5FERA

Complex of trim25 ring with ubch5-ub
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
79
structure length
79
Chain Sequence
MAELCPLAEELSCSICLEPFKEPVTTPCGHNFCGSCLNETWAVQGSPYLCPQCRAVYQARPQLHKNTVLCNVVEQFLQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin/ISG15 ligase TRIM25
publication title Functional role of TRIM E3 ligase oligomerization and regulation of catalytic activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 16
structure length 79
sequence length 79
chains with identical sequence D
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15227 zf-C3HC4_4 zinc finger of C3HC4-type, RING
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5ferA00
1HYIA 2L0BA 2H0DA 2LXHC 2UZGA 4UP5A 5TRBA 2LGKA 3SHBA 2YU4A 3HCTA 3ZYQA 4ZDTA 2CKLA 4O64A 4GNGA 3N9OA 1K2FA 3RPGB 4I7CA 3QZVA 2CT2A 2VPGA 2M85A 5B8DA 2M1RA 4FJCA 1U6GB 4GNFA 3T6RA 1JOCA 3ASLA 2H0DB 2L43A 2YSJA 4V3KC 1VD4A 1X4JA 2CKLB 3N9NA 4YAXA 3U5PA 4CA1A 4GB0A 1ZBDB 2VJEA 3O37A 4PPEA 4YC9A 4ZUXU 1WFKA 1XWHA 4FK5A 2F6JA 3ZTGA 4FO9A 4AYCA 3SOWA 5EYAF 2L80A 4N4FA 1JM7A 2JMIA 5H1UA 5H1TA 2EODA 2VJEB 5LKZA 2VJFA 1DVPA 5DKAA 1WEOA 4YBTA 2KGIA 1N87A 1X4IA 4GNDA 3O7AA 4AUQB 2CSYA 4AYCB 2QJ0A 5AIUA 2F6NA 3L11A 2K17A 2C2VS 4A4BA 1JM7B 3U5MA 3HCUA 3LRQA 4P5OB 2LQ6A 2ZETC 2RI7A 2M6MA 5G05B 2L5UA 4LLBA 5C13A 4UI9B 2IDAA 2LGLA 2VPEA 2VJFB 4AP4A 2YQMA 2YSMA 3MHHA 2YYRA 4FIPA 4WA6A 4YBSA 5D1LB 2ECGA 5H1VA 4I7DA 3ZVZB 2YHNA 3DQVR 3L1XA 4S3OB 2Y43A 1Z2QA 5LKUA 3SOUA 3O34A 5LKTA 1E4UA 3LQHA 4MVTA 3RPGC 3GV4A 2KWKA 5D1KB 1BORA 1WGMA 4PTBA 4BBQA 3N9LA 4YADA 4N3WA 2G45A 4LADB 5KH7A 1VYXA 2XB1A 2YURA 2VPBA 1MM3A 2ECWA 4Q6FA 3PURA 1LDKC 5FERA 3DPLR 1WENA 2MA6A 4F52B 1T1HA 2F42A 2MT5A 4V3LC 5B75A 2Y1MA 3EB6A 2ECVA 4R2YA 3MHSA 2MD8C 2FSAA 2LXPC 2MNYA 5KH3A 5LCWB 2I50A 1WEWA 2HYED 2KU3A 1IYMA 2BAYA 3RTRB 2KREA 3U5OA 2ECTA 1WESA 4LKAA 4C9ZA 3HTKC 4IC3A 2KWOA 4LJNA 3LQIA 3C6WA 5TDWA 3ZPV1 2XEUA 4R8PK 3M63A 4BHWA 3GL6A 2PUYA 4NN2A 3KV6A 3L1ZB 2LN0A 3ZPVE 2CSZA 3NG2A 5B78A 2K1JA 2KWNA 1Z6UA 5I3LA 2E6SA 1LDJB 3N9MA 2LDRA 3KNVA 5J3XA 3VK6A 2K4DA 4AVXA 4S3OC 4ZQLA 3EB5A 2QIZA 4XI1A 2M3HA 2RSDA 1WEVA 5FB1A 2E6RA 2VNFA 2YHOA 4I7BA 5JG6A 2VP7A 4MSXA 1WEMA 2ECNA 5KH9A 2C2LA 2KYUA 4YBMA 2KE1A 2Y1NA 2L75A 5FB0A 4GNEA 2ECJA 5B76A 3M62A 2EA6A 2NAAA 2YREA 5B77A 3I2DA 3M99A 2LV9A 2D8SA 1G25A 5TBNA 3N9QA 5G04B 3PUQA 3O35A 5D1MB 3O36A 2KWJA 1FP0A 4B7YC 2MIQA 4WZ2A 4L58A 5C11A 2LGVA 5FEYA 4A0CD 3N9PA 5H9MA 2PNXA 3T7LA 4WZ0A 2ECIA 2KIZA 2JMDA 2YT5A 4X3GA 3O70A 4UP0A 3LQJA 1Z60A 1V87A 3KV5A 1WE9A 2MA5A 3IHPA 2MNZA 2K16A 1WEPA 2YW8A 1HYJA 2FUUA 2KGGA 3O33A 5DINA 3V43A 4A49A 2G43A 1X4UA 1WILA 2FUIA 3KQIA 1CHCA 5LKXA 4YABA 2AN6A 2KFTA 2MD7B 2JRJA 2EGPA 1FBVA 2LGGA 2G6QA 3FL2A 2LRIC 2OXQC 2QICA 4L7XA 4A4CA 1WIMA 4B86C 1F62A 5TDRA 5TABA 4QF2A 2VPDA 4QF3A 3U5NA 4WZ3B 2KR4A 3HCSA 2DX8A 2YUCA 4TKPB 1WEQA 1VFYA 1RMDA 3PHDA 2MUMA 4IC2A 2HDPA 3C5KA 2YQLA 1WEEA 4R7EA 1WEUA 5B79A 2JMJA 3ZNIA 1MM2A 4YATA 5AITA 5G0FA 3ZVYA 4CCGX 4LK9A 4W4UA 3SOXA
chains in the Genus database with same CATH superfamily
1HYIA 2L0BA 2H0DA 2LXHC 2UZGA 3PLWA 4UP5A 5TRBA 2LGKA 3LDYA 3SHBA 2YU4A 3HCTA 3ZYQA 4ZDTA 2CKLA 4O64A 4GNGA 3N9OA 1K2FA 4Z0RA 2XOZA 3RPGB 4I7CA 3QZVA 2CT2A 2VPGA 2M85A 5B8DA 2M1RA 2XOYA 3O47A 4FJCA 1U6GB 4GNFA 4O62A 3T6RA 1JOCA 3ASLA 2H0DB 2L43A 2YSJA 4V3KC 1VD4A 1X4JA 2CKLB 3N9NA 4YAXA 3DWDA 3U5PA 4CA1A 4GB0A 1ZBDB 2VJEA 3O37A 4PPEA 4YC9A 4ZUXU 3LVQE 1WFKA 1XWHA 4FK5A 2F6JA 3ZTGA 2DSMA 4FO9A 4AYCA 3SOWA 5EYAF 2L80A 3MDBC 4N4FA 2D8UA 1JM7A 2JMIA 5H1UA 5H1TA 2EODA 2M13A 2VJEB 5LKZA 2VJFA 1DVPA 5DKAA 2FFWA 1WEOA 4YBTA 2KGIA 1N87A 1X4IA 4GNDA 3O7AA 4AUQB 2CSYA 4AYCB 2QJ0A 5AIUA 2F6NA 3L11A 2K17A 2C2VS 4A4BA 3Q1DA 1JM7B 3U5MA 3HCUA 3KDEC 3LRQA 4P5OB 2LQ6A 2ZETC 2RI7A 2YVRA 2M6MA 5G05B 2L5UA 4LLBA 5C13A 4UI9B 2IDAA 2LGLA 2VPEA 2VJFB 1DCQA 4AP4A 2YQMA 2YSMA 3MHHA 2YYRA 4FIPA 4WA6A 4QQ4A 4YBSA 5D1LB 2ECGA 5H1VA 4I7DA 3ZVZB 2YHNA 3DQVR 3L1XA 4S3OB 2Y43A 2XP0A 1Z2QA 5LKUA 3SOUA 3O34A 5LKTA 1E4UA 3LQHA 4MVTA 3RPGC 3GV4A 2KWKA 5D1KB 1BORA 1WGMA 4PTBA 4BBQA 3N9LA 2XOCA 4YADA 4N3WA 2G45A 4LADB 5KH7A 1VYXA 2XB1A 2YURA 4OGCA 2VPBA 1MM3A 3JUEA 2ECWA 4Q6FA 3PURA 1LDKC 3T9KA 5FERA 3DPLR 2CRRA 1WENA 2MA6A 4F52B 1T1HA 2F42A 2MT5A 4V3LC 5B75A 2Y1MA 3EB6A 2ECVA 4R2YA 3MHSA 2MD8C 2FSAA 2LXPC 2MKEA 2MNYA 5KH3A 2KKYA 5LCWB 2I50A 3H7HA 1WEWA 2HYED 2KU3A 3FEHA 1IYMA 2BAYA 3RTRB 2KREA 3U5OA 2ECTA 1WESA 4LKAA 4C9ZA 3HTKC 4IC3A 2KWOA 4LJNA 3LQIA 3SUBA 3C6WA 5TDWA 3ZPV1 2EGMA 2XEUA 4R8PK 2FD4A 3LVRE 3M63A 4BHWA 3GL6A 2PUYA 4NN2A 3KV6A 3L1ZB 2LN0A 3ZPVE 2CSZA 5SVIA 2JM3A 3NG2A 2CRWA 5B78A 2K1JA 2KWNA 1Z6UA 5I3LA 2E6SA 1LDJB 2LAUA 3N9MA 2LDRA 3KNVA 5J3XA 3VK6A 2K4DA 4AVXA 4S3OC 4ZQLA 3EB5A 4OGEA 2QIZA 4XI1A 2M3HA 2RSDA 1WEVA 5FB1A 2E6RA 5SVIB 2VNFA 2YHOA 3FM8C 4I7BA 5JG6A 2VP7A 4MSXA 1WEMA 2ECNA 5KH9A 2C2LA 2KYUA 3M7KA 4YBMA 2KE1A 2Y1NA 2L75A 5FB0A 4GNEA 2ECJA 4Z0OA 5B76A 3M62A 2EA6A 2NAAA 2YREA 5B77A 2DJAA 3I2DA 3M99A 2LV9A 2D8SA 1G25A 5TBNA 3N9QA 5G04B 3PUQA 3O35A 5D1MB 3O36A 2KWJA 4F1PA 1FP0A 4B7YC 2MIQA 4WZ2A 4L58A 5SVYA 5C11A 2LGVA 5FEYA 4A0CD 3N9PA 5H9MA 2PNXA 3T7LA 4WZ0A 2ECIA 2KIZA 2JMDA 2CONA 2YT5A 4X3GA 3O70A 2IQJA 4UP0A 3LQJA 1Z60A 1V87A 3KV5A 1WE9A 2MA5A 3IHPA 2MNZA 2K16A 1WEPA 2YW8A 3E2DA 1HYJA 2EXUA 2FUUA 2JUNA 2KGGA 3O33A 5DINA 3V43A 4A49A 2G43A 1X4UA 5K3QA 1WILA 2FUIA 3DDTA 5SVXA 3KQIA 1CHCA 5LKXA 4YABA 2AN6A 2KFTA 2MD7B 2JRJA 2EGPA 1FBVA 2LGGA 2G6QA 3FL2A 2LRIC 2OWAA 3FAOA 2OXQC 2QICA 4L7XA 2P57A 4A4CA 2RR4A 1WIMA 4B86C 1F62A 5TDRA 5TABA 2CSVA 4QF2A 2VPDA 4QF3A 3U5NA 4WZ3B 2KR4A 3HCSA 2DX8A 3FJUB 2YUCA 4H9DA 4TKPB 2B0OE 1WEQA 1VFYA 1RMDA 3PHDA 2MUMA 4IC2A 2HDPA 2KKXA 3C5KA 2YQLA 1WEEA 4R7EA 1WEUA 5B79A 2JMJA 3LJUX 2L7PA 3ZNIA 1MM2A 4YATA 5AITA 3FANA 5G0FA 1MBMA 3ZVYA 4CCGX 4LK9A 4W4UA 3SOXA 2E61A
chains in the Genus database with same CATH topology
1HYIA 2L0BA 2H0DA 2LXHC 2UZGA 4UP5A 5TRBA 2LGKA 3SHBA 2YU4A 3HCTA 3ZYQA 4ZDTA 2CKLA 4O64A 4GNGA 3N9OA 1K2FA 3RPGB 4I7CA 3QZVA 2CT2A 2VPGA 2M85A 5B8DA 2M1RA 4FJCA 1U6GB 4GNFA 3T6RA 1JOCA 3ASLA 2H0DB 2L43A 2YSJA 4V3KC 1VD4A 1X4JA 2CKLB 3N9NA 4YAXA 3U5PA 4CA1A 4GB0A 1ZBDB 2VJEA 3O37A 4PPEA 4YC9A 4ZUXU 1WFKA 1XWHA 4FK5A 2F6JA 3ZTGA 4FO9A 4AYCA 3SOWA 5EYAF 2L80A 4N4FA 1JM7A 2JMIA 5H1UA 5H1TA 2EODA 2VJEB 5LKZA 2VJFA 1DVPA 5DKAA 1WEOA 4YBTA 2KGIA 1N87A 1X4IA 4GNDA 3O7AA 4AUQB 2CSYA 4AYCB 2QJ0A 5AIUA 2F6NA 3L11A 2K17A 2C2VS 4A4BA 1JM7B 3U5MA 3HCUA 3LRQA 4P5OB 2LQ6A 2ZETC 2RI7A 2M6MA 5G05B 2L5UA 4LLBA 5C13A 4UI9B 2IDAA 2LGLA 2VPEA 2VJFB 4AP4A 2YQMA 2YSMA 3MHHA 2YYRA 4FIPA 4WA6A 4YBSA 5D1LB 2ECGA 5H1VA 4I7DA 3ZVZB 2YHNA 3DQVR 3L1XA 4S3OB 2Y43A 1Z2QA 5LKUA 3SOUA 3O34A 5LKTA 1E4UA 3LQHA 4MVTA 3RPGC 3GV4A 2KWKA 5D1KB 1BORA 1WGMA 4PTBA 4BBQA 3N9LA 4YADA 4N3WA 2G45A 4LADB 5KH7A 1VYXA 2XB1A 2YURA 2VPBA 1MM3A 2ECWA 4Q6FA 3PURA 1LDKC 5FERA 3DPLR 1WENA 2MA6A 4F52B 1T1HA 2F42A 2MT5A 4V3LC 5B75A 2Y1MA 3EB6A 2ECVA 4R2YA 3MHSA 2MD8C 2FSAA 2LXPC 2MNYA 5KH3A 5LCWB 2I50A 1WEWA 2HYED 2KU3A 1IYMA 2BAYA 3RTRB 2KREA 3U5OA 2ECTA 1WESA 4LKAA 4C9ZA 3HTKC 4IC3A 2KWOA 4LJNA 3LQIA 3C6WA 5TDWA 3ZPV1 2XEUA 4R8PK 3M63A 4BHWA 3GL6A 2PUYA 4NN2A 3KV6A 3L1ZB 2LN0A 3ZPVE 2CSZA 3NG2A 5B78A 2K1JA 2KWNA 1Z6UA 5I3LA 2E6SA 1LDJB 3N9MA 2LDRA 3KNVA 5J3XA 3VK6A 2K4DA 4AVXA 4S3OC 4ZQLA 3EB5A 2QIZA 4XI1A 2M3HA 2RSDA 1WEVA 5FB1A 2E6RA 2VNFA 2YHOA 4I7BA 5JG6A 2VP7A 4MSXA 1WEMA 2ECNA 5KH9A 2C2LA 2KYUA 4YBMA 2KE1A 2Y1NA 2L75A 5FB0A 4GNEA 2ECJA 5B76A 3M62A 2EA6A 2NAAA 2YREA 5B77A 3I2DA 3M99A 2LV9A 2D8SA 1G25A 5TBNA 3N9QA 5G04B 3PUQA 3O35A 5D1MB 3O36A 2KWJA 1FP0A 4B7YC 2MIQA 4WZ2A 4L58A 5C11A 2LGVA 5FEYA 4A0CD 3N9PA 5H9MA 2PNXA 3T7LA 4WZ0A 2ECIA 2KIZA 2JMDA 2YT5A 4X3GA 3O70A 4UP0A 3LQJA 1Z60A 1V87A 3KV5A 1WE9A 2MA5A 3IHPA 2MNZA 2K16A 1WEPA 2YW8A 1HYJA 2FUUA 2KGGA 3O33A 5DINA 3V43A 4A49A 2G43A 1X4UA 1WILA 2FUIA 3KQIA 1CHCA 5LKXA 4YABA 2AN6A 2KFTA 2MD7B 2JRJA 2EGPA 1FBVA 2LGGA 2G6QA 3FL2A 2LRIC 2OXQC 2QICA 4L7XA 4A4CA 1WIMA 4B86C 1F62A 5TDRA 5TABA 4QF2A 2VPDA 4QF3A 3U5NA 4WZ3B 2KR4A 3HCSA 2DX8A 2YUCA 4TKPB 1WEQA 1VFYA 1RMDA 3PHDA 2MUMA 4IC2A 2HDPA 3C5KA 2YQLA 1WEEA 4R7EA 1WEUA 5B79A 2JMJA 3ZNIA 1MM2A 4YATA 5AITA 5G0FA 3ZVYA 4CCGX 4LK9A 4W4UA 3SOXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HYI A;  2L0B A;  2H0D A;  2LXH C;  2UZG A;  4UP5 A;  5TRB A;  2LGK A;  3SHB A;  2YU4 A;  3HCT A;  3ZYQ A;  4ZDT A;  2CKL A;  4O64 A;  4GNG A;  3N9O A;  1K2F A;  3RPG B;  4I7C A;  3QZV A;  2CT2 A;  2VPG A;  2M85 A;  5B8D A;  2M1R A;  4FJC A;  1U6G B;  4GNF A;  3T6R A;  1JOC A;  3ASL A;  2H0D B;  2L43 A;  2YSJ A;  4V3K C;  1VD4 A;  1X4J A;  2CKL B;  3N9N A;  4YAX A;  3U5P A;  4CA1 A;  4GB0 A;  1ZBD B;  2VJE A;  3O37 A;  4PPE A;  4YC9 A;  4ZUX U;  1WFK A;  1XWH A;  4FK5 A;  2F6J A;  3ZTG A;  4FO9 A;  4AYC A;  3SOW A;  5EYA F;  2L80 A;  4N4F A;  1JM7 A;  2JMI A;  5H1U A;  5H1T A;  2EOD A;  2VJE B;  5LKZ A;  2VJF A;  1DVP A;  5DKA A;  1WEO A;  4YBT A;  2KGI A;  1N87 A;  1X4I A;  4GND A;  3O7A A;  4AUQ B;  2CSY A;  4AYC B;  2QJ0 A;  5AIU A;  2F6N A;  3L11 A;  2K17 A;  2C2V S;  4A4B A;  1JM7 B;  3U5M A;  3HCU A;  3LRQ A;  4P5O B;  2LQ6 A;  2ZET C;  2RI7 A;  2M6M A;  5G05 B;  2L5U A;  4LLB A;  5C13 A;  4UI9 B;  2IDA A;  2LGL A;  2VPE A;  2VJF B;  4AP4 A;  2YQM A;  2YSM A;  3MHH A;  2YYR A;  4FIP A;  4WA6 A;  4YBS A;  5D1L B;  2ECG A;  5H1V A;  4I7D A;  3ZVZ B;  2YHN A;  3DQV R;  3L1X A;  4S3O B;  2Y43 A;  1Z2Q A;  5LKU A;  3SOU A;  3O34 A;  5LKT A;  1E4U A;  3LQH A;  4MVT A;  3RPG C;  3GV4 A;  2KWK A;  5D1K B;  1BOR A;  1WGM A;  4PTB A;  4BBQ A;  3N9L A;  4YAD A;  4N3W A;  2G45 A;  4LAD B;  5KH7 A;  1VYX A;  2XB1 A;  2YUR A;  2VPB A;  1MM3 A;  2ECW A;  4Q6F A;  3PUR A;  1LDK C;  5FER A;  3DPL R;  1WEN A;  2MA6 A;  4F52 B;  1T1H A;  2F42 A;  2MT5 A;  4V3L C;  5B75 A;  2Y1M A;  3EB6 A;  2ECV A;  4R2Y A;  3MHS A;  2MD8 C;  2FSA A;  2LXP C;  2MNY A;  5KH3 A;  5LCW B;  2I50 A;  1WEW A;  2HYE D;  2KU3 A;  1IYM A;  2BAY A;  3RTR B;  2KRE A;  3U5O A;  2ECT A;  1WES A;  4LKA A;  4C9Z A;  3HTK C;  4IC3 A;  2KWO A;  4LJN A;  3LQI A;  3C6W A;  5TDW A;  3ZPV 1;  2XEU A;  4R8P K;  3M63 A;  4BHW A;  3GL6 A;  2PUY A;  4NN2 A;  3KV6 A;  3L1Z B;  2LN0 A;  3ZPV E;  2CSZ A;  3NG2 A;  5B78 A;  2K1J A;  2KWN A;  1Z6U A;  5I3L A;  2E6S A;  1LDJ B;  3N9M A;  2LDR A;  3KNV A;  5J3X A;  3VK6 A;  2K4D A;  4AVX A;  4S3O C;  4ZQL A;  3EB5 A;  2QIZ A;  4XI1 A;  2M3H A;  2RSD A;  1WEV A;  5FB1 A;  2E6R A;  2VNF A;  2YHO A;  4I7B A;  5JG6 A;  2VP7 A;  4MSX A;  1WEM A;  2ECN A;  5KH9 A;  2C2L A;  2KYU A;  4YBM A;  2KE1 A;  2Y1N A;  2L75 A;  5FB0 A;  4GNE A;  2ECJ A;  5B76 A;  3M62 A;  2EA6 A;  2NAA A;  2YRE A;  5B77 A;  3I2D A;  3M99 A;  2LV9 A;  2D8S A;  1G25 A;  5TBN A;  3N9Q A;  5G04 B;  3PUQ A;  3O35 A;  5D1M B;  3O36 A;  2KWJ A;  1FP0 A;  4B7Y C;  2MIQ A;  4WZ2 A;  4L58 A;  5C11 A;  2LGV A;  5FEY A;  4A0C D;  3N9P A;  5H9M A;  2PNX A;  3T7L A;  4WZ0 A;  2ECI A;  2KIZ A;  2JMD A;  2YT5 A;  4X3G A;  3O70 A;  4UP0 A;  3LQJ A;  1Z60 A;  1V87 A;  3KV5 A;  1WE9 A;  2MA5 A;  3IHP A;  2MNZ A;  2K16 A;  1WEP A;  2YW8 A;  1HYJ A;  2FUU A;  2KGG A;  3O33 A;  5DIN A;  3V43 A;  4A49 A;  2G43 A;  1X4U A;  1WIL A;  2FUI A;  3KQI A;  1CHC A;  5LKX A;  4YAB A;  2AN6 A;  2KFT A;  2MD7 B;  2JRJ A;  2EGP A;  1FBV A;  2LGG A;  2G6Q A;  3FL2 A;  2LRI C;  2OXQ C;  2QIC A;  4L7X A;  4A4C A;  1WIM A;  4B86 C;  1F62 A;  5TDR A;  5TAB A;  4QF2 A;  2VPD A;  4QF3 A;  3U5N A;  4WZ3 B;  2KR4 A;  3HCS A;  2DX8 A;  2YUC A;  4TKP B;  1WEQ A;  1VFY A;  1RMD A;  3PHD A;  2MUM A;  4IC2 A;  2HDP A;  3C5K A;  2YQL A;  1WEE A;  4R7E A;  1WEU A;  5B79 A;  2JMJ A;  3ZNI A;  1MM2 A;  4YAT A;  5AIT A;  5G0F A;  3ZVY A;  4CCG X;  4LK9 A;  4W4U A;  3SOX A; 
#chains in the Genus database with same CATH topology
 1HYI A;  2L0B A;  2H0D A;  2LXH C;  2UZG A;  3PLW A;  4UP5 A;  5TRB A;  2LGK A;  3LDY A;  3SHB A;  2YU4 A;  3HCT A;  3ZYQ A;  4ZDT A;  2CKL A;  4O64 A;  4GNG A;  3N9O A;  1K2F A;  4Z0R A;  2XOZ A;  3RPG B;  4I7C A;  3QZV A;  2CT2 A;  2VPG A;  2M85 A;  5B8D A;  2M1R A;  2XOY A;  3O47 A;  4FJC A;  1U6G B;  4GNF A;  4O62 A;  3T6R A;  1JOC A;  3ASL A;  2H0D B;  2L43 A;  2YSJ A;  4V3K C;  1VD4 A;  1X4J A;  2CKL B;  3N9N A;  4YAX A;  3DWD A;  3U5P A;  4CA1 A;  4GB0 A;  1ZBD B;  2VJE A;  3O37 A;  4PPE A;  4YC9 A;  4ZUX U;  3LVQ E;  1WFK A;  1XWH A;  4FK5 A;  2F6J A;  3ZTG A;  2DSM A;  4FO9 A;  4AYC A;  3SOW A;  5EYA F;  2L80 A;  3MDB C;  4N4F A;  2D8U A;  1JM7 A;  2JMI A;  5H1U A;  5H1T A;  2EOD A;  2M13 A;  2VJE B;  5LKZ A;  2VJF A;  1DVP A;  5DKA A;  2FFW A;  1WEO A;  4YBT A;  2KGI A;  1N87 A;  1X4I A;  4GND A;  3O7A A;  4AUQ B;  2CSY A;  4AYC B;  2QJ0 A;  5AIU A;  2F6N A;  3L11 A;  2K17 A;  2C2V S;  4A4B A;  3Q1D A;  1JM7 B;  3U5M A;  3HCU A;  3KDE C;  3LRQ A;  4P5O B;  2LQ6 A;  2ZET C;  2RI7 A;  2YVR A;  2M6M A;  5G05 B;  2L5U A;  4LLB A;  5C13 A;  4UI9 B;  2IDA A;  2LGL A;  2VPE A;  2VJF B;  1DCQ A;  4AP4 A;  2YQM A;  2YSM A;  3MHH A;  2YYR A;  4FIP A;  4WA6 A;  4QQ4 A;  4YBS A;  5D1L B;  2ECG A;  5H1V A;  4I7D A;  3ZVZ B;  2YHN A;  3DQV R;  3L1X A;  4S3O B;  2Y43 A;  2XP0 A;  1Z2Q A;  5LKU A;  3SOU A;  3O34 A;  5LKT A;  1E4U A;  3LQH A;  4MVT A;  3RPG C;  3GV4 A;  2KWK A;  5D1K B;  1BOR A;  1WGM A;  4PTB A;  4BBQ A;  3N9L A;  2XOC A;  4YAD A;  4N3W A;  2G45 A;  4LAD B;  5KH7 A;  1VYX A;  2XB1 A;  2YUR A;  4OGC A;  2VPB A;  1MM3 A;  3JUE A;  2ECW A;  4Q6F A;  3PUR A;  1LDK C;  3T9K A;  5FER A;  3DPL R;  2CRR A;  1WEN A;  2MA6 A;  4F52 B;  1T1H A;  2F42 A;  2MT5 A;  4V3L C;  5B75 A;  2Y1M A;  3EB6 A;  2ECV A;  4R2Y A;  3MHS A;  2MD8 C;  2FSA A;  2LXP C;  2MKE A;  2MNY A;  5KH3 A;  2KKY A;  5LCW B;  2I50 A;  3H7H A;  1WEW A;  2HYE D;  2KU3 A;  3FEH A;  1IYM A;  2BAY A;  3RTR B;  2KRE A;  3U5O A;  2ECT A;  1WES A;  4LKA A;  4C9Z A;  3HTK C;  4IC3 A;  2KWO A;  4LJN A;  3LQI A;  3SUB A;  3C6W A;  5TDW A;  3ZPV 1;  2EGM A;  2XEU A;  4R8P K;  2FD4 A;  3LVR E;  3M63 A;  4BHW A;  3GL6 A;  2PUY A;  4NN2 A;  3KV6 A;  3L1Z B;  2LN0 A;  3ZPV E;  2CSZ A;  5SVI A;  2JM3 A;  3NG2 A;  2CRW A;  5B78 A;  2K1J A;  2KWN A;  1Z6U A;  5I3L A;  2E6S A;  1LDJ B;  2LAU A;  3N9M A;  2LDR A;  3KNV A;  5J3X A;  3VK6 A;  2K4D A;  4AVX A;  4S3O C;  4ZQL A;  3EB5 A;  4OGE A;  2QIZ A;  4XI1 A;  2M3H A;  2RSD A;  1WEV A;  5FB1 A;  2E6R A;  5SVI B;  2VNF A;  2YHO A;  3FM8 C;  4I7B A;  5JG6 A;  2VP7 A;  4MSX A;  1WEM A;  2ECN A;  5KH9 A;  2C2L A;  2KYU A;  3M7K A;  4YBM A;  2KE1 A;  2Y1N A;  2L75 A;  5FB0 A;  4GNE A;  2ECJ A;  4Z0O A;  5B76 A;  3M62 A;  2EA6 A;  2NAA A;  2YRE A;  5B77 A;  2DJA A;  3I2D A;  3M99 A;  2LV9 A;  2D8S A;  1G25 A;  5TBN A;  3N9Q A;  5G04 B;  3PUQ A;  3O35 A;  5D1M B;  3O36 A;  2KWJ A;  4F1P A;  1FP0 A;  4B7Y C;  2MIQ A;  4WZ2 A;  4L58 A;  5SVY A;  5C11 A;  2LGV A;  5FEY A;  4A0C D;  3N9P A;  5H9M A;  2PNX A;  3T7L A;  4WZ0 A;  2ECI A;  2KIZ A;  2JMD A;  2CON A;  2YT5 A;  4X3G A;  3O70 A;  2IQJ A;  4UP0 A;  3LQJ A;  1Z60 A;  1V87 A;  3KV5 A;  1WE9 A;  2MA5 A;  3IHP A;  2MNZ A;  2K16 A;  1WEP A;  2YW8 A;  3E2D A;  1HYJ A;  2EXU A;  2FUU A;  2JUN A;  2KGG A;  3O33 A;  5DIN A;  3V43 A;  4A49 A;  2G43 A;  1X4U A;  5K3Q A;  1WIL A;  2FUI A;  3DDT A;  5SVX A;  3KQI A;  1CHC A;  5LKX A;  4YAB A;  2AN6 A;  2KFT A;  2MD7 B;  2JRJ A;  2EGP A;  1FBV A;  2LGG A;  2G6Q A;  3FL2 A;  2LRI C;  2OWA A;  3FAO A;  2OXQ C;  2QIC A;  4L7X A;  2P57 A;  4A4C A;  2RR4 A;  1WIM A;  4B86 C;  1F62 A;  5TDR A;  5TAB A;  2CSV A;  4QF2 A;  2VPD A;  4QF3 A;  3U5N A;  4WZ3 B;  2KR4 A;  3HCS A;  2DX8 A;  3FJU B;  2YUC A;  4H9D A;  4TKP B;  2B0O E;  1WEQ A;  1VFY A;  1RMD A;  3PHD A;  2MUM A;  4IC2 A;  2HDP A;  2KKX A;  3C5K A;  2YQL A;  1WEE A;  4R7E A;  1WEU A;  5B79 A;  2JMJ A;  3LJU X;  2L7P A;  3ZNI A;  1MM2 A;  4YAT A;  5AIT A;  3FAN A;  5G0F A;  1MBM A;  3ZVY A;  4CCG X;  4LK9 A;  4W4U A;  3SOX A;  2E61 A; 
#chains in the Genus database with same CATH homology
 1HYI A;  2L0B A;  2H0D A;  2LXH C;  2UZG A;  4UP5 A;  5TRB A;  2LGK A;  3SHB A;  2YU4 A;  3HCT A;  3ZYQ A;  4ZDT A;  2CKL A;  4O64 A;  4GNG A;  3N9O A;  1K2F A;  3RPG B;  4I7C A;  3QZV A;  2CT2 A;  2VPG A;  2M85 A;  5B8D A;  2M1R A;  4FJC A;  1U6G B;  4GNF A;  3T6R A;  1JOC A;  3ASL A;  2H0D B;  2L43 A;  2YSJ A;  4V3K C;  1VD4 A;  1X4J A;  2CKL B;  3N9N A;  4YAX A;  3U5P A;  4CA1 A;  4GB0 A;  1ZBD B;  2VJE A;  3O37 A;  4PPE A;  4YC9 A;  4ZUX U;  1WFK A;  1XWH A;  4FK5 A;  2F6J A;  3ZTG A;  4FO9 A;  4AYC A;  3SOW A;  5EYA F;  2L80 A;  4N4F A;  1JM7 A;  2JMI A;  5H1U A;  5H1T A;  2EOD A;  2VJE B;  5LKZ A;  2VJF A;  1DVP A;  5DKA A;  1WEO A;  4YBT A;  2KGI A;  1N87 A;  1X4I A;  4GND A;  3O7A A;  4AUQ B;  2CSY A;  4AYC B;  2QJ0 A;  5AIU A;  2F6N A;  3L11 A;  2K17 A;  2C2V S;  4A4B A;  1JM7 B;  3U5M A;  3HCU A;  3LRQ A;  4P5O B;  2LQ6 A;  2ZET C;  2RI7 A;  2M6M A;  5G05 B;  2L5U A;  4LLB A;  5C13 A;  4UI9 B;  2IDA A;  2LGL A;  2VPE A;  2VJF B;  4AP4 A;  2YQM A;  2YSM A;  3MHH A;  2YYR A;  4FIP A;  4WA6 A;  4YBS A;  5D1L B;  2ECG A;  5H1V A;  4I7D A;  3ZVZ B;  2YHN A;  3DQV R;  3L1X A;  4S3O B;  2Y43 A;  1Z2Q A;  5LKU A;  3SOU A;  3O34 A;  5LKT A;  1E4U A;  3LQH A;  4MVT A;  3RPG C;  3GV4 A;  2KWK A;  5D1K B;  1BOR A;  1WGM A;  4PTB A;  4BBQ A;  3N9L A;  4YAD A;  4N3W A;  2G45 A;  4LAD B;  5KH7 A;  1VYX A;  2XB1 A;  2YUR A;  2VPB A;  1MM3 A;  2ECW A;  4Q6F A;  3PUR A;  1LDK C;  5FER A;  3DPL R;  1WEN A;  2MA6 A;  4F52 B;  1T1H A;  2F42 A;  2MT5 A;  4V3L C;  5B75 A;  2Y1M A;  3EB6 A;  2ECV A;  4R2Y A;  3MHS A;  2MD8 C;  2FSA A;  2LXP C;  2MNY A;  5KH3 A;  5LCW B;  2I50 A;  1WEW A;  2HYE D;  2KU3 A;  1IYM A;  2BAY A;  3RTR B;  2KRE A;  3U5O A;  2ECT A;  1WES A;  4LKA A;  4C9Z A;  3HTK C;  4IC3 A;  2KWO A;  4LJN A;  3LQI A;  3C6W A;  5TDW A;  3ZPV 1;  2XEU A;  4R8P K;  3M63 A;  4BHW A;  3GL6 A;  2PUY A;  4NN2 A;  3KV6 A;  3L1Z B;  2LN0 A;  3ZPV E;  2CSZ A;  3NG2 A;  5B78 A;  2K1J A;  2KWN A;  1Z6U A;  5I3L A;  2E6S A;  1LDJ B;  3N9M A;  2LDR A;  3KNV A;  5J3X A;  3VK6 A;  2K4D A;  4AVX A;  4S3O C;  4ZQL A;  3EB5 A;  2QIZ A;  4XI1 A;  2M3H A;  2RSD A;  1WEV A;  5FB1 A;  2E6R A;  2VNF A;  2YHO A;  4I7B A;  5JG6 A;  2VP7 A;  4MSX A;  1WEM A;  2ECN A;  5KH9 A;  2C2L A;  2KYU A;  4YBM A;  2KE1 A;  2Y1N A;  2L75 A;  5FB0 A;  4GNE A;  2ECJ A;  5B76 A;  3M62 A;  2EA6 A;  2NAA A;  2YRE A;  5B77 A;  3I2D A;  3M99 A;  2LV9 A;  2D8S A;  1G25 A;  5TBN A;  3N9Q A;  5G04 B;  3PUQ A;  3O35 A;  5D1M B;  3O36 A;  2KWJ A;  1FP0 A;  4B7Y C;  2MIQ A;  4WZ2 A;  4L58 A;  5C11 A;  2LGV A;  5FEY A;  4A0C D;  3N9P A;  5H9M A;  2PNX A;  3T7L A;  4WZ0 A;  2ECI A;  2KIZ A;  2JMD A;  2YT5 A;  4X3G A;  3O70 A;  4UP0 A;  3LQJ A;  1Z60 A;  1V87 A;  3KV5 A;  1WE9 A;  2MA5 A;  3IHP A;  2MNZ A;  2K16 A;  1WEP A;  2YW8 A;  1HYJ A;  2FUU A;  2KGG A;  3O33 A;  5DIN A;  3V43 A;  4A49 A;  2G43 A;  1X4U A;  1WIL A;  2FUI A;  3KQI A;  1CHC A;  5LKX A;  4YAB A;  2AN6 A;  2KFT A;  2MD7 B;  2JRJ A;  2EGP A;  1FBV A;  2LGG A;  2G6Q A;  3FL2 A;  2LRI C;  2OXQ C;  2QIC A;  4L7X A;  4A4C A;  1WIM A;  4B86 C;  1F62 A;  5TDR A;  5TAB A;  4QF2 A;  2VPD A;  4QF3 A;  3U5N A;  4WZ3 B;  2KR4 A;  3HCS A;  2DX8 A;  2YUC A;  4TKP B;  1WEQ A;  1VFY A;  1RMD A;  3PHD A;  2MUM A;  4IC2 A;  2HDP A;  3C5K A;  2YQL A;  1WEE A;  4R7E A;  1WEU A;  5B79 A;  2JMJ A;  3ZNI A;  1MM2 A;  4YAT A;  5AIT A;  5G0F A;  3ZVY A;  4CCG X;  4LK9 A;  4W4U A;  3SOX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...