A;  1HYI A;  3SOU A;  4PTB A;  1BOR A;  1VYX A;  5H1U A;  3KQI A;  5LKX A;  4L7X A;  2LDR A;  2YW8 A;  2VJF B;  4A49 A;  3C6W A;  4N3W A;  4O64 A;  5H9M A;  4LKA A;  1DVP A;  2YT5 A;  5FEY A;  3EB6 A;  3ZPV E;  2H0D B;  4C9Z A;  4YBM A;  3LQJ A;  2XEU A;  1RMD A;  4FIP A;  2LRI C;  4LLB A;  2F6J A;  2EGP A;  3SOW A;  3LQI A;  5DKA A;  4A0C D;  3ZTG A;  1WEP A;  2CKL A;  2MNY A;  3N9P A;  4BHW A;  3O7A A;  3L11 A;  4QF2 A;  1MM3 A;  4YBS A;  2F6N A;  5B78 A;  4IC3 A;  2L43 A;  2KGI A;  1WIL A;  4UP0 A;  1V87 A;  3O34 A;  3FL2 A;  2G43 A;  4WZ2 A;  5TRB A;  2YSM A;  2ECW A;  5FB1 A;  2LXH C;  2KFT A;  4YAD A;  3T6R A;  3PHD A;  1T1H A;  2ECT A;  1VD4 A;  2Y1M A;  2L5U A;  3ASL A;  2ECG A;  3RPG C;  1WEQ A;  1WEU A;  4UP5 A;  1ZBD B;  2CKL B;  1X4I A;  2LV9 A;  2IDA A;  5I3L A;  2M1R A;  1MM2 A;  3L1Z B;  2VJE A;  2LGV A;  5B8D A;  4R8P K;  3DPL R;  4Q6F A;  1G25 A;  4LK9 A;  4A4B A;  1VFY A;  2KRE A;  3HCS A;  4AVX A;  3KV6 A;  2L75 A;  2YUR A;  4YAB A;  3GL6 A;  1X4U A;  2CT2 A;  3N9M A;  2JMD A;  4AP4 A;  3DQV R;  3ZNI A;  2KU3 A;  3RPG B;  2L80 A;  5D1K B;  3NG2 A;  1WES A;  3M99 A;  2MD7 B;  2YYR A;  4MSX A;  4V3L C;  1K2F A;  4FO9 A;  1U6G B;  3LQH A;  4IC2 A;  2Y1N A;  5FB0 A;  3ZVY A;  2C2V S;  3KNV A;  5FER A;  2JMI A;  4L58 A;  2LN0 A;  2FUU A;  4WA6 A;  4WZ3 B;  2YHN A;  3N9N A;  4R7E A;  3N9L A;  1WEM A;  2KR4 A;  2ECN A;  3IHP A;  4GNG A;  2K4D A;  4CCG X;  4S3O C;  4QF3 A;  5TBN A;  5TAB A;  2VPD A;  2VP7 A;  3ZVZ B;  3ZPV 1;  1JOC A;  2XB1 A;  5LKZ A;  2LXP C;  2M3H A;  2QIC A;  1Z6U A;  4P5O B;  4X3G A;  2FUI A;  4R2Y A;  4PPE A;  4B7Y C;  3O37 A;  4I7D A;  4CA1 A;  5G04 B;  2I50 A;  4ZQL A;  3O33 A;  3U5N A;  4YC9 A;  1JM7 A;  5JG6 A;  4I7C A;  4YAT A;  5TDR A;  2PUY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...