3GV4A

Crystal structure of human hdac6 zinc finger domain and ubiquitin c-terminal peptide rlrgg
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
99
structure length
99
Chain Sequence
b'PLPWCPHLVAVCPIPAAGLDVTQPCGDCGTIQENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYVHHQALLDVKNIAHQNKF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone deacetylase 6
publication title Crystal structure of human HDAC6 zinc finger domain and ubiquitin C-terminal peptide RLRGG
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 31
structure length 99
sequence length 99
ec nomenclature ec 3.5.1.98: Histone deacetylase.
pdb deposition date 2009-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3gv4A00
3C5KA 2MNZA 2KFTA 2JMIA 2YSJA 2Y1NA 2H0DA 4AVXA 4V3KC 3PURA 2CKLB 2M6MA 3N9OA 3ZVYA 2H0DB 1X4UA 2HYED 1FP0A 2PNXA 3N9NA 3KV5A 2L75A 2K1JA 3RPGB 2K4DA 3VK6A 5B79A 5FEYA 2ECJA 2E6SA 5KH7A 4MVTA 1T1HA 4LADB 2I50A 4GNFA 4XI1A 4YBSA 2ZETC 5C13A 2L0BA 5FB1A 4YC9A 4UP0A 5H9MA 5DINA 4B86C 4P5OB 2LN0A 1JOCA 3N9LA 2XB1A 3ASLA 2YQLA 4LKAA 5LKXA 3T6RA 5FB0A 2CSZA 2G43A 4AYCA 2MT5A 2VJEA 1IYMA 5LKZA 1V87A 2ECGA 2D8SA 3LQHA 2VJFA 4WZ3B 3U5NA 2LGLA 4UP5A 5LKUA 2VJFB 2FUUA 2RI7A 1MM3A 2KWJA 2EODA 2EA6A 1X4JA 3KQIA 3O35A 3L11A 2YT5A 4PPEA 5G05B 4X3GA 4FK5A 5D1KB 4FIPA 4QF3A 2IDAA 4A0CD 3SOXA 3PHDA 4A49A 5B78A 1WILA 2C2LA 3C6WA 1WEPA 4CCGX 5J3XA 3SOWA 2KIZA 1CHCA 2F6NA 5KH9A 3RPGC 2MD7B 3SOUA 2KR4A 2DX8A 3L1ZB 2F42A 5KH3A 1WEEA 1WEWA 3PUQA 3HTKC 2YREA 2M85A 2LGKA 5LCWB 4FJCA 3MHHA 2L43A 2M3HA 3M63A 1WGMA 5B8DA 1LDKC 3O33A 2CKLA 4YAXA 3O37A 5TBNA 5LKTA 4YADA 1Z2QA 2RSDA 1WENA 2MNYA 5G04B 2ECWA 3L1XA 2VPEA 5TDRA 4A4BA 4ZDTA 2KWNA 4B7YC 4NN2A 2YUCA 4WZ0A 5C11A 2G6QA 4BHWA 1WESA 1DVPA 1X4IA 4GNEA 3ZPV1 3ZPVE 4IC3A 3O70A 1WEMA 2ECIA 5G0FA 2JMDA 3HCTA 4YBTA 4PTBA 3M99A 3ZVZB 4L58A 2VPDA 3U5PA 1WEUA 3ZNIA 2QICA 3N9PA 2PUYA 4TKPB 5JG6A 2G45A 3KV6A 2YU4A 4LJNA 2LGVA 3I2DA 3LRQA 5H1VA 4GNDA 2Y43A 2HDPA 5I3LA 2MIQA 1VFYA 2YW8A 4R8PK 1VYXA 2MUMA 4GNGA 2KYUA 3O36A 2YYRA 2MA5A 2K17A 1JM7A 5TRBA 4N4FA 3RTRB 4Q6FA 1G25A 1JM7B 2MA6A 2AN6A 5H1UA 1LDJB 1BORA 3V43A 3U5OA 2ECTA 1WE9A 2EGPA 4L7XA 4BBQA 2L5UA 3HCUA 2LXPC 3N9MA 1XWHA 3O7AA 5B76A 1VD4A 3SHBA 1WEQA 2YQMA 2KWKA 2VP7A 4S3OB 4GB0A 1HYJA 1E4UA 3FL2A 2KREA 4YBMA 4ZQLA 1WFKA 2Y1MA 4R2YA 1WEVA 4R7EA 3NG2A 3U5MA 2YHOA 4LK9A 2K16A 4N3WA 2BAYA 4I7CA 2OXQC 2L80A 2LRIC 4V3LC 4UI9B 2QIZA 5AIUA 1WEOA 3DPLR 5TABA 4FO9A 1HYIA 5EYAF 3GL6A 1MM2A 5H1TA 3N9QA 2NAAA 3ZYQA 2CSYA 5TDWA 2YHNA 1ZBDB 4LLBA 1FBVA 2LV9A 2VPBA 3T7LA 2KWOA 4AP4A 1F62A 3DQVR 1K2FA 2LQ6A 2JRJA 5B77A 4MSXA 2YSMA 2ECVA 2LDRA 2CT2A 2KU3A 2XEUA 2VNFA 3GV4A 4O64A 2C2VS 4CA1A 3HCSA 2QJ0A 3LQJA 2KGGA 5DKAA 4AYCB 4C9ZA 2FUIA 2VJEB 5FERA 4S3OC 1Z6UA 4WA6A 2VPGA 2LGGA 3O34A 5B75A 2F6JA 3KNVA 2LXHC 2YURA 4W4UA 3QZVA 3M62A 1N87A 2E6RA 1Z60A 4I7BA 2FSAA 2M1RA 3EB6A 4F52B 2KGIA 3EB5A 5D1LB 4AUQB 1RMDA 2ECNA 3ZTGA 4A4CA 2JMJA 4I7DA 4YATA 4ZUXU 4YABA 4IC2A 1U6GB 5AITA 3LQIA 3MHSA 5D1MB 3IHPA 2UZGA 2KE1A 1WIMA 4QF2A 4WZ2A 2MD8C
chains in the Genus database with same CATH superfamily
3C5KA 2MNZA 4Z0RA 2KFTA 1MBMA 2JMIA 2YSJA 2Y1NA 2H0DA 4AVXA 4V3KC 3PURA 2CKLB 2CONA 2M6MA 3N9OA 3ZVYA 2H0DB 1X4UA 2HYED 1FP0A 2PNXA 3N9NA 3KV5A 3T9KA 2L75A 2K1JA 3RPGB 2K4DA 3VK6A 5B79A 5FEYA 2ECJA 2E6SA 5KH7A 2CRRA 4MVTA 1T1HA 4LADB 2I50A 4GNFA 4XI1A 4YBSA 2ZETC 5C13A 2L0BA 5FB1A 4YC9A 4UP0A 5H9MA 5DINA 4B86C 3LJUX 4P5OB 2LN0A 1JOCA 3N9LA 2XB1A 3ASLA 2YQLA 4LKAA 5LKXA 3T6RA 5FB0A 2CSZA 2G43A 4AYCA 2EXUA 2MT5A 2VJEA 1IYMA 5LKZA 1V87A 2ECGA 2D8SA 4QQ4A 3LQHA 2VJFA 2KKYA 4WZ3B 3U5NA 2LGLA 4UP5A 5LKUA 2VJFB 2FUUA 2RI7A 2YVRA 1MM3A 2KWJA 2EODA 2EA6A 1X4JA 3KQIA 3O35A 3L11A 2YT5A 4PPEA 3FEHA 5G05B 4X3GA 3LDYA 4FK5A 5D1KB 4FIPA 4QF3A 2IDAA 3SUBA 4A0CD 3SOXA 2KKXA 3PHDA 4A49A 5B78A 1WILA 4O62A 2C2LA 2RR4A 3C6WA 1WEPA 4CCGX 5J3XA 3SOWA 2KIZA 1CHCA 2F6NA 5KH9A 3RPGC 2MD7B 3SOUA 2KR4A 2DX8A 3FM8C 3KDEC 3L1ZB 2F42A 5KH3A 5SVXA 1WEEA 1WEWA 3PUQA 3HTKC 4F1PA 2YREA 2M85A 2LGKA 5LCWB 4FJCA 3MHHA 2L43A 2M3HA 3M63A 1WGMA 5B8DA 1LDKC 3O33A 2CKLA 4YAXA 4OGEA 3O37A 5TBNA 5LKTA 4YADA 1Z2QA 2RSDA 1WENA 2MNYA 5G04B 2ECWA 3L1XA 2VPEA 5TDRA 4A4BA 4ZDTA 2KWNA 4B7YC 4NN2A 2YUCA 4OGCA 4WZ0A 2G6QA 5C11A 3H7HA 5K3QA 4BHWA 1WESA 1DVPA 3M7KA 1X4IA 2JM3A 2L7PA 4H9DA 4GNEA 3ZPV1 3ZPVE 4IC3A 5SVIB 3O70A 1WEMA 2ECIA 5G0FA 2JMDA 3HCTA 4YBTA 4PTBA 3M99A 3ZVZB 4L58A 2VPDA 3U5PA 1WEUA 3ZNIA 2QICA 3N9PA 2PUYA 3E2DA 3LVQE 2IQJA 4TKPB 5JG6A 2G45A 3KV6A 2YU4A 4LJNA 2LGVA 3I2DA 3LRQA 5H1VA 4GNDA 2Y43A 2HDPA 5I3LA 2MIQA 1VFYA 2YW8A 4R8PK 1VYXA 2MUMA 4GNGA 2KYUA 3O36A 2YYRA 2MA5A 2K17A 1JM7A 3FAOA 5TRBA 4N4FA 3RTRB 4Q6FA 1G25A 1JM7B 2MA6A 2AN6A 5H1UA 1LDJB 1BORA 3V43A 3U5OA 2ECTA 1WE9A 5SVYA 2EGPA 4L7XA 4BBQA 2L5UA 3HCUA 2LXPC 3N9MA 2LAUA 1XWHA 3O7AA 5B76A 1VD4A 2XOCA 3SHBA 1WEQA 2YQMA 2KWKA 2VP7A 4S3OB 4GB0A 1HYJA 1E4UA 2D8UA 2FD4A 3FL2A 2KREA 2OWAA 4YBMA 4ZQLA 1WFKA 2Y1MA 4R2YA 2XOZA 1WEVA 4R7EA 3NG2A 2YHOA 4LK9A 3U5MA 2K16A 4N3WA 2BAYA 4I7CA 3DWDA 3PLWA 2OXQC 3FJUB 3O47A 2L80A 2LRIC 4V3LC 4UI9B 2EGMA 4Z0OA 2QIZA 5AIUA 1WEOA 3DPLR 5SVIA 5TABA 4FO9A 1HYIA 3Q1DA 5EYAF 2XP0A 2XOYA 3GL6A 1MM2A 5H1TA 3N9QA 2NAAA 3ZYQA 2CSYA 5TDWA 2YHNA 2DSMA 1ZBDB 4LLBA 1FBVA 2LV9A 2VPBA 3T7LA 2KWOA 4AP4A 1DCQA 1F62A 3DQVR 1K2FA 2LQ6A 2JRJA 5B77A 4MSXA 2YSMA 2ECVA 2LDRA 2CT2A 2KU3A 2XEUA 2VNFA 3GV4A 4O64A 2C2VS 4CA1A 2DJAA 2JUNA 3HCSA 2QJ0A 3MDBC 3LQJA 2KGGA 5DKAA 4AYCB 4C9ZA 2FUIA 2VJEB 2E61A 2FFWA 5FERA 4S3OC 3FANA 1Z6UA 4WA6A 2VPGA 3JUEA 2LGGA 3O34A 5B75A 2F6JA 3KNVA 2LXHC 2YURA 4W4UA 3QZVA 3M62A 1N87A 2E6RA 2M13A 1Z60A 4I7BA 2FSAA 2M1RA 3EB6A 4F52B 3LVRE 2KGIA 3EB5A 5D1LB 4AUQB 1RMDA 2ECNA 3ZTGA 2B0OE 4A4CA 2JMJA 3DDTA 4I7DA 2CSVA 4YATA 4ZUXU 4YABA 2CRWA 2MKEA 4IC2A 1U6GB 5AITA 3LQIA 3MHSA 2P57A 5D1MB 3IHPA 2UZGA 2KE1A 1WIMA 4QF2A 4WZ2A 2MD8C
chains in the Genus database with same CATH topology
3C5KA 2MNZA 2KFTA 2JMIA 2YSJA 2Y1NA 2H0DA 4AVXA 4V3KC 3PURA 2CKLB 2M6MA 3N9OA 3ZVYA 2H0DB 1X4UA 2HYED 1FP0A 2PNXA 3N9NA 3KV5A 2L75A 2K1JA 3RPGB 2K4DA 3VK6A 5B79A 5FEYA 2ECJA 2E6SA 5KH7A 4MVTA 1T1HA 4LADB 2I50A 4GNFA 4XI1A 4YBSA 2ZETC 5C13A 2L0BA 5FB1A 4YC9A 4UP0A 5H9MA 5DINA 4B86C 4P5OB 2LN0A 1JOCA 3N9LA 2XB1A 3ASLA 2YQLA 4LKAA 5LKXA 3T6RA 5FB0A 2CSZA 2G43A 4AYCA 2MT5A 2VJEA 1IYMA 5LKZA 1V87A 2ECGA 2D8SA 3LQHA 2VJFA 4WZ3B 3U5NA 2LGLA 4UP5A 5LKUA 2VJFB 2FUUA 2RI7A 1MM3A 2KWJA 2EODA 2EA6A 1X4JA 3KQIA 3O35A 3L11A 2YT5A 4PPEA 5G05B 4X3GA 4FK5A 5D1KB 4FIPA 4QF3A 2IDAA 4A0CD 3SOXA 3PHDA 4A49A 5B78A 1WILA 2C2LA 3C6WA 1WEPA 4CCGX 5J3XA 3SOWA 2KIZA 1CHCA 2F6NA 5KH9A 3RPGC 2MD7B 3SOUA 2KR4A 2DX8A 3L1ZB 2F42A 5KH3A 1WEEA 1WEWA 3PUQA 3HTKC 2YREA 2M85A 2LGKA 5LCWB 4FJCA 3MHHA 2L43A 2M3HA 3M63A 1WGMA 5B8DA 1LDKC 3O33A 2CKLA 4YAXA 3O37A 5TBNA 5LKTA 4YADA 1Z2QA 2RSDA 1WENA 2MNYA 5G04B 2ECWA 3L1XA 2VPEA 5TDRA 4A4BA 4ZDTA 2KWNA 4B7YC 4NN2A 2YUCA 4WZ0A 5C11A 2G6QA 4BHWA 1WESA 1DVPA 1X4IA 4GNEA 3ZPV1 3ZPVE 4IC3A 3O70A 1WEMA 2ECIA 5G0FA 2JMDA 3HCTA 4YBTA 4PTBA 3M99A 3ZVZB 4L58A 2VPDA 3U5PA 1WEUA 3ZNIA 2QICA 3N9PA 2PUYA 4TKPB 5JG6A 2G45A 3KV6A 2YU4A 4LJNA 2LGVA 3I2DA 3LRQA 5H1VA 4GNDA 2Y43A 2HDPA 5I3LA 2MIQA 1VFYA 2YW8A 4R8PK 1VYXA 2MUMA 4GNGA 2KYUA 3O36A 2YYRA 2MA5A 2K17A 1JM7A 5TRBA 4N4FA 3RTRB 4Q6FA 1G25A 1JM7B 2MA6A 2AN6A 5H1UA 1LDJB 1BORA 3V43A 3U5OA 2ECTA 1WE9A 2EGPA 4L7XA 4BBQA 2L5UA 3HCUA 2LXPC 3N9MA 1XWHA 3O7AA 5B76A 1VD4A 3SHBA 1WEQA 2YQMA 2KWKA 2VP7A 4S3OB 4GB0A 1HYJA 1E4UA 3FL2A 2KREA 4YBMA 4ZQLA 1WFKA 2Y1MA 4R2YA 1WEVA 4R7EA 3NG2A 3U5MA 2YHOA 4LK9A 2K16A 4N3WA 2BAYA 4I7CA 2OXQC 2L80A 2LRIC 4V3LC 4UI9B 2QIZA 5AIUA 1WEOA 3DPLR 5TABA 4FO9A 1HYIA 5EYAF 3GL6A 1MM2A 5H1TA 3N9QA 2NAAA 3ZYQA 2CSYA 5TDWA 2YHNA 1ZBDB 4LLBA 1FBVA 2LV9A 2VPBA 3T7LA 2KWOA 4AP4A 1F62A 3DQVR 1K2FA 2LQ6A 2JRJA 5B77A 4MSXA 2YSMA 2ECVA 2LDRA 2CT2A 2KU3A 2XEUA 2VNFA 3GV4A 4O64A 2C2VS 4CA1A 3HCSA 2QJ0A 3LQJA 2KGGA 5DKAA 4AYCB 4C9ZA 2FUIA 2VJEB 5FERA 4S3OC 1Z6UA 4WA6A 2VPGA 2LGGA 3O34A 5B75A 2F6JA 3KNVA 2LXHC 2YURA 4W4UA 3QZVA 3M62A 1N87A 2E6RA 1Z60A 4I7BA 2FSAA 2M1RA 3EB6A 4F52B 2KGIA 3EB5A 5D1LB 4AUQB 1RMDA 2ECNA 3ZTGA 4A4CA 2JMJA 4I7DA 4YATA 4ZUXU 4YABA 4IC2A 1U6GB 5AITA 3LQIA 3MHSA 5D1MB 3IHPA 2UZGA 2KE1A 1WIMA 4QF2A 4WZ2A 2MD8C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C5K A;  2MNZ A;  2KFT A;  2JMI A;  2YSJ A;  2Y1N A;  2H0D A;  4AVX A;  4V3K C;  3PUR A;  2CKL B;  2M6M A;  3N9O A;  3ZVY A;  2H0D B;  1X4U A;  2HYE D;  1FP0 A;  2PNX A;  3N9N A;  3KV5 A;  2L75 A;  2K1J A;  3RPG B;  2K4D A;  3VK6 A;  5B79 A;  5FEY A;  2ECJ A;  2E6S A;  5KH7 A;  4MVT A;  1T1H A;  4LAD B;  2I50 A;  4GNF A;  4XI1 A;  4YBS A;  2ZET C;  5C13 A;  2L0B A;  5FB1 A;  4YC9 A;  4UP0 A;  5H9M A;  5DIN A;  4B86 C;  4P5O B;  2LN0 A;  1JOC A;  3N9L A;  2XB1 A;  3ASL A;  2YQL A;  4LKA A;  5LKX A;  3T6R A;  5FB0 A;  2CSZ A;  2G43 A;  4AYC A;  2MT5 A;  2VJE A;  1IYM A;  5LKZ A;  1V87 A;  2ECG A;  2D8S A;  3LQH A;  2VJF A;  4WZ3 B;  3U5N A;  2LGL A;  4UP5 A;  5LKU A;  2VJF B;  2FUU A;  2RI7 A;  1MM3 A;  2KWJ A;  2EOD A;  2EA6 A;  1X4J A;  3KQI A;  3O35 A;  3L11 A;  2YT5 A;  4PPE A;  5G05 B;  4X3G A;  4FK5 A;  5D1K B;  4FIP A;  4QF3 A;  2IDA A;  4A0C D;  3SOX A;  3PHD A;  4A49 A;  5B78 A;  1WIL A;  2C2L A;  3C6W A;  1WEP A;  4CCG X;  5J3X A;  3SOW A;  2KIZ A;  1CHC A;  2F6N A;  5KH9 A;  3RPG C;  2MD7 B;  3SOU A;  2KR4 A;  2DX8 A;  3L1Z B;  2F42 A;  5KH3 A;  1WEE A;  1WEW A;  3PUQ A;  3HTK C;  2YRE A;  2M85 A;  2LGK A;  5LCW B;  4FJC A;  3MHH A;  2L43 A;  2M3H A;  3M63 A;  1WGM A;  5B8D A;  1LDK C;  3O33 A;  2CKL A;  4YAX A;  3O37 A;  5TBN A;  5LKT A;  4YAD A;  1Z2Q A;  2RSD A;  1WEN A;  2MNY A;  5G04 B;  2ECW A;  3L1X A;  2VPE A;  5TDR A;  4A4B A;  4ZDT A;  2KWN A;  4B7Y C;  4NN2 A;  2YUC A;  4WZ0 A;  5C11 A;  2G6Q A;  4BHW A;  1WES A;  1DVP A;  1X4I A;  4GNE A;  3ZPV 1;  3ZPV E;  4IC3 A;  3O70 A;  1WEM A;  2ECI A;  5G0F A;  2JMD A;  3HCT A;  4YBT A;  4PTB A;  3M99 A;  3ZVZ B;  4L58 A;  2VPD A;  3U5P A;  1WEU A;  3ZNI A;  2QIC A;  3N9P A;  2PUY A;  4TKP B;  5JG6 A;  2G45 A;  3KV6 A;  2YU4 A;  4LJN A;  2LGV A;  3I2D A;  3LRQ A;  5H1V A;  4GND A;  2Y43 A;  2HDP A;  5I3L A;  2MIQ A;  1VFY A;  2YW8 A;  4R8P K;  1VYX A;  2MUM A;  4GNG A;  2KYU A;  3O36 A;  2YYR A;  2MA5 A;  2K17 A;  1JM7 A;  5TRB A;  4N4F A;  3RTR B;  4Q6F A;  1G25 A;  1JM7 B;  2MA6 A;  2AN6 A;  5H1U A;  1LDJ B;  1BOR A;  3V43 A;  3U5O A;  2ECT A;  1WE9 A;  2EGP A;  4L7X A;  4BBQ A;  2L5U A;  3HCU A;  2LXP C;  3N9M A;  1XWH A;  3O7A A;  5B76 A;  1VD4 A;  3SHB A;  1WEQ A;  2YQM A;  2KWK A;  2VP7 A;  4S3O B;  4GB0 A;  1HYJ A;  1E4U A;  3FL2 A;  2KRE A;  4YBM A;  4ZQL A;  1WFK A;  2Y1M A;  4R2Y A;  1WEV A;  4R7E A;  3NG2 A;  3U5M A;  2YHO A;  4LK9 A;  2K16 A;  4N3W A;  2BAY A;  4I7C A;  2OXQ C;  2L80 A;  2LRI C;  4V3L C;  4UI9 B;  2QIZ A;  5AIU A;  1WEO A;  3DPL R;  5TAB A;  4FO9 A;  1HYI A;  5EYA F;  3GL6 A;  1MM2 A;  5H1T A;  3N9Q A;  2NAA A;  3ZYQ A;  2CSY A;  5TDW A;  2YHN A;  1ZBD B;  4LLB A;  1FBV A;  2LV9 A;  2VPB A;  3T7L A;  2KWO A;  4AP4 A;  1F62 A;  3DQV R;  1K2F A;  2LQ6 A;  2JRJ A;  5B77 A;  4MSX A;  2YSM A;  2ECV A;  2LDR A;  2CT2 A;  2KU3 A;  2XEU A;  2VNF A;  3GV4 A;  4O64 A;  2C2V S;  4CA1 A;  3HCS A;  2QJ0 A;  3LQJ A;  2KGG A;  5DKA A;  4AYC B;  4C9Z A;  2FUI A;  2VJE B;  5FER A;  4S3O C;  1Z6U A;  4WA6 A;  2VPG A;  2LGG A;  3O34 A;  5B75 A;  2F6J A;  3KNV A;  2LXH C;  2YUR A;  4W4U A;  3QZV A;  3M62 A;  1N87 A;  2E6R A;  1Z60 A;  4I7B A;  2FSA A;  2M1R A;  3EB6 A;  4F52 B;  2KGI A;  3EB5 A;  5D1L B;  4AUQ B;  1RMD A;  2ECN A;  3ZTG A;  4A4C A;  2JMJ A;  4I7D A;  4YAT A;  4ZUX U;  4YAB A;  4IC2 A;  1U6G B;  5AIT A;  3LQI A;  3MHS A;  5D1M B;  3IHP A;  2UZG A;  2KE1 A;  1WIM A;  4QF2 A;  4WZ2 A;  2MD8 C; 
#chains in the Genus database with same CATH topology
 3C5K A;  2MNZ A;  4Z0R A;  2KFT A;  1MBM A;  2JMI A;  2YSJ A;  2Y1N A;  2H0D A;  4AVX A;  4V3K C;  3PUR A;  2CKL B;  2CON A;  2M6M A;  3N9O A;  3ZVY A;  2H0D B;  1X4U A;  2HYE D;  1FP0 A;  2PNX A;  3N9N A;  3KV5 A;  3T9K A;  2L75 A;  2K1J A;  3RPG B;  2K4D A;  3VK6 A;  5B79 A;  5FEY A;  2ECJ A;  2E6S A;  5KH7 A;  2CRR A;  4MVT A;  1T1H A;  4LAD B;  2I50 A;  4GNF A;  4XI1 A;  4YBS A;  2ZET C;  5C13 A;  2L0B A;  5FB1 A;  4YC9 A;  4UP0 A;  5H9M A;  5DIN A;  4B86 C;  3LJU X;  4P5O B;  2LN0 A;  1JOC A;  3N9L A;  2XB1 A;  3ASL A;  2YQL A;  4LKA A;  5LKX A;  3T6R A;  5FB0 A;  2CSZ A;  2G43 A;  4AYC A;  2EXU A;  2MT5 A;  2VJE A;  1IYM A;  5LKZ A;  1V87 A;  2ECG A;  2D8S A;  4QQ4 A;  3LQH A;  2VJF A;  2KKY A;  4WZ3 B;  3U5N A;  2LGL A;  4UP5 A;  5LKU A;  2VJF B;  2FUU A;  2RI7 A;  2YVR A;  1MM3 A;  2KWJ A;  2EOD A;  2EA6 A;  1X4J A;  3KQI A;  3O35 A;  3L11 A;  2YT5 A;  4PPE A;  3FEH A;  5G05 B;  4X3G A;  3LDY A;  4FK5 A;  5D1K B;  4FIP A;  4QF3 A;  2IDA A;  3SUB A;  4A0C D;  3SOX A;  2KKX A;  3PHD A;  4A49 A;  5B78 A;  1WIL A;  4O62 A;  2C2L A;  2RR4 A;  3C6W A;  1WEP A;  4CCG X;  5J3X A;  3SOW A;  2KIZ A;  1CHC A;  2F6N A;  5KH9 A;  3RPG C;  2MD7 B;  3SOU A;  2KR4 A;  2DX8 A;  3FM8 C;  3KDE C;  3L1Z B;  2F42 A;  5KH3 A;  5SVX A;  1WEE A;  1WEW A;  3PUQ A;  3HTK C;  4F1P A;  2YRE A;  2M85 A;  2LGK A;  5LCW B;  4FJC A;  3MHH A;  2L43 A;  2M3H A;  3M63 A;  1WGM A;  5B8D A;  1LDK C;  3O33 A;  2CKL A;  4YAX A;  4OGE A;  3O37 A;  5TBN A;  5LKT A;  4YAD A;  1Z2Q A;  2RSD A;  1WEN A;  2MNY A;  5G04 B;  2ECW A;  3L1X A;  2VPE A;  5TDR A;  4A4B A;  4ZDT A;  2KWN A;  4B7Y C;  4NN2 A;  2YUC A;  4OGC A;  4WZ0 A;  2G6Q A;  5C11 A;  3H7H A;  5K3Q A;  4BHW A;  1WES A;  1DVP A;  3M7K A;  1X4I A;  2JM3 A;  2L7P A;  4H9D A;  4GNE A;  3ZPV 1;  3ZPV E;  4IC3 A;  5SVI B;  3O70 A;  1WEM A;  2ECI A;  5G0F A;  2JMD A;  3HCT A;  4YBT A;  4PTB A;  3M99 A;  3ZVZ B;  4L58 A;  2VPD A;  3U5P A;  1WEU A;  3ZNI A;  2QIC A;  3N9P A;  2PUY A;  3E2D A;  3LVQ E;  2IQJ A;  4TKP B;  5JG6 A;  2G45 A;  3KV6 A;  2YU4 A;  4LJN A;  2LGV A;  3I2D A;  3LRQ A;  5H1V A;  4GND A;  2Y43 A;  2HDP A;  5I3L A;  2MIQ A;  1VFY A;  2YW8 A;  4R8P K;  1VYX A;  2MUM A;  4GNG A;  2KYU A;  3O36 A;  2YYR A;  2MA5 A;  2K17 A;  1JM7 A;  3FAO A;  5TRB A;  4N4F A;  3RTR B;  4Q6F A;  1G25 A;  1JM7 B;  2MA6 A;  2AN6 A;  5H1U A;  1LDJ B;  1BOR A;  3V43 A;  3U5O A;  2ECT A;  1WE9 A;  5SVY A;  2EGP A;  4L7X A;  4BBQ A;  2L5U A;  3HCU A;  2LXP C;  3N9M A;  2LAU A;  1XWH A;  3O7A A;  5B76 A;  1VD4 A;  2XOC A;  3SHB A;  1WEQ A;  2YQM A;  2KWK A;  2VP7 A;  4S3O B;  4GB0 A;  1HYJ A;  1E4U A;  2D8U A;  2FD4 A;  3FL2 A;  2KRE A;  2OWA A;  4YBM A;  4ZQL A;  1WFK A;  2Y1M A;  4R2Y A;  2XOZ A;  1WEV A;  4R7E A;  3NG2 A;  2YHO A;  4LK9 A;  3U5M A;  2K16 A;  4N3W A;  2BAY A;  4I7C A;  3DWD A;  3PLW A;  2OXQ C;  3FJU B;  3O47 A;  2L80 A;  2LRI C;  4V3L C;  4UI9 B;  2EGM A;  4Z0O A;  2QIZ A;  5AIU A;  1WEO A;  3DPL R;  5SVI A;  5TAB A;  4FO9 A;  1HYI A;  3Q1D A;  5EYA F;  2XP0 A;  2XOY A;  3GL6 A;  1MM2 A;  5H1T A;  3N9Q A;  2NAA A;  3ZYQ A;  2CSY A;  5TDW A;  2YHN A;  2DSM A;  1ZBD B;  4LLB A;  1FBV A;  2LV9 A;  2VPB A;  3T7L A;  2KWO A;  4AP4 A;  1DCQ A;  1F62 A;  3DQV R;  1K2F A;  2LQ6 A;  2JRJ A;  5B77 A;  4MSX A;  2YSM A;  2ECV A;  2LDR A;  2CT2 A;  2KU3 A;  2XEU A;  2VNF A;  3GV4 A;  4O64 A;  2C2V S;  4CA1 A;  2DJA A;  2JUN A;  3HCS A;  2QJ0 A;  3MDB C;  3LQJ A;  2KGG A;  5DKA A;  4AYC B;  4C9Z A;  2FUI A;  2VJE B;  2E61 A;  2FFW A;  5FER A;  4S3O C;  3FAN A;  1Z6U A;  4WA6 A;  2VPG A;  3JUE A;  2LGG A;  3O34 A;  5B75 A;  2F6J A;  3KNV A;  2LXH C;  2YUR A;  4W4U A;  3QZV A;  3M62 A;  1N87 A;  2E6R A;  2M13 A;  1Z60 A;  4I7B A;  2FSA A;  2M1R A;  3EB6 A;  4F52 B;  3LVR E;  2KGI A;  3EB5 A;  5D1L B;  4AUQ B;  1RMD A;  2ECN A;  3ZTG A;  2B0O E;  4A4C A;  2JMJ A;  3DDT A;  4I7D A;  2CSV A;  4YAT A;  4ZUX U;  4YAB A;  2CRW A;  2MKE A;  4IC2 A;  1U6G B;  5AIT A;  3LQI A;  3MHS A;  2P57 A;  5D1M B;  3IHP A;  2UZG A;  2KE1 A;  1WIM A;  4QF2 A;  4WZ2 A;  2MD8 C; 
#chains in the Genus database with same CATH homology
 3C5K A;  2MNZ A;  2KFT A;  2JMI A;  2YSJ A;  2Y1N A;  2H0D A;  4AVX A;  4V3K C;  3PUR A;  2CKL B;  2M6M A;  3N9O A;  3ZVY A;  2H0D B;  1X4U A;  2HYE D;  1FP0 A;  2PNX A;  3N9N A;  3KV5 A;  2L75 A;  2K1J A;  3RPG B;  2K4D A;  3VK6 A;  5B79 A;  5FEY A;  2ECJ A;  2E6S A;  5KH7 A;  4MVT A;  1T1H A;  4LAD B;  2I50 A;  4GNF A;  4XI1 A;  4YBS A;  2ZET C;  5C13 A;  2L0B A;  5FB1 A;  4YC9 A;  4UP0 A;  5H9M A;  5DIN A;  4B86 C;  4P5O B;  2LN0 A;  1JOC A;  3N9L A;  2XB1 A;  3ASL A;  2YQL A;  4LKA A;  5LKX A;  3T6R A;  5FB0 A;  2CSZ A;  2G43 A;  4AYC A;  2MT5 A;  2VJE A;  1IYM A;  5LKZ A;  1V87 A;  2ECG A;  2D8S A;  3LQH A;  2VJF A;  4WZ3 B;  3U5N A;  2LGL A;  4UP5 A;  5LKU A;  2VJF B;  2FUU A;  2RI7 A;  1MM3 A;  2KWJ A;  2EOD A;  2EA6 A;  1X4J A;  3KQI A;  3O35 A;  3L11 A;  2YT5 A;  4PPE A;  5G05 B;  4X3G A;  4FK5 A;  5D1K B;  4FIP A;  4QF3 A;  2IDA A;  4A0C D;  3SOX A;  3PHD A;  4A49 A;  5B78 A;  1WIL A;  2C2L A;  3C6W A;  1WEP A;  4CCG X;  5J3X A;  3SOW A;  2KIZ A;  1CHC A;  2F6N A;  5KH9 A;  3RPG C;  2MD7 B;  3SOU A;  2KR4 A;  2DX8 A;  3L1Z B;  2F42 A;  5KH3 A;  1WEE A;  1WEW A;  3PUQ A;  3HTK C;  2YRE A;  2M85 A;  2LGK A;  5LCW B;  4FJC A;  3MHH A;  2L43 A;  2M3H A;  3M63 A;  1WGM A;  5B8D A;  1LDK C;  3O33 A;  2CKL A;  4YAX A;  3O37 A;  5TBN A;  5LKT A;  4YAD A;  1Z2Q A;  2RSD A;  1WEN A;  2MNY A;  5G04 B;  2ECW A;  3L1X A;  2VPE A;  5TDR A;  4A4B A;  4ZDT A;  2KWN A;  4B7Y C;  4NN2 A;  2YUC A;  4WZ0 A;  5C11 A;  2G6Q A;  4BHW A;  1WES A;  1DVP A;  1X4I A;  4GNE A;  3ZPV 1;  3ZPV E;  4IC3 A;  3O70 A;  1WEM A;  2ECI A;  5G0F A;  2JMD A;  3HCT A;  4YBT A;  4PTB A;  3M99 A;  3ZVZ B;  4L58 A;  2VPD A;  3U5P A;  1WEU A;  3ZNI A;  2QIC A;  3N9P A;  2PUY A;  4TKP B;  5JG6 A;  2G45 A;  3KV6 A;  2YU4 A;  4LJN A;  2LGV A;  3I2D A;  3LRQ A;  5H1V A;  4GND A;  2Y43 A;  2HDP A;  5I3L A;  2MIQ A;  1VFY A;  2YW8 A;  4R8P K;  1VYX A;  2MUM A;  4GNG A;  2KYU A;  3O36 A;  2YYR A;  2MA5 A;  2K17 A;  1JM7 A;  5TRB A;  4N4F A;  3RTR B;  4Q6F A;  1G25 A;  1JM7 B;  2MA6 A;  2AN6 A;  5H1U A;  1LDJ B;  1BOR A;  3V43 A;  3U5O A;  2ECT A;  1WE9 A;  2EGP A;  4L7X A;  4BBQ A;  2L5U A;  3HCU A;  2LXP C;  3N9M A;  1XWH A;  3O7A A;  5B76 A;  1VD4 A;  3SHB A;  1WEQ A;  2YQM A;  2KWK A;  2VP7 A;  4S3O B;  4GB0 A;  1HYJ A;  1E4U A;  3FL2 A;  2KRE A;  4YBM A;  4ZQL A;  1WFK A;  2Y1M A;  4R2Y A;  1WEV A;  4R7E A;  3NG2 A;  3U5M A;  2YHO A;  4LK9 A;  2K16 A;  4N3W A;  2BAY A;  4I7C A;  2OXQ C;  2L80 A;  2LRI C;  4V3L C;  4UI9 B;  2QIZ A;  5AIU A;  1WEO A;  3DPL R;  5TAB A;  4FO9 A;  1HYI A;  5EYA F;  3GL6 A;  1MM2 A;  5H1T A;  3N9Q A;  2NAA A;  3ZYQ A;  2CSY A;  5TDW A;  2YHN A;  1ZBD B;  4LLB A;  1FBV A;  2LV9 A;  2VPB A;  3T7L A;  2KWO A;  4AP4 A;  1F62 A;  3DQV R;  1K2F A;  2LQ6 A;  2JRJ A;  5B77 A;  4MSX A;  2YSM A;  2ECV A;  2LDR A;  2CT2 A;  2KU3 A;  2XEU A;  2VNF A;  3GV4 A;  4O64 A;  2C2V S;  4CA1 A;  3HCS A;  2QJ0 A;  3LQJ A;  2KGG A;  5DKA A;  4AYC B;  4C9Z A;  2FUI A;  2VJE B;  5FER A;  4S3O C;  1Z6U A;  4WA6 A;  2VPG A;  2LGG A;  3O34 A;  5B75 A;  2F6J A;  3KNV A;  2LXH C;  2YUR A;  4W4U A;  3QZV A;  3M62 A;  1N87 A;  2E6R A;  1Z60 A;  4I7B A;  2FSA A;  2M1R A;  3EB6 A;  4F52 B;  2KGI A;  3EB5 A;  5D1L B;  4AUQ B;  1RMD A;  2ECN A;  3ZTG A;  4A4C A;  2JMJ A;  4I7D A;  4YAT A;  4ZUX U;  4YAB A;  4IC2 A;  1U6G B;  5AIT A;  3LQI A;  3MHS A;  5D1M B;  3IHP A;  2UZG A;  2KE1 A;  1WIM A;  4QF2 A;  4WZ2 A;  2MD8 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...