3GV4A

Crystal structure of human hdac6 zinc finger domain and ubiquitin c-terminal peptide rlrgg
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
99
structure length
99
Chain Sequence
b'PLPWCPHLVAVCPIPAAGLDVTQPCGDCGTIQENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYVHHQALLDVKNIAHQNKF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone deacetylase 6
molecule tags Hydrolase
source organism Homo sapiens
publication title Crystal structure of human HDAC6 zinc finger domain and ubiquitin C-terminal peptide RLRGG
rcsb
total genus 31
structure length 99
sequence length 99
ec nomenclature ec 3.5.1.98: Histone deacetylase.
pdb deposition date 2009-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3gv4A00
2FUIA 2YW8A 3U5PA 5LKXA 3T7LA 2M6MA 3C6WA 2ECTA 2PUYA 3ZNIA 3N9MA 2H0DA 4LJNA 3ZYQA 4PTBA 5TBNA 2KWJA 2JMIA 2MA5A 5D1KB 3ZVYA 2ECWA 5B75A 2YHOA 3ZVZB 3KQIA 5KH9A 2YSMA 5LKTA 2KWOA 1VYXA 5LKUA 4I7DA 2VJFA 3N9OA 4TKPB 2KGGA 3LQHA 5KH3A 3C5KA 2CKLB 2YU4A 2VPDA 2LDRA 3M99A 5LCWB 2MIQA 2F6NA 4Q6FA 5B77A 1X4UA 2LGKA 5EYAF 2FSAA 1WEPA 3RPGC 1JM7A 2K16A 4A0CD 4CCGX 2LGLA 4QF3A 4LADB 2RSDA 3ASLA 4S3OB 2YHNA 3MHSA 1U6GB 4A49A 2DX8A 4IC3A 4V3LC 4ZDTA 2EODA 4YATA 2ECNA 4X3GA 2Y1NA 4AP4A 3U5MA 2VJEB 5TABA 5FB0A 1WE9A 3N9PA 5H1VA 2CKLA 1K2FA 2LGVA 4GNDA 1WEUA 2QICA 3PUQA 3L1XA 2LV9A 3HTKC 5D1LB 3U5NA 2MNZA 2C2VS 1XWHA 3PHDA 2KWKA 4GB0A 4YBMA 3N9NA 2VPGA 4UP0A 4N4FA 4L7XA 4IC2A 4O64A 2ECJA 2QJ0A 2L43A 4A4BA 2UZGA 4W4UA 5G0FA 4S3OC 2MT5A 2LQ6A 2YQMA 3ZPV1 2H0DB 4P5OB 3SOUA 1MM2A 2RI7A 4WA6A 2JRJA 3U5OA 2KFTA 1WEVA 5B79A 1V87A 5H1TA 2Y1MA 1WEEA 1Z60A 3IHPA 4NN2A 1WEMA 4UP5A 1G25A 4B86C 2K4DA 2L5UA 4FJCA 4AYCA 4MVTA 4N3WA 3LQJA 3V43A 2ECGA 4YAXA 1FBVA 5I3LA 5G04B 5C13A 1X4IA 1VD4A 2K1JA 4CA1A 1T1HA 3O33A 1F62A 3NG2A 2YREA 3PURA 2G45A 1N87A 2M85A 2LN0A 3KNVA 4A4CA 1ZBDB 5H1UA 2VNFA 2AN6A 2YT5A 3DPLR 3O7AA 2F6JA 2LXHC 2MUMA 2HYED 4R7EA 2LRIC 4FIPA 4MSXA 3T6RA 2QIZA 2ECIA 4PPEA 3M63A 4BHWA 4C9ZA 4XI1A 2LXPC 5KH7A 4BBQA 2JMDA 2LGGA 4QF2A 5B78A 3GV4A 4FO9A 2C2LA 4I7CA 1WESA 2NAAA 2L80A 5D1MB 2YQLA 3KV5A 2KR4A 2CSYA 4R8PK 2D8SA 1LDKC 3LQIA 4GNFA 2FUUA 2YURA 4LLBA 3GL6A 2PNXA 1WIMA 1WEWA 3EB5A 5FEYA 1WILA 2YYRA 5AITA 2HDPA 3QZVA 3ZTGA 4R2YA 2XB1A 2M1RA 3L11A 1JOCA 3RPGB 5TDWA 4GNEA 2Y43A 2MD7B 5H9MA 2VP7A 3L1ZB 5G05B 3VK6A 3RTRB 2BAYA 4AVXA 3O35A 5AIUA 2EGPA 5C11A 5LKZA 5FB1A 3N9QA 4LKAA 2VPEA 1X4JA 2KU3A 4AYCB 4F52B 2CSZA 2YSJA 2XEUA 3O36A 3O37A 1FP0A 2CT2A 3O70A 2EA6A 1HYJA 4FK5A 2VPBA 5J3XA 1MM3A 4GNGA 1HYIA 2M3HA 4WZ0A 4WZ2A 4V3KC 3SHBA 2VJFB 2ZETC 3EB6A 3N9LA 4YBSA 2KGIA 3DQVR 1Z2QA 2ECVA 2E6RA 4YBTA 5TDRA 4YC9A 4ZQLA 4UI9B 4WZ3B 2YUCA 1WEOA 4ZUXU 2KE1A 1DVPA 1CHCA 1WEQA 3LRQA 5FERA 4B7YC 5TRBA 4L58A 5DINA 3I2DA 3O34A 3HCSA 2MNYA 2KIZA 2KYUA 2F42A 5DKAA 2VJEA 4AUQB 2KWNA 2L75A 3M62A 1BORA 2I50A 2E6SA 3FL2A 5JG6A 4YADA 3HCTA 5B76A 3ZPVE 1WGMA 2L0BA 4I7BA 1VFYA 3HCUA 2K17A 2OXQC 2MD8C 1E4UA 2G6QA 4YABA 2IDAA 3SOWA 2KREA 1WFKA 3KV6A 2JMJA 1IYMA 2G43A 1Z6UA 3MHHA 4LK9A 1RMDA 1WENA 1JM7B 5B8DA 2MA6A 3SOXA 1LDJB
chains in the Genus database with same CATH superfamily
2FUIA 3FJUB 2YW8A 3U5PA 5LKXA 3T7LA 3JUEA 2M6MA 3C6WA 2ECTA 2PUYA 3ZNIA 3N9MA 2H0DA 4LJNA 3ZYQA 4PTBA 5TBNA 2KWJA 2JMIA 2MA5A 5D1KB 3ZVYA 2ECWA 5B75A 2YHOA 3ZVZB 3KQIA 5KH9A 2YSMA 5LKTA 2KWOA 1VYXA 5LKUA 3T9KA 2DJAA 4I7DA 2VJFA 3N9OA 4TKPB 2KGGA 3LQHA 5KH3A 3C5KA 2CKLB 2YU4A 2VPDA 2LDRA 2MKEA 3M99A 5LCWB 2MIQA 2F6NA 5SVIB 4Q6FA 5B77A 1X4UA 2LGKA 5EYAF 2FSAA 1WEPA 3RPGC 3O47A 1JM7A 2K16A 4A0CD 4CCGX 2LGLA 4QF3A 4LADB 2RSDA 3ASLA 4OGCA 4S3OB 2YHNA 3LJUX 3MHSA 1U6GB 4A49A 2DX8A 4IC3A 4V3LC 4ZDTA 2EODA 4YATA 2ECNA 4X3GA 2Y1NA 4QQ4A 4AP4A 3U5MA 2VJEB 5TABA 5FB0A 1WE9A 3N9PA 5H1VA 2CKLA 1K2FA 2FD4A 2LGVA 4GNDA 1WEUA 3DWDA 2QICA 2XP0A 2LAUA 3PUQA 2D8UA 2LV9A 3HTKC 3L1XA 5D1LB 3U5NA 2MNZA 2C2VS 1XWHA 3PHDA 2KWKA 2FFWA 4GB0A 4Z0OA 4YBMA 3N9NA 2VPGA 4UP0A 4N4FA 4L7XA 3LVQE 4IC2A 4O64A 2ECJA 2QJ0A 3LVRE 2KKXA 2L43A 4A4BA 2UZGA 4W4UA 5G0FA 4S3OC 2MT5A 2LQ6A 2YQMA 3ZPV1 2DSMA 2H0DB 2P57A 4P5OB 3SOUA 1MM2A 2RI7A 4WA6A 2JRJA 3U5OA 2KFTA 1WEVA 3PLWA 5B79A 1V87A 5H1TA 2Y1MA 1WEEA 1Z60A 3IHPA 4NN2A 1WEMA 4UP5A 1G25A 2M13A 4B86C 2K4DA 2L5UA 4FJCA 3M7KA 4AYCA 5SVXA 3KDEC 4MVTA 2KKYA 4N3WA 3LQJA 3V43A 2ECGA 4YAXA 1FBVA 5I3LA 5G04B 5C13A 1X4IA 1VD4A 2K1JA 4CA1A 1T1HA 3O33A 3FM8C 1F62A 3NG2A 2YREA 2CSVA 3PURA 2G45A 1N87A 2M85A 2LN0A 3FAOA 3KNVA 4A4CA 1ZBDB 5H1UA 2VNFA 3FEHA 3MDBC 2AN6A 2YT5A 3DPLR 3O7AA 2F6JA 2LXHC 2MUMA 2HYED 4R7EA 2LRIC 4FIPA 4MSXA 3T6RA 2QIZA 2ECIA 2CONA 4PPEA 3M63A 4BHWA 4F1PA 4C9ZA 4XI1A 2LXPC 5KH7A 4BBQA 2JMDA 2LGGA 4QF2A 4OGEA 5B78A 3GV4A 4FO9A 2C2LA 4I7CA 1WESA 2NAAA 2L80A 5D1MB 2YQLA 3KV5A 2KR4A 2CSYA 4R8PK 3FANA 2D8SA 1LDKC 3LQIA 4GNFA 2FUUA 2YURA 2XOYA 3GL6A 4LLBA 2PNXA 1WIMA 1WEWA 3Q1DA 3EB5A 5FEYA 1WILA 2YYRA 5AITA 2HDPA 3QZVA 3ZTGA 2OWAA 4R2YA 2EXUA 2XB1A 2M1RA 3L11A 1JOCA 3RPGB 5TDWA 4GNEA 2Y43A 2XOZA 2XOCA 3H7HA 4O62A 2MD7B 2B0OE 5H9MA 2VP7A 2L7PA 3L1ZB 5G05B 3VK6A 3RTRB 2BAYA 4AVXA 3O35A 5AIUA 2EGPA 5C11A 5LKZA 4H9DA 5FB1A 3N9QA 4LKAA 5K3QA 2VPEA 1X4JA 2KU3A 4AYCB 4F52B 2CSZA 2YSJA 2XEUA 3O36A 3O37A 3LDYA 1DCQA 1FP0A 2CRRA 2CT2A 3O70A 2EA6A 1HYJA 4FK5A 2VPBA 5J3XA 1MM3A 4GNGA 1HYIA 2M3HA 4WZ0A 1MBMA 4WZ2A 4V3KC 3SHBA 2VJFB 2ZETC 3EB6A 3N9LA 4YBSA 2KGIA 3DQVR 1Z2QA 2ECVA 2E6RA 4YBTA 5TDRA 4YC9A 4ZQLA 4UI9B 4WZ3B 2YUCA 4Z0RA 1WEOA 4ZUXU 2KE1A 1DVPA 1CHCA 1WEQA 3LRQA 5FERA 5SVYA 4B7YC 5TRBA 4L58A 5DINA 3I2DA 3O34A 3HCSA 2MNYA 2KIZA 2KYUA 2F42A 5DKAA 2VJEA 4AUQB 2KWNA 2L75A 2CRWA 3M62A 1BORA 2I50A 2YVRA 2E6SA 3FL2A 5JG6A 4YADA 2E61A 3HCTA 5B76A 2EGMA 3DDTA 3ZPVE 1WGMA 2L0BA 2RR4A 4I7BA 1VFYA 2JM3A 3HCUA 2K17A 2OXQC 2MD8C 3SUBA 1E4UA 2G6QA 4YABA 2IDAA 3SOWA 2KREA 1WFKA 2JUNA 3E2DA 3KV6A 2JMJA 1IYMA 2G43A 1Z6UA 2IQJA 3MHHA 4LK9A 1RMDA 1WENA 1JM7B 5B8DA 2MA6A 3SOXA 1LDJB 5SVIA
chains in the Genus database with same CATH topology
2FUIA 2YW8A 3U5PA 5LKXA 3T7LA 2M6MA 3C6WA 2ECTA 2PUYA 3ZNIA 3N9MA 2H0DA 4LJNA 3ZYQA 4PTBA 5TBNA 2KWJA 2JMIA 2MA5A 5D1KB 3ZVYA 2ECWA 5B75A 2YHOA 3ZVZB 3KQIA 5KH9A 2YSMA 5LKTA 2KWOA 1VYXA 5LKUA 4I7DA 2VJFA 3N9OA 4TKPB 2KGGA 3LQHA 5KH3A 3C5KA 2CKLB 2YU4A 2VPDA 2LDRA 3M99A 5LCWB 2MIQA 2F6NA 4Q6FA 5B77A 1X4UA 2LGKA 5EYAF 2FSAA 1WEPA 3RPGC 1JM7A 2K16A 4A0CD 4CCGX 2LGLA 4QF3A 4LADB 2RSDA 3ASLA 4S3OB 2YHNA 3MHSA 1U6GB 4A49A 2DX8A 4IC3A 4V3LC 4ZDTA 2EODA 4YATA 2ECNA 4X3GA 2Y1NA 4AP4A 3U5MA 2VJEB 5TABA 5FB0A 1WE9A 3N9PA 5H1VA 2CKLA 1K2FA 2LGVA 4GNDA 1WEUA 2QICA 3PUQA 3L1XA 2LV9A 3HTKC 5D1LB 3U5NA 2MNZA 2C2VS 1XWHA 3PHDA 2KWKA 4GB0A 4YBMA 3N9NA 2VPGA 4UP0A 4N4FA 4L7XA 4IC2A 4O64A 2ECJA 2QJ0A 2L43A 4A4BA 2UZGA 4W4UA 5G0FA 4S3OC 2MT5A 2LQ6A 2YQMA 3ZPV1 2H0DB 4P5OB 3SOUA 1MM2A 2RI7A 4WA6A 2JRJA 3U5OA 2KFTA 1WEVA 5B79A 1V87A 5H1TA 2Y1MA 1WEEA 1Z60A 3IHPA 4NN2A 1WEMA 4UP5A 1G25A 4B86C 2K4DA 2L5UA 4FJCA 4AYCA 4MVTA 4N3WA 3LQJA 3V43A 2ECGA 4YAXA 1FBVA 5I3LA 5G04B 5C13A 1X4IA 1VD4A 2K1JA 4CA1A 1T1HA 3O33A 1F62A 3NG2A 2YREA 3PURA 2G45A 1N87A 2M85A 2LN0A 3KNVA 4A4CA 1ZBDB 5H1UA 2VNFA 2AN6A 2YT5A 3DPLR 3O7AA 2F6JA 2LXHC 2MUMA 2HYED 4R7EA 2LRIC 4FIPA 4MSXA 3T6RA 2QIZA 2ECIA 4PPEA 3M63A 4BHWA 4C9ZA 4XI1A 2LXPC 5KH7A 4BBQA 2JMDA 2LGGA 4QF2A 5B78A 3GV4A 4FO9A 2C2LA 4I7CA 1WESA 2NAAA 2L80A 5D1MB 2YQLA 3KV5A 2KR4A 2CSYA 4R8PK 2D8SA 1LDKC 3LQIA 4GNFA 2FUUA 2YURA 4LLBA 3GL6A 2PNXA 1WIMA 1WEWA 3EB5A 5FEYA 1WILA 2YYRA 5AITA 2HDPA 3QZVA 3ZTGA 4R2YA 2XB1A 2M1RA 3L11A 1JOCA 3RPGB 5TDWA 4GNEA 2Y43A 2MD7B 5H9MA 2VP7A 3L1ZB 5G05B 3VK6A 3RTRB 2BAYA 4AVXA 3O35A 5AIUA 2EGPA 5C11A 5LKZA 5FB1A 3N9QA 4LKAA 2VPEA 1X4JA 2KU3A 4AYCB 4F52B 2CSZA 2YSJA 2XEUA 3O36A 3O37A 1FP0A 2CT2A 3O70A 2EA6A 1HYJA 4FK5A 2VPBA 5J3XA 1MM3A 4GNGA 1HYIA 2M3HA 4WZ0A 4WZ2A 4V3KC 3SHBA 2VJFB 2ZETC 3EB6A 3N9LA 4YBSA 2KGIA 3DQVR 1Z2QA 2ECVA 2E6RA 4YBTA 5TDRA 4YC9A 4ZQLA 4UI9B 4WZ3B 2YUCA 1WEOA 4ZUXU 2KE1A 1DVPA 1CHCA 1WEQA 3LRQA 5FERA 4B7YC 5TRBA 4L58A 5DINA 3I2DA 3O34A 3HCSA 2MNYA 2KIZA 2KYUA 2F42A 5DKAA 2VJEA 4AUQB 2KWNA 2L75A 3M62A 1BORA 2I50A 2E6SA 3FL2A 5JG6A 4YADA 3HCTA 5B76A 3ZPVE 1WGMA 2L0BA 4I7BA 1VFYA 3HCUA 2K17A 2OXQC 2MD8C 1E4UA 2G6QA 4YABA 2IDAA 3SOWA 2KREA 1WFKA 3KV6A 2JMJA 1IYMA 2G43A 1Z6UA 3MHHA 4LK9A 1RMDA 1WENA 1JM7B 5B8DA 2MA6A 3SOXA 1LDJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FUI A;  2YW8 A;  3U5P A;  5LKX A;  3T7L A;  2M6M A;  3C6W A;  2ECT A;  2PUY A;  3ZNI A;  3N9M A;  2H0D A;  4LJN A;  3ZYQ A;  4PTB A;  5TBN A;  2KWJ A;  2JMI A;  2MA5 A;  5D1K B;  3ZVY A;  2ECW A;  5B75 A;  2YHO A;  3ZVZ B;  3KQI A;  5KH9 A;  2YSM A;  5LKT A;  2KWO A;  1VYX A;  5LKU A;  4I7D A;  2VJF A;  3N9O A;  4TKP B;  2KGG A;  3LQH A;  5KH3 A;  3C5K A;  2CKL B;  2YU4 A;  2VPD A;  2LDR A;  3M99 A;  5LCW B;  2MIQ A;  2F6N A;  4Q6F A;  5B77 A;  1X4U A;  2LGK A;  5EYA F;  2FSA A;  1WEP A;  3RPG C;  1JM7 A;  2K16 A;  4A0C D;  4CCG X;  2LGL A;  4QF3 A;  4LAD B;  2RSD A;  3ASL A;  4S3O B;  2YHN A;  3MHS A;  1U6G B;  4A49 A;  2DX8 A;  4IC3 A;  4V3L C;  4ZDT A;  2EOD A;  4YAT A;  2ECN A;  4X3G A;  2Y1N A;  4AP4 A;  3U5M A;  2VJE B;  5TAB A;  5FB0 A;  1WE9 A;  3N9P A;  5H1V A;  2CKL A;  1K2F A;  2LGV A;  4GND A;  1WEU A;  2QIC A;  3PUQ A;  3L1X A;  2LV9 A;  3HTK C;  5D1L B;  3U5N A;  2MNZ A;  2C2V S;  1XWH A;  3PHD A;  2KWK A;  4GB0 A;  4YBM A;  3N9N A;  2VPG A;  4UP0 A;  4N4F A;  4L7X A;  4IC2 A;  4O64 A;  2ECJ A;  2QJ0 A;  2L43 A;  4A4B A;  2UZG A;  4W4U A;  5G0F A;  4S3O C;  2MT5 A;  2LQ6 A;  2YQM A;  3ZPV 1;  2H0D B;  4P5O B;  3SOU A;  1MM2 A;  2RI7 A;  4WA6 A;  2JRJ A;  3U5O A;  2KFT A;  1WEV A;  5B79 A;  1V87 A;  5H1T A;  2Y1M A;  1WEE A;  1Z60 A;  3IHP A;  4NN2 A;  1WEM A;  4UP5 A;  1G25 A;  4B86 C;  2K4D A;  2L5U A;  4FJC A;  4AYC A;  4MVT A;  4N3W A;  3LQJ A;  3V43 A;  2ECG A;  4YAX A;  1FBV A;  5I3L A;  5G04 B;  5C13 A;  1X4I A;  1VD4 A;  2K1J A;  4CA1 A;  1T1H A;  3O33 A;  1F62 A;  3NG2 A;  2YRE A;  3PUR A;  2G45 A;  1N87 A;  2M85 A;  2LN0 A;  3KNV A;  4A4C A;  1ZBD B;  5H1U A;  2VNF A;  2AN6 A;  2YT5 A;  3DPL R;  3O7A A;  2F6J A;  2LXH C;  2MUM A;  2HYE D;  4R7E A;  2LRI C;  4FIP A;  4MSX A;  3T6R A;  2QIZ A;  2ECI A;  4PPE A;  3M63 A;  4BHW A;  4C9Z A;  4XI1 A;  2LXP C;  5KH7 A;  4BBQ A;  2JMD A;  2LGG A;  4QF2 A;  5B78 A;  3GV4 A;  4FO9 A;  2C2L A;  4I7C A;  1WES A;  2NAA A;  2L80 A;  5D1M B;  2YQL A;  3KV5 A;  2KR4 A;  2CSY A;  4R8P K;  2D8S A;  1LDK C;  3LQI A;  4GNF A;  2FUU A;  2YUR A;  4LLB A;  3GL6 A;  2PNX A;  1WIM A;  1WEW A;  3EB5 A;  5FEY A;  1WIL A;  2YYR A;  5AIT A;  2HDP A;  3QZV A;  3ZTG A;  4R2Y A;  2XB1 A;  2M1R A;  3L11 A;  1JOC A;  3RPG B;  5TDW A;  4GNE A;  2Y43 A;  2MD7 B;  5H9M A;  2VP7 A;  3L1Z B;  5G05 B;  3VK6 A;  3RTR B;  2BAY A;  4AVX A;  3O35 A;  5AIU A;  2EGP A;  5C11 A;  5LKZ A;  5FB1 A;  3N9Q A;  4LKA A;  2VPE A;  1X4J A;  2KU3 A;  4AYC B;  4F52 B;  2CSZ A;  2YSJ A;  2XEU A;  3O36 A;  3O37 A;  1FP0 A;  2CT2 A;  3O70 A;  2EA6 A;  1HYJ A;  4FK5 A;  2VPB A;  5J3X A;  1MM3 A;  4GNG A;  1HYI A;  2M3H A;  4WZ0 A;  4WZ2 A;  4V3K C;  3SHB A;  2VJF B;  2ZET C;  3EB6 A;  3N9L A;  4YBS A;  2KGI A;  3DQV R;  1Z2Q A;  2ECV A;  2E6R A;  4YBT A;  5TDR A;  4YC9 A;  4ZQL A;  4UI9 B;  4WZ3 B;  2YUC A;  1WEO A;  4ZUX U;  2KE1 A;  1DVP A;  1CHC A;  1WEQ A;  3LRQ A;  5FER A;  4B7Y C;  5TRB A;  4L58 A;  5DIN A;  3I2D A;  3O34 A;  3HCS A;  2MNY A;  2KIZ A;  2KYU A;  2F42 A;  5DKA A;  2VJE A;  4AUQ B;  2KWN A;  2L75 A;  3M62 A;  1BOR A;  2I50 A;  2E6S A;  3FL2 A;  5JG6 A;  4YAD A;  3HCT A;  5B76 A;  3ZPV E;  1WGM A;  2L0B A;  4I7B A;  1VFY A;  3HCU A;  2K17 A;  2OXQ C;  2MD8 C;  1E4U A;  2G6Q A;  4YAB A;  2IDA A;  3SOW A;  2KRE A;  1WFK A;  3KV6 A;  2JMJ A;  1IYM A;  2G43 A;  1Z6U A;  3MHH A;  4LK9 A;  1RMD A;  1WEN A;  1JM7 B;  5B8D A;  2MA6 A;  3SOX A;  1LDJ B; 
#chains in the Genus database with same CATH topology
 2FUI A;  3FJU B;  2YW8 A;  3U5P A;  5LKX A;  3T7L A;  3JUE A;  2M6M A;  3C6W A;  2ECT A;  2PUY A;  3ZNI A;  3N9M A;  2H0D A;  4LJN A;  3ZYQ A;  4PTB A;  5TBN A;  2KWJ A;  2JMI A;  2MA5 A;  5D1K B;  3ZVY A;  2ECW A;  5B75 A;  2YHO A;  3ZVZ B;  3KQI A;  5KH9 A;  2YSM A;  5LKT A;  2KWO A;  1VYX A;  5LKU A;  3T9K A;  2DJA A;  4I7D A;  2VJF A;  3N9O A;  4TKP B;  2KGG A;  3LQH A;  5KH3 A;  3C5K A;  2CKL B;  2YU4 A;  2VPD A;  2LDR A;  2MKE A;  3M99 A;  5LCW B;  2MIQ A;  2F6N A;  5SVI B;  4Q6F A;  5B77 A;  1X4U A;  2LGK A;  5EYA F;  2FSA A;  1WEP A;  3RPG C;  3O47 A;  1JM7 A;  2K16 A;  4A0C D;  4CCG X;  2LGL A;  4QF3 A;  4LAD B;  2RSD A;  3ASL A;  4OGC A;  4S3O B;  2YHN A;  3LJU X;  3MHS A;  1U6G B;  4A49 A;  2DX8 A;  4IC3 A;  4V3L C;  4ZDT A;  2EOD A;  4YAT A;  2ECN A;  4X3G A;  2Y1N A;  4QQ4 A;  4AP4 A;  3U5M A;  2VJE B;  5TAB A;  5FB0 A;  1WE9 A;  3N9P A;  5H1V A;  2CKL A;  1K2F A;  2FD4 A;  2LGV A;  4GND A;  1WEU A;  3DWD A;  2QIC A;  2XP0 A;  2LAU A;  3PUQ A;  2D8U A;  2LV9 A;  3HTK C;  3L1X A;  5D1L B;  3U5N A;  2MNZ A;  2C2V S;  1XWH A;  3PHD A;  2KWK A;  2FFW A;  4GB0 A;  4Z0O A;  4YBM A;  3N9N A;  2VPG A;  4UP0 A;  4N4F A;  4L7X A;  3LVQ E;  4IC2 A;  4O64 A;  2ECJ A;  2QJ0 A;  3LVR E;  2KKX A;  2L43 A;  4A4B A;  2UZG A;  4W4U A;  5G0F A;  4S3O C;  2MT5 A;  2LQ6 A;  2YQM A;  3ZPV 1;  2DSM A;  2H0D B;  2P57 A;  4P5O B;  3SOU A;  1MM2 A;  2RI7 A;  4WA6 A;  2JRJ A;  3U5O A;  2KFT A;  1WEV A;  3PLW A;  5B79 A;  1V87 A;  5H1T A;  2Y1M A;  1WEE A;  1Z60 A;  3IHP A;  4NN2 A;  1WEM A;  4UP5 A;  1G25 A;  2M13 A;  4B86 C;  2K4D A;  2L5U A;  4FJC A;  3M7K A;  4AYC A;  5SVX A;  3KDE C;  4MVT A;  2KKY A;  4N3W A;  3LQJ A;  3V43 A;  2ECG A;  4YAX A;  1FBV A;  5I3L A;  5G04 B;  5C13 A;  1X4I A;  1VD4 A;  2K1J A;  4CA1 A;  1T1H A;  3O33 A;  3FM8 C;  1F62 A;  3NG2 A;  2YRE A;  2CSV A;  3PUR A;  2G45 A;  1N87 A;  2M85 A;  2LN0 A;  3FAO A;  3KNV A;  4A4C A;  1ZBD B;  5H1U A;  2VNF A;  3FEH A;  3MDB C;  2AN6 A;  2YT5 A;  3DPL R;  3O7A A;  2F6J A;  2LXH C;  2MUM A;  2HYE D;  4R7E A;  2LRI C;  4FIP A;  4MSX A;  3T6R A;  2QIZ A;  2ECI A;  2CON A;  4PPE A;  3M63 A;  4BHW A;  4F1P A;  4C9Z A;  4XI1 A;  2LXP C;  5KH7 A;  4BBQ A;  2JMD A;  2LGG A;  4QF2 A;  4OGE A;  5B78 A;  3GV4 A;  4FO9 A;  2C2L A;  4I7C A;  1WES A;  2NAA A;  2L80 A;  5D1M B;  2YQL A;  3KV5 A;  2KR4 A;  2CSY A;  4R8P K;  3FAN A;  2D8S A;  1LDK C;  3LQI A;  4GNF A;  2FUU A;  2YUR A;  2XOY A;  3GL6 A;  4LLB A;  2PNX A;  1WIM A;  1WEW A;  3Q1D A;  3EB5 A;  5FEY A;  1WIL A;  2YYR A;  5AIT A;  2HDP A;  3QZV A;  3ZTG A;  2OWA A;  4R2Y A;  2EXU A;  2XB1 A;  2M1R A;  3L11 A;  1JOC A;  3RPG B;  5TDW A;  4GNE A;  2Y43 A;  2XOZ A;  2XOC A;  3H7H A;  4O62 A;  2MD7 B;  2B0O E;  5H9M A;  2VP7 A;  2L7P A;  3L1Z B;  5G05 B;  3VK6 A;  3RTR B;  2BAY A;  4AVX A;  3O35 A;  5AIU A;  2EGP A;  5C11 A;  5LKZ A;  4H9D A;  5FB1 A;  3N9Q A;  4LKA A;  5K3Q A;  2VPE A;  1X4J A;  2KU3 A;  4AYC B;  4F52 B;  2CSZ A;  2YSJ A;  2XEU A;  3O36 A;  3O37 A;  3LDY A;  1DCQ A;  1FP0 A;  2CRR A;  2CT2 A;  3O70 A;  2EA6 A;  1HYJ A;  4FK5 A;  2VPB A;  5J3X A;  1MM3 A;  4GNG A;  1HYI A;  2M3H A;  4WZ0 A;  1MBM A;  4WZ2 A;  4V3K C;  3SHB A;  2VJF B;  2ZET C;  3EB6 A;  3N9L A;  4YBS A;  2KGI A;  3DQV R;  1Z2Q A;  2ECV A;  2E6R A;  4YBT A;  5TDR A;  4YC9 A;  4ZQL A;  4UI9 B;  4WZ3 B;  2YUC A;  4Z0R A;  1WEO A;  4ZUX U;  2KE1 A;  1DVP A;  1CHC A;  1WEQ A;  3LRQ A;  5FER A;  5SVY A;  4B7Y C;  5TRB A;  4L58 A;  5DIN A;  3I2D A;  3O34 A;  3HCS A;  2MNY A;  2KIZ A;  2KYU A;  2F42 A;  5DKA A;  2VJE A;  4AUQ B;  2KWN A;  2L75 A;  2CRW A;  3M62 A;  1BOR A;  2I50 A;  2YVR A;  2E6S A;  3FL2 A;  5JG6 A;  4YAD A;  2E61 A;  3HCT A;  5B76 A;  2EGM A;  3DDT A;  3ZPV E;  1WGM A;  2L0B A;  2RR4 A;  4I7B A;  1VFY A;  2JM3 A;  3HCU A;  2K17 A;  2OXQ C;  2MD8 C;  3SUB A;  1E4U A;  2G6Q A;  4YAB A;  2IDA A;  3SOW A;  2KRE A;  1WFK A;  2JUN A;  3E2D A;  3KV6 A;  2JMJ A;  1IYM A;  2G43 A;  1Z6U A;  2IQJ A;  3MHH A;  4LK9 A;  1RMD A;  1WEN A;  1JM7 B;  5B8D A;  2MA6 A;  3SOX A;  1LDJ B;  5SVI A; 
#chains in the Genus database with same CATH homology
 2FUI A;  2YW8 A;  3U5P A;  5LKX A;  3T7L A;  2M6M A;  3C6W A;  2ECT A;  2PUY A;  3ZNI A;  3N9M A;  2H0D A;  4LJN A;  3ZYQ A;  4PTB A;  5TBN A;  2KWJ A;  2JMI A;  2MA5 A;  5D1K B;  3ZVY A;  2ECW A;  5B75 A;  2YHO A;  3ZVZ B;  3KQI A;  5KH9 A;  2YSM A;  5LKT A;  2KWO A;  1VYX A;  5LKU A;  4I7D A;  2VJF A;  3N9O A;  4TKP B;  2KGG A;  3LQH A;  5KH3 A;  3C5K A;  2CKL B;  2YU4 A;  2VPD A;  2LDR A;  3M99 A;  5LCW B;  2MIQ A;  2F6N A;  4Q6F A;  5B77 A;  1X4U A;  2LGK A;  5EYA F;  2FSA A;  1WEP A;  3RPG C;  1JM7 A;  2K16 A;  4A0C D;  4CCG X;  2LGL A;  4QF3 A;  4LAD B;  2RSD A;  3ASL A;  4S3O B;  2YHN A;  3MHS A;  1U6G B;  4A49 A;  2DX8 A;  4IC3 A;  4V3L C;  4ZDT A;  2EOD A;  4YAT A;  2ECN A;  4X3G A;  2Y1N A;  4AP4 A;  3U5M A;  2VJE B;  5TAB A;  5FB0 A;  1WE9 A;  3N9P A;  5H1V A;  2CKL A;  1K2F A;  2LGV A;  4GND A;  1WEU A;  2QIC A;  3PUQ A;  3L1X A;  2LV9 A;  3HTK C;  5D1L B;  3U5N A;  2MNZ A;  2C2V S;  1XWH A;  3PHD A;  2KWK A;  4GB0 A;  4YBM A;  3N9N A;  2VPG A;  4UP0 A;  4N4F A;  4L7X A;  4IC2 A;  4O64 A;  2ECJ A;  2QJ0 A;  2L43 A;  4A4B A;  2UZG A;  4W4U A;  5G0F A;  4S3O C;  2MT5 A;  2LQ6 A;  2YQM A;  3ZPV 1;  2H0D B;  4P5O B;  3SOU A;  1MM2 A;  2RI7 A;  4WA6 A;  2JRJ A;  3U5O A;  2KFT A;  1WEV A;  5B79 A;  1V87 A;  5H1T A;  2Y1M A;  1WEE A;  1Z60 A;  3IHP A;  4NN2 A;  1WEM A;  4UP5 A;  1G25 A;  4B86 C;  2K4D A;  2L5U A;  4FJC A;  4AYC A;  4MVT A;  4N3W A;  3LQJ A;  3V43 A;  2ECG A;  4YAX A;  1FBV A;  5I3L A;  5G04 B;  5C13 A;  1X4I A;  1VD4 A;  2K1J A;  4CA1 A;  1T1H A;  3O33 A;  1F62 A;  3NG2 A;  2YRE A;  3PUR A;  2G45 A;  1N87 A;  2M85 A;  2LN0 A;  3KNV A;  4A4C A;  1ZBD B;  5H1U A;  2VNF A;  2AN6 A;  2YT5 A;  3DPL R;  3O7A A;  2F6J A;  2LXH C;  2MUM A;  2HYE D;  4R7E A;  2LRI C;  4FIP A;  4MSX A;  3T6R A;  2QIZ A;  2ECI A;  4PPE A;  3M63 A;  4BHW A;  4C9Z A;  4XI1 A;  2LXP C;  5KH7 A;  4BBQ A;  2JMD A;  2LGG A;  4QF2 A;  5B78 A;  3GV4 A;  4FO9 A;  2C2L A;  4I7C A;  1WES A;  2NAA A;  2L80 A;  5D1M B;  2YQL A;  3KV5 A;  2KR4 A;  2CSY A;  4R8P K;  2D8S A;  1LDK C;  3LQI A;  4GNF A;  2FUU A;  2YUR A;  4LLB A;  3GL6 A;  2PNX A;  1WIM A;  1WEW A;  3EB5 A;  5FEY A;  1WIL A;  2YYR A;  5AIT A;  2HDP A;  3QZV A;  3ZTG A;  4R2Y A;  2XB1 A;  2M1R A;  3L11 A;  1JOC A;  3RPG B;  5TDW A;  4GNE A;  2Y43 A;  2MD7 B;  5H9M A;  2VP7 A;  3L1Z B;  5G05 B;  3VK6 A;  3RTR B;  2BAY A;  4AVX A;  3O35 A;  5AIU A;  2EGP A;  5C11 A;  5LKZ A;  5FB1 A;  3N9Q A;  4LKA A;  2VPE A;  1X4J A;  2KU3 A;  4AYC B;  4F52 B;  2CSZ A;  2YSJ A;  2XEU A;  3O36 A;  3O37 A;  1FP0 A;  2CT2 A;  3O70 A;  2EA6 A;  1HYJ A;  4FK5 A;  2VPB A;  5J3X A;  1MM3 A;  4GNG A;  1HYI A;  2M3H A;  4WZ0 A;  4WZ2 A;  4V3K C;  3SHB A;  2VJF B;  2ZET C;  3EB6 A;  3N9L A;  4YBS A;  2KGI A;  3DQV R;  1Z2Q A;  2ECV A;  2E6R A;  4YBT A;  5TDR A;  4YC9 A;  4ZQL A;  4UI9 B;  4WZ3 B;  2YUC A;  1WEO A;  4ZUX U;  2KE1 A;  1DVP A;  1CHC A;  1WEQ A;  3LRQ A;  5FER A;  4B7Y C;  5TRB A;  4L58 A;  5DIN A;  3I2D A;  3O34 A;  3HCS A;  2MNY A;  2KIZ A;  2KYU A;  2F42 A;  5DKA A;  2VJE A;  4AUQ B;  2KWN A;  2L75 A;  3M62 A;  1BOR A;  2I50 A;  2E6S A;  3FL2 A;  5JG6 A;  4YAD A;  3HCT A;  5B76 A;  3ZPV E;  1WGM A;  2L0B A;  4I7B A;  1VFY A;  3HCU A;  2K17 A;  2OXQ C;  2MD8 C;  1E4U A;  2G6Q A;  4YAB A;  2IDA A;  3SOW A;  2KRE A;  1WFK A;  3KV6 A;  2JMJ A;  1IYM A;  2G43 A;  1Z6U A;  3MHH A;  4LK9 A;  1RMD A;  1WEN A;  1JM7 B;  5B8D A;  2MA6 A;  3SOX A;  1LDJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...