3GV4A

Crystal structure of human hdac6 zinc finger domain and ubiquitin c-terminal peptide rlrgg
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
99
structure length
99
Chain Sequence
PLPWCPHLVAVCPIPAAGLDVTQPCGDCGTIQENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYVHHQALLDVKNIAHQNKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone deacetylase 6
publication title Crystal structure of human HDAC6 zinc finger domain and ubiquitin C-terminal peptide RLRGG
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 31
structure length 99
sequence length 99
ec nomenclature ec 3.5.1.98: Histone deacetylase.
pdb deposition date 2009-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3gv4A00
5H9MA 3RPGC 2CKLA 3L1XA 5B8DA 2MD8C 4MSXA 2KWJA 2XB1A 2KE1A 4I7BA 4AUQB 1LDKC 1WGMA 2RI7A 3N9OA 4YATA 3LRQA 4NN2A 2YYRA 1WEMA 2YHNA 3KNVA 2AN6A 2OXQC 3I2DA 1G25A 3SOXA 4LK9A 1HYJA 4QF2A 2ECGA 2YURA 2YU4A 4V3KC 2NAAA 2MNYA 2YSJA 4FK5A 4R8PK 4WA6A 3ZPVE 3DQVR 2VJFB 3NG2A 2MD7B 4UP0A 2G6QA 3ZNIA 5FB1A 2D8SA 3M63A 3EB5A 2ECIA 2KFTA 5TDRA 4X3GA 3N9QA 3L11A 1N87A 2KIZA 2LGLA 4TKPB 3PHDA 1BORA 2PNXA 4GB0A 4R2YA 4B7YC 4A4BA 3VK6A 1MM2A 4FJCA 4QF3A 2CSYA 2KR4A 1WEOA 4ZQLA 4MVTA 5G05B 4CA1A 4AYCA 4YBTA 3QZVA 1XWHA 2YREA 1ZBDB 2VNFA 2KREA 4WZ2A 2DX8A 1VFYA 1FBVA 4L7XA 2C2VS 2IDAA 3SOUA 1X4JA 3O7AA 4BHWA 3U5OA 1WEPA 3MHHA 3SHBA 5LCWB 2I50A 2L75A 2YQMA 2L5UA 2MUMA 4WZ0A 2M85A 4I7CA 2LGGA 2LXHC 5B78A 5G0FA 3PURA 5LKUA 4N4FA 3O70A 1JM7B 5DINA 1Z6UA 4A0CD 2M1RA 1RMDA 1MM3A 2K16A 4YC9A 2JMJA 5KH9A 2HDPA 1U6GB 3RTRB 2Y43A 3KV5A 2YQLA 1WFKA 2VPEA 3ZVYA 2FSAA 3O34A 2LRIC 3C5KA 3T6RA 1WEUA 1WEWA 4LLBA 2XEUA 4S3OB 1DVPA 5AITA 3ZVZB 5TBNA 4W4UA 3HCSA 2JRJA 1V87A 2L80A 2ECTA 3MHSA 2Y1NA 4L58A 1T1HA 1WEVA 5DKAA 1WIMA 2FUUA 2L43A 4LADB 2CKLB 4YADA 2ECJA 2UZGA 4GNFA 2H0DB 3O33A 3RPGB 4GNDA 2L0BA 4GNEA 4B86C 5EYAF 3KV6A 5G04B 3O36A 1WEEA 2CSZA 3EB6A 2EODA 3U5MA 4IC3A 2MNZA 3LQIA 2QICA 4FO9A 5H1VA 2G45A 1X4IA 5FB0A 4WZ3B 2ZETC 2LGVA 5TABA 5D1MB 2LQ6A 4N3WA 3HCUA 3DPLR 2MA5A 3HCTA 2JMDA 4A4CA 4F52B 2VP7A 4BBQA 5B76A 2YHOA 5H1TA 5LKXA 2ECVA 3LQJA 2VJEB 5J3XA 3M99A 1VD4A 4Q6FA 2KGIA 2ECWA 2K1JA 2KU3A 4UI9B 2FUIA 4YABA 2LDRA 2M3HA 4AYCB 5LKZA 2PUYA 3ASLA 1E4UA 1Z60A 2KWNA 2KGGA 4O64A 1HYIA 5FEYA 1WENA 2Y1MA 3O35A 3N9LA 2MT5A 2VJFA 4P5OB 5AIUA 1F62A 2KYUA 3SOWA 4XI1A 1K2FA 2H0DA 4UP5A 4AVXA 2LGKA 3O37A 2F42A 5KH3A 4FIPA 1LDJB 1VYXA 2RSDA 3ZTGA 4R7EA 2F6NA 1WESA 2HYED 2LV9A 4ZDTA 4LKAA 5B77A 3N9MA 3V43A 2E6SA 4CCGX 5B75A 4ZUXU 5H1UA 2MIQA 4GNGA 1FP0A 2VPBA 5I3LA 3HTKC 3U5NA 2BAYA 4LJNA 1Z2QA 1WILA 2YSMA 3T7LA 3GV4A 2JMIA 5C13A 1WE9A 2KWKA 2LN0A 3N9NA 3U5PA 1CHCA 4AP4A 3M62A 2EA6A 4I7DA 5LKTA 2VJEA 5JG6A 2MA6A 2K17A 5C11A 2ECNA 3KQIA 4YBMA 1WEQA 2C2LA 2F6JA 2G43A 1JM7A 2VPGA 5TRBA 5KH7A 2M6MA 1JOCA 3FL2A 3IHPA 5D1LB 2EGPA 2LXPC 3ZPV1 3GL6A 1IYMA 2QJ0A 5FERA 1X4UA 5B79A 5TDWA 2QIZA 2YT5A 4S3OC 5D1KB 2YUCA 2E6RA 3ZYQA 4PPEA 4YAXA 4PTBA 3N9PA 4A49A 3PUQA 2VPDA 2YW8A 4IC2A 2KWOA 4YBSA 2CT2A 4V3LC 2K4DA 3C6WA 3LQHA 4C9ZA 3L1ZB
chains in the Genus database with same CATH superfamily
2FFWA 5H9MA 3RPGC 2MKEA 2CKLA 3L1XA 5B8DA 2MD8C 4MSXA 2KWJA 2XB1A 2KE1A 4I7BA 4AUQB 1LDKC 1WGMA 2RI7A 3N9OA 4YATA 2XOCA 3LRQA 4NN2A 5SVIB 4OGCA 2YYRA 1WEMA 2YHNA 3KNVA 2AN6A 3DDTA 2OXQC 3I2DA 1G25A 2E61A 3SOXA 4LK9A 1HYJA 4QF2A 2D8UA 2ECGA 2YURA 2YU4A 4V3KC 2NAAA 2MNYA 2YSJA 4FK5A 4R8PK 4WA6A 3ZPVE 3DQVR 2VJFB 3NG2A 2MD7B 4UP0A 2G6QA 3ZNIA 2D8SA 5FB1A 3M63A 3EB5A 3T9KA 2ECIA 2KFTA 5TDRA 4X3GA 3N9QA 3L11A 1N87A 2KIZA 2LGLA 4TKPB 3PHDA 1BORA 2PNXA 3FM8C 4GB0A 4R2YA 4B7YC 4A4BA 3VK6A 1MM2A 4FJCA 4QF3A 3M7KA 2CSYA 2KR4A 1WEOA 4ZQLA 4MVTA 5G05B 3LVQE 4CA1A 4AYCA 4YBTA 4Z0RA 3QZVA 1XWHA 2YREA 1ZBDB 2VNFA 2KREA 4WZ2A 2DX8A 1VFYA 1FBVA 4L7XA 2C2VS 2IDAA 2CRRA 3SOUA 3O47A 1X4JA 3O7AA 4BHWA 3U5OA 1WEPA 3MHHA 3SHBA 5LCWB 2I50A 2L75A 2YQMA 2L5UA 2MUMA 4WZ0A 2KKXA 5SVXA 2M85A 4I7CA 2LGGA 2LXHC 5B78A 5G0FA 3PURA 5LKUA 4N4FA 3O70A 1JM7B 5DINA 1Z6UA 4A0CD 2M1RA 1RMDA 1MM3A 2K16A 3LVRE 4YC9A 2CONA 2JMJA 5KH9A 2HDPA 1U6GB 3RTRB 2Y43A 3KV5A 2YQLA 1WFKA 2VPEA 3H7HA 3ZVYA 2FSAA 3O34A 2LRIC 2DSMA 3C5KA 3DWDA 3T6RA 1WEUA 1WEWA 4LLBA 5SVYA 2DJAA 2XEUA 2LAUA 4S3OB 1DVPA 5AITA 3ZVZB 5TBNA 2IQJA 4W4UA 3KDEC 3HCSA 2JRJA 1V87A 2L80A 2ECTA 3MHSA 2Y1NA 4L58A 1T1HA 1WEVA 5DKAA 1WIMA 2FUUA 2L43A 4LADB 2CKLB 4YADA 2ECJA 2UZGA 4GNFA 2H0DB 3O33A 3RPGB 4GNDA 4H9DA 3PLWA 2L0BA 4GNEA 4B86C 5EYAF 3KV6A 5G04B 2YVRA 3O36A 1WEEA 2CSZA 3EB6A 2EODA 3U5MA 4IC3A 2CSVA 2MNZA 3LQIA 2QICA 4FO9A 5H1VA 2G45A 1X4IA 5FB0A 4WZ3B 2ZETC 3MDBC 2LGVA 5D1MB 5TABA 2LQ6A 4N3WA 3HCUA 2EXUA 3DPLR 2B0OE 2MA5A 3HCTA 2JMDA 2JUNA 2CRWA 4A4CA 4F52B 3FEHA 2VP7A 4BBQA 5B76A 2YHOA 5H1TA 5LKXA 2ECVA 4F1PA 3LQJA 2VJEB 5J3XA 3M99A 1VD4A 4Q6FA 5SVIA 2KGIA 2ECWA 2K1JA 2KU3A 4UI9B 2FUIA 4YABA 2LDRA 2FD4A 2M3HA 4AYCB 5LKZA 2PUYA 3ASLA 1E4UA 1Z60A 2KWNA 2KGGA 4O64A 2EGMA 1HYIA 5FEYA 1WENA 2P57A 2Y1MA 2XOZA 3O35A 4Z0OA 3N9LA 2MT5A 2VJFA 4P5OB 4QQ4A 5AIUA 1F62A 2KYUA 4XI1A 3SOWA 1K2FA 2H0DA 4UP5A 4AVXA 2LGKA 3O37A 2F42A 5KH3A 4FIPA 1LDJB 1VYXA 2RSDA 3ZTGA 4R7EA 2F6NA 1WESA 2HYED 2LV9A 4ZDTA 4LKAA 5B77A 3N9MA 3V43A 2E6SA 4OGEA 4CCGX 5B75A 4ZUXU 5H1UA 2MIQA 4GNGA 1FP0A 2VPBA 5I3LA 3HTKC 3U5NA 2BAYA 4LJNA 1Z2QA 3FAOA 1WILA 4O62A 2YSMA 3T7LA 3GV4A 2JMIA 3JUEA 5C13A 1WE9A 2KWKA 2LN0A 3N9NA 5K3QA 3U5PA 1CHCA 4AP4A 3M62A 2EA6A 4I7DA 5LKTA 2VJEA 2XP0A 5JG6A 2MA6A 3LJUX 2K17A 5C11A 3E2DA 2ECNA 2OWAA 3Q1DA 3KQIA 4YBMA 1WEQA 2C2LA 2F6JA 2G43A 1JM7A 2VPGA 5TRBA 5KH7A 2M6MA 1JOCA 2JM3A 2L7PA 3FL2A 3IHPA 5D1LB 2EGPA 2LXPC 3ZPV1 2M13A 1DCQA 3SUBA 3GL6A 1IYMA 2QJ0A 2XOYA 5FERA 1X4UA 5B79A 5TDWA 1MBMA 2QIZA 2RR4A 2YT5A 2KKYA 4S3OC 5D1KB 2YUCA 2E6RA 3ZYQA 4PPEA 4YAXA 4PTBA 3N9PA 4A49A 3PUQA 2VPDA 2YW8A 4IC2A 3FJUB 2KWOA 4YBSA 2CT2A 4V3LC 2K4DA 3C6WA 3LDYA 3LQHA 4C9ZA 3FANA 3L1ZB
chains in the Genus database with same CATH topology
5H9MA 3RPGC 2CKLA 3L1XA 5B8DA 2MD8C 4MSXA 2KWJA 2XB1A 2KE1A 4I7BA 4AUQB 1LDKC 1WGMA 2RI7A 3N9OA 4YATA 3LRQA 4NN2A 2YYRA 1WEMA 2YHNA 3KNVA 2AN6A 2OXQC 3I2DA 1G25A 3SOXA 4LK9A 1HYJA 4QF2A 2ECGA 2YURA 2YU4A 4V3KC 2NAAA 2MNYA 2YSJA 4FK5A 4R8PK 4WA6A 3ZPVE 3DQVR 2VJFB 3NG2A 2MD7B 4UP0A 2G6QA 3ZNIA 5FB1A 2D8SA 3M63A 3EB5A 2ECIA 2KFTA 5TDRA 4X3GA 3N9QA 3L11A 1N87A 2KIZA 2LGLA 4TKPB 3PHDA 1BORA 2PNXA 4GB0A 4R2YA 4B7YC 4A4BA 3VK6A 1MM2A 4FJCA 4QF3A 2CSYA 2KR4A 1WEOA 4ZQLA 4MVTA 5G05B 4CA1A 4AYCA 4YBTA 3QZVA 1XWHA 2YREA 1ZBDB 2VNFA 2KREA 4WZ2A 2DX8A 1VFYA 1FBVA 4L7XA 2C2VS 2IDAA 3SOUA 1X4JA 3O7AA 4BHWA 3U5OA 1WEPA 3MHHA 3SHBA 5LCWB 2I50A 2L75A 2YQMA 2L5UA 2MUMA 4WZ0A 2M85A 4I7CA 2LGGA 2LXHC 5B78A 5G0FA 3PURA 5LKUA 4N4FA 3O70A 1JM7B 5DINA 1Z6UA 4A0CD 2M1RA 1RMDA 1MM3A 2K16A 4YC9A 2JMJA 5KH9A 2HDPA 1U6GB 3RTRB 2Y43A 3KV5A 2YQLA 1WFKA 2VPEA 3ZVYA 2FSAA 3O34A 2LRIC 3C5KA 3T6RA 1WEUA 1WEWA 4LLBA 2XEUA 4S3OB 1DVPA 5AITA 3ZVZB 5TBNA 4W4UA 3HCSA 2JRJA 1V87A 2L80A 2ECTA 3MHSA 2Y1NA 4L58A 1T1HA 1WEVA 5DKAA 1WIMA 2FUUA 2L43A 4LADB 2CKLB 4YADA 2ECJA 2UZGA 4GNFA 2H0DB 3O33A 3RPGB 4GNDA 2L0BA 4GNEA 4B86C 5EYAF 3KV6A 5G04B 3O36A 1WEEA 2CSZA 3EB6A 2EODA 3U5MA 4IC3A 2MNZA 3LQIA 2QICA 4FO9A 5H1VA 2G45A 1X4IA 5FB0A 4WZ3B 2ZETC 2LGVA 5TABA 5D1MB 2LQ6A 4N3WA 3HCUA 3DPLR 2MA5A 3HCTA 2JMDA 4A4CA 4F52B 2VP7A 4BBQA 5B76A 2YHOA 5H1TA 5LKXA 2ECVA 3LQJA 2VJEB 5J3XA 3M99A 1VD4A 4Q6FA 2KGIA 2ECWA 2K1JA 2KU3A 4UI9B 2FUIA 4YABA 2LDRA 2M3HA 4AYCB 5LKZA 2PUYA 3ASLA 1E4UA 1Z60A 2KWNA 2KGGA 4O64A 1HYIA 5FEYA 1WENA 2Y1MA 3O35A 3N9LA 2MT5A 2VJFA 4P5OB 5AIUA 1F62A 2KYUA 3SOWA 4XI1A 1K2FA 2H0DA 4UP5A 4AVXA 2LGKA 3O37A 2F42A 5KH3A 4FIPA 1LDJB 1VYXA 2RSDA 3ZTGA 4R7EA 2F6NA 1WESA 2HYED 2LV9A 4ZDTA 4LKAA 5B77A 3N9MA 3V43A 2E6SA 4CCGX 5B75A 4ZUXU 5H1UA 2MIQA 4GNGA 1FP0A 2VPBA 5I3LA 3HTKC 3U5NA 2BAYA 4LJNA 1Z2QA 1WILA 2YSMA 3T7LA 3GV4A 2JMIA 5C13A 1WE9A 2KWKA 2LN0A 3N9NA 3U5PA 1CHCA 4AP4A 3M62A 2EA6A 4I7DA 5LKTA 2VJEA 5JG6A 2MA6A 2K17A 5C11A 2ECNA 3KQIA 4YBMA 1WEQA 2C2LA 2F6JA 2G43A 1JM7A 2VPGA 5TRBA 5KH7A 2M6MA 1JOCA 3FL2A 3IHPA 5D1LB 2EGPA 2LXPC 3ZPV1 3GL6A 1IYMA 2QJ0A 5FERA 1X4UA 5B79A 5TDWA 2QIZA 2YT5A 4S3OC 5D1KB 2YUCA 2E6RA 3ZYQA 4PPEA 4YAXA 4PTBA 3N9PA 4A49A 3PUQA 2VPDA 2YW8A 4IC2A 2KWOA 4YBSA 2CT2A 4V3LC 2K4DA 3C6WA 3LQHA 4C9ZA 3L1ZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H9M A;  3RPG C;  2CKL A;  3L1X A;  5B8D A;  2MD8 C;  4MSX A;  2KWJ A;  2XB1 A;  2KE1 A;  4I7B A;  4AUQ B;  1LDK C;  1WGM A;  2RI7 A;  3N9O A;  4YAT A;  3LRQ A;  4NN2 A;  2YYR A;  1WEM A;  2YHN A;  3KNV A;  2AN6 A;  2OXQ C;  3I2D A;  1G25 A;  3SOX A;  4LK9 A;  1HYJ A;  4QF2 A;  2ECG A;  2YUR A;  2YU4 A;  4V3K C;  2NAA A;  2MNY A;  2YSJ A;  4FK5 A;  4R8P K;  4WA6 A;  3ZPV E;  3DQV R;  2VJF B;  3NG2 A;  2MD7 B;  4UP0 A;  2G6Q A;  3ZNI A;  5FB1 A;  2D8S A;  3M63 A;  3EB5 A;  2ECI A;  2KFT A;  5TDR A;  4X3G A;  3N9Q A;  3L11 A;  1N87 A;  2KIZ A;  2LGL A;  4TKP B;  3PHD A;  1BOR A;  2PNX A;  4GB0 A;  4R2Y A;  4B7Y C;  4A4B A;  3VK6 A;  1MM2 A;  4FJC A;  4QF3 A;  2CSY A;  2KR4 A;  1WEO A;  4ZQL A;  4MVT A;  5G05 B;  4CA1 A;  4AYC A;  4YBT A;  3QZV A;  1XWH A;  2YRE A;  1ZBD B;  2VNF A;  2KRE A;  4WZ2 A;  2DX8 A;  1VFY A;  1FBV A;  4L7X A;  2C2V S;  2IDA A;  3SOU A;  1X4J A;  3O7A A;  4BHW A;  3U5O A;  1WEP A;  3MHH A;  3SHB A;  5LCW B;  2I50 A;  2L75 A;  2YQM A;  2L5U A;  2MUM A;  4WZ0 A;  2M85 A;  4I7C A;  2LGG A;  2LXH C;  5B78 A;  5G0F A;  3PUR A;  5LKU A;  4N4F A;  3O70 A;  1JM7 B;  5DIN A;  1Z6U A;  4A0C D;  2M1R A;  1RMD A;  1MM3 A;  2K16 A;  4YC9 A;  2JMJ A;  5KH9 A;  2HDP A;  1U6G B;  3RTR B;  2Y43 A;  3KV5 A;  2YQL A;  1WFK A;  2VPE A;  3ZVY A;  2FSA A;  3O34 A;  2LRI C;  3C5K A;  3T6R A;  1WEU A;  1WEW A;  4LLB A;  2XEU A;  4S3O B;  1DVP A;  5AIT A;  3ZVZ B;  5TBN A;  4W4U A;  3HCS A;  2JRJ A;  1V87 A;  2L80 A;  2ECT A;  3MHS A;  2Y1N A;  4L58 A;  1T1H A;  1WEV A;  5DKA A;  1WIM A;  2FUU A;  2L43 A;  4LAD B;  2CKL B;  4YAD A;  2ECJ A;  2UZG A;  4GNF A;  2H0D B;  3O33 A;  3RPG B;  4GND A;  2L0B A;  4GNE A;  4B86 C;  5EYA F;  3KV6 A;  5G04 B;  3O36 A;  1WEE A;  2CSZ A;  3EB6 A;  2EOD A;  3U5M A;  4IC3 A;  2MNZ A;  3LQI A;  2QIC A;  4FO9 A;  5H1V A;  2G45 A;  1X4I A;  5FB0 A;  4WZ3 B;  2ZET C;  2LGV A;  5TAB A;  5D1M B;  2LQ6 A;  4N3W A;  3HCU A;  3DPL R;  2MA5 A;  3HCT A;  2JMD A;  4A4C A;  4F52 B;  2VP7 A;  4BBQ A;  5B76 A;  2YHO A;  5H1T A;  5LKX A;  2ECV A;  3LQJ A;  2VJE B;  5J3X A;  3M99 A;  1VD4 A;  4Q6F A;  2KGI A;  2ECW A;  2K1J A;  2KU3 A;  4UI9 B;  2FUI A;  4YAB A;  2LDR A;  2M3H A;  4AYC B;  5LKZ A;  2PUY A;  3ASL A;  1E4U A;  1Z60 A;  2KWN A;  2KGG A;  4O64 A;  1HYI A;  5FEY A;  1WEN A;  2Y1M A;  3O35 A;  3N9L A;  2MT5 A;  2VJF A;  4P5O B;  5AIU A;  1F62 A;  2KYU A;  3SOW A;  4XI1 A;  1K2F A;  2H0D A;  4UP5 A;  4AVX A;  2LGK A;  3O37 A;  2F42 A;  5KH3 A;  4FIP A;  1LDJ B;  1VYX A;  2RSD A;  3ZTG A;  4R7E A;  2F6N A;  1WES A;  2HYE D;  2LV9 A;  4ZDT A;  4LKA A;  5B77 A;  3N9M A;  3V43 A;  2E6S A;  4CCG X;  5B75 A;  4ZUX U;  5H1U A;  2MIQ A;  4GNG A;  1FP0 A;  2VPB A;  5I3L A;  3HTK C;  3U5N A;  2BAY A;  4LJN A;  1Z2Q A;  1WIL A;  2YSM A;  3T7L A;  3GV4 A;  2JMI A;  5C13 A;  1WE9 A;  2KWK A;  2LN0 A;  3N9N A;  3U5P A;  1CHC A;  4AP4 A;  3M62 A;  2EA6 A;  4I7D A;  5LKT A;  2VJE A;  5JG6 A;  2MA6 A;  2K17 A;  5C11 A;  2ECN A;  3KQI A;  4YBM A;  1WEQ A;  2C2L A;  2F6J A;  2G43 A;  1JM7 A;  2VPG A;  5TRB A;  5KH7 A;  2M6M A;  1JOC A;  3FL2 A;  3IHP A;  5D1L B;  2EGP A;  2LXP C;  3ZPV 1;  3GL6 A;  1IYM A;  2QJ0 A;  5FER A;  1X4U A;  5B79 A;  5TDW A;  2QIZ A;  2YT5 A;  4S3O C;  5D1K B;  2YUC A;  2E6R A;  3ZYQ A;  4PPE A;  4YAX A;  4PTB A;  3N9P A;  4A49 A;  3PUQ A;  2VPD A;  2YW8 A;  4IC2 A;  2KWO A;  4YBS A;  2CT2 A;  4V3L C;  2K4D A;  3C6W A;  3LQH A;  4C9Z A;  3L1Z B; 
#chains in the Genus database with same CATH topology
 2FFW A;  5H9M A;  3RPG C;  2MKE A;  2CKL A;  3L1X A;  5B8D A;  2MD8 C;  4MSX A;  2KWJ A;  2XB1 A;  2KE1 A;  4I7B A;  4AUQ B;  1LDK C;  1WGM A;  2RI7 A;  3N9O A;  4YAT A;  2XOC A;  3LRQ A;  4NN2 A;  5SVI B;  4OGC A;  2YYR A;  1WEM A;  2YHN A;  3KNV A;  2AN6 A;  3DDT A;  2OXQ C;  3I2D A;  1G25 A;  2E61 A;  3SOX A;  4LK9 A;  1HYJ A;  4QF2 A;  2D8U A;  2ECG A;  2YUR A;  2YU4 A;  4V3K C;  2NAA A;  2MNY A;  2YSJ A;  4FK5 A;  4R8P K;  4WA6 A;  3ZPV E;  3DQV R;  2VJF B;  3NG2 A;  2MD7 B;  4UP0 A;  2G6Q A;  3ZNI A;  2D8S A;  5FB1 A;  3M63 A;  3EB5 A;  3T9K A;  2ECI A;  2KFT A;  5TDR A;  4X3G A;  3N9Q A;  3L11 A;  1N87 A;  2KIZ A;  2LGL A;  4TKP B;  3PHD A;  1BOR A;  2PNX A;  3FM8 C;  4GB0 A;  4R2Y A;  4B7Y C;  4A4B A;  3VK6 A;  1MM2 A;  4FJC A;  4QF3 A;  3M7K A;  2CSY A;  2KR4 A;  1WEO A;  4ZQL A;  4MVT A;  5G05 B;  3LVQ E;  4CA1 A;  4AYC A;  4YBT A;  4Z0R A;  3QZV A;  1XWH A;  2YRE A;  1ZBD B;  2VNF A;  2KRE A;  4WZ2 A;  2DX8 A;  1VFY A;  1FBV A;  4L7X A;  2C2V S;  2IDA A;  2CRR A;  3SOU A;  3O47 A;  1X4J A;  3O7A A;  4BHW A;  3U5O A;  1WEP A;  3MHH A;  3SHB A;  5LCW B;  2I50 A;  2L75 A;  2YQM A;  2L5U A;  2MUM A;  4WZ0 A;  2KKX A;  5SVX A;  2M85 A;  4I7C A;  2LGG A;  2LXH C;  5B78 A;  5G0F A;  3PUR A;  5LKU A;  4N4F A;  3O70 A;  1JM7 B;  5DIN A;  1Z6U A;  4A0C D;  2M1R A;  1RMD A;  1MM3 A;  2K16 A;  3LVR E;  4YC9 A;  2CON A;  2JMJ A;  5KH9 A;  2HDP A;  1U6G B;  3RTR B;  2Y43 A;  3KV5 A;  2YQL A;  1WFK A;  2VPE A;  3H7H A;  3ZVY A;  2FSA A;  3O34 A;  2LRI C;  2DSM A;  3C5K A;  3DWD A;  3T6R A;  1WEU A;  1WEW A;  4LLB A;  5SVY A;  2DJA A;  2XEU A;  2LAU A;  4S3O B;  1DVP A;  5AIT A;  3ZVZ B;  5TBN A;  2IQJ A;  4W4U A;  3KDE C;  3HCS A;  2JRJ A;  1V87 A;  2L80 A;  2ECT A;  3MHS A;  2Y1N A;  4L58 A;  1T1H A;  1WEV A;  5DKA A;  1WIM A;  2FUU A;  2L43 A;  4LAD B;  2CKL B;  4YAD A;  2ECJ A;  2UZG A;  4GNF A;  2H0D B;  3O33 A;  3RPG B;  4GND A;  4H9D A;  3PLW A;  2L0B A;  4GNE A;  4B86 C;  5EYA F;  3KV6 A;  5G04 B;  2YVR A;  3O36 A;  1WEE A;  2CSZ A;  3EB6 A;  2EOD A;  3U5M A;  4IC3 A;  2CSV A;  2MNZ A;  3LQI A;  2QIC A;  4FO9 A;  5H1V A;  2G45 A;  1X4I A;  5FB0 A;  4WZ3 B;  2ZET C;  3MDB C;  2LGV A;  5D1M B;  5TAB A;  2LQ6 A;  4N3W A;  3HCU A;  2EXU A;  3DPL R;  2B0O E;  2MA5 A;  3HCT A;  2JMD A;  2JUN A;  2CRW A;  4A4C A;  4F52 B;  3FEH A;  2VP7 A;  4BBQ A;  5B76 A;  2YHO A;  5H1T A;  5LKX A;  2ECV A;  4F1P A;  3LQJ A;  2VJE B;  5J3X A;  3M99 A;  1VD4 A;  4Q6F A;  5SVI A;  2KGI A;  2ECW A;  2K1J A;  2KU3 A;  4UI9 B;  2FUI A;  4YAB A;  2LDR A;  2FD4 A;  2M3H A;  4AYC B;  5LKZ A;  2PUY A;  3ASL A;  1E4U A;  1Z60 A;  2KWN A;  2KGG A;  4O64 A;  2EGM A;  1HYI A;  5FEY A;  1WEN A;  2P57 A;  2Y1M A;  2XOZ A;  3O35 A;  4Z0O A;  3N9L A;  2MT5 A;  2VJF A;  4P5O B;  4QQ4 A;  5AIU A;  1F62 A;  2KYU A;  4XI1 A;  3SOW A;  1K2F A;  2H0D A;  4UP5 A;  4AVX A;  2LGK A;  3O37 A;  2F42 A;  5KH3 A;  4FIP A;  1LDJ B;  1VYX A;  2RSD A;  3ZTG A;  4R7E A;  2F6N A;  1WES A;  2HYE D;  2LV9 A;  4ZDT A;  4LKA A;  5B77 A;  3N9M A;  3V43 A;  2E6S A;  4OGE A;  4CCG X;  5B75 A;  4ZUX U;  5H1U A;  2MIQ A;  4GNG A;  1FP0 A;  2VPB A;  5I3L A;  3HTK C;  3U5N A;  2BAY A;  4LJN A;  1Z2Q A;  3FAO A;  1WIL A;  4O62 A;  2YSM A;  3T7L A;  3GV4 A;  2JMI A;  3JUE A;  5C13 A;  1WE9 A;  2KWK A;  2LN0 A;  3N9N A;  5K3Q A;  3U5P A;  1CHC A;  4AP4 A;  3M62 A;  2EA6 A;  4I7D A;  5LKT A;  2VJE A;  2XP0 A;  5JG6 A;  2MA6 A;  3LJU X;  2K17 A;  5C11 A;  3E2D A;  2ECN A;  2OWA A;  3Q1D A;  3KQI A;  4YBM A;  1WEQ A;  2C2L A;  2F6J A;  2G43 A;  1JM7 A;  2VPG A;  5TRB A;  5KH7 A;  2M6M A;  1JOC A;  2JM3 A;  2L7P A;  3FL2 A;  3IHP A;  5D1L B;  2EGP A;  2LXP C;  3ZPV 1;  2M13 A;  1DCQ A;  3SUB A;  3GL6 A;  1IYM A;  2QJ0 A;  2XOY A;  5FER A;  1X4U A;  5B79 A;  5TDW A;  1MBM A;  2QIZ A;  2RR4 A;  2YT5 A;  2KKY A;  4S3O C;  5D1K B;  2YUC A;  2E6R A;  3ZYQ A;  4PPE A;  4YAX A;  4PTB A;  3N9P A;  4A49 A;  3PUQ A;  2VPD A;  2YW8 A;  4IC2 A;  3FJU B;  2KWO A;  4YBS A;  2CT2 A;  4V3L C;  2K4D A;  3C6W A;  3LDY A;  3LQH A;  4C9Z A;  3FAN A;  3L1Z B; 
#chains in the Genus database with same CATH homology
 5H9M A;  3RPG C;  2CKL A;  3L1X A;  5B8D A;  2MD8 C;  4MSX A;  2KWJ A;  2XB1 A;  2KE1 A;  4I7B A;  4AUQ B;  1LDK C;  1WGM A;  2RI7 A;  3N9O A;  4YAT A;  3LRQ A;  4NN2 A;  2YYR A;  1WEM A;  2YHN A;  3KNV A;  2AN6 A;  2OXQ C;  3I2D A;  1G25 A;  3SOX A;  4LK9 A;  1HYJ A;  4QF2 A;  2ECG A;  2YUR A;  2YU4 A;  4V3K C;  2NAA A;  2MNY A;  2YSJ A;  4FK5 A;  4R8P K;  4WA6 A;  3ZPV E;  3DQV R;  2VJF B;  3NG2 A;  2MD7 B;  4UP0 A;  2G6Q A;  3ZNI A;  5FB1 A;  2D8S A;  3M63 A;  3EB5 A;  2ECI A;  2KFT A;  5TDR A;  4X3G A;  3N9Q A;  3L11 A;  1N87 A;  2KIZ A;  2LGL A;  4TKP B;  3PHD A;  1BOR A;  2PNX A;  4GB0 A;  4R2Y A;  4B7Y C;  4A4B A;  3VK6 A;  1MM2 A;  4FJC A;  4QF3 A;  2CSY A;  2KR4 A;  1WEO A;  4ZQL A;  4MVT A;  5G05 B;  4CA1 A;  4AYC A;  4YBT A;  3QZV A;  1XWH A;  2YRE A;  1ZBD B;  2VNF A;  2KRE A;  4WZ2 A;  2DX8 A;  1VFY A;  1FBV A;  4L7X A;  2C2V S;  2IDA A;  3SOU A;  1X4J A;  3O7A A;  4BHW A;  3U5O A;  1WEP A;  3MHH A;  3SHB A;  5LCW B;  2I50 A;  2L75 A;  2YQM A;  2L5U A;  2MUM A;  4WZ0 A;  2M85 A;  4I7C A;  2LGG A;  2LXH C;  5B78 A;  5G0F A;  3PUR A;  5LKU A;  4N4F A;  3O70 A;  1JM7 B;  5DIN A;  1Z6U A;  4A0C D;  2M1R A;  1RMD A;  1MM3 A;  2K16 A;  4YC9 A;  2JMJ A;  5KH9 A;  2HDP A;  1U6G B;  3RTR B;  2Y43 A;  3KV5 A;  2YQL A;  1WFK A;  2VPE A;  3ZVY A;  2FSA A;  3O34 A;  2LRI C;  3C5K A;  3T6R A;  1WEU A;  1WEW A;  4LLB A;  2XEU A;  4S3O B;  1DVP A;  5AIT A;  3ZVZ B;  5TBN A;  4W4U A;  3HCS A;  2JRJ A;  1V87 A;  2L80 A;  2ECT A;  3MHS A;  2Y1N A;  4L58 A;  1T1H A;  1WEV A;  5DKA A;  1WIM A;  2FUU A;  2L43 A;  4LAD B;  2CKL B;  4YAD A;  2ECJ A;  2UZG A;  4GNF A;  2H0D B;  3O33 A;  3RPG B;  4GND A;  2L0B A;  4GNE A;  4B86 C;  5EYA F;  3KV6 A;  5G04 B;  3O36 A;  1WEE A;  2CSZ A;  3EB6 A;  2EOD A;  3U5M A;  4IC3 A;  2MNZ A;  3LQI A;  2QIC A;  4FO9 A;  5H1V A;  2G45 A;  1X4I A;  5FB0 A;  4WZ3 B;  2ZET C;  2LGV A;  5TAB A;  5D1M B;  2LQ6 A;  4N3W A;  3HCU A;  3DPL R;  2MA5 A;  3HCT A;  2JMD A;  4A4C A;  4F52 B;  2VP7 A;  4BBQ A;  5B76 A;  2YHO A;  5H1T A;  5LKX A;  2ECV A;  3LQJ A;  2VJE B;  5J3X A;  3M99 A;  1VD4 A;  4Q6F A;  2KGI A;  2ECW A;  2K1J A;  2KU3 A;  4UI9 B;  2FUI A;  4YAB A;  2LDR A;  2M3H A;  4AYC B;  5LKZ A;  2PUY A;  3ASL A;  1E4U A;  1Z60 A;  2KWN A;  2KGG A;  4O64 A;  1HYI A;  5FEY A;  1WEN A;  2Y1M A;  3O35 A;  3N9L A;  2MT5 A;  2VJF A;  4P5O B;  5AIU A;  1F62 A;  2KYU A;  3SOW A;  4XI1 A;  1K2F A;  2H0D A;  4UP5 A;  4AVX A;  2LGK A;  3O37 A;  2F42 A;  5KH3 A;  4FIP A;  1LDJ B;  1VYX A;  2RSD A;  3ZTG A;  4R7E A;  2F6N A;  1WES A;  2HYE D;  2LV9 A;  4ZDT A;  4LKA A;  5B77 A;  3N9M A;  3V43 A;  2E6S A;  4CCG X;  5B75 A;  4ZUX U;  5H1U A;  2MIQ A;  4GNG A;  1FP0 A;  2VPB A;  5I3L A;  3HTK C;  3U5N A;  2BAY A;  4LJN A;  1Z2Q A;  1WIL A;  2YSM A;  3T7L A;  3GV4 A;  2JMI A;  5C13 A;  1WE9 A;  2KWK A;  2LN0 A;  3N9N A;  3U5P A;  1CHC A;  4AP4 A;  3M62 A;  2EA6 A;  4I7D A;  5LKT A;  2VJE A;  5JG6 A;  2MA6 A;  2K17 A;  5C11 A;  2ECN A;  3KQI A;  4YBM A;  1WEQ A;  2C2L A;  2F6J A;  2G43 A;  1JM7 A;  2VPG A;  5TRB A;  5KH7 A;  2M6M A;  1JOC A;  3FL2 A;  3IHP A;  5D1L B;  2EGP A;  2LXP C;  3ZPV 1;  3GL6 A;  1IYM A;  2QJ0 A;  5FER A;  1X4U A;  5B79 A;  5TDW A;  2QIZ A;  2YT5 A;  4S3O C;  5D1K B;  2YUC A;  2E6R A;  3ZYQ A;  4PPE A;  4YAX A;  4PTB A;  3N9P A;  4A49 A;  3PUQ A;  2VPD A;  2YW8 A;  4IC2 A;  2KWO A;  4YBS A;  2CT2 A;  4V3L C;  2K4D A;  3C6W A;  3LQH A;  4C9Z A;  3L1Z B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...