5DINA

Structural basis for the indispensable role of a unique zinc finger motif in lnx2 ubiquitination
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
120
structure length
120
Chain Sequence
PLCFECGQQHWTRENHLYNYQNEVDDDLVCHICLQPLLQPLDTPCGHTFCYKCLRNFLQEKDFCPLDRKRLHFKLCKKSSILVHKLLDKLLVLCPFSSVCKDVMQRCDLEAHLKNRCPGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Ligand of Numb protein X 2
publication title Structural basis for the indispensable role of a unique zinc finger motif in LNX2 ubiquitination.
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature ec 6.3.2.19: Transferred entry: 2.3.2.23, 2.3.2.27 and 6.2.1.45.
pdb deposition date 2015-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5dinA00
1Z6UA 2YUCA 5B79A 4MSXA 4N3WA 1E4UA 4R8PK 5EYAF 4IC3A 2YQMA 2LGGA 3U5MA 2LXHC 4BHWA 4XI1A 2VPDA 1VFYA 2AN6A 2ECTA 3U5PA 3LRQA 2ZETC 2ECIA 2VJFA 2KE1A 2KWNA 2LV9A 3SHBA 5B77A 4YAXA 2CSZA 2Y1MA 5DINA 3VK6A 4B7YC 4YADA 4FJCA 1K2FA 2ECJA 2H0DA 3SOXA 2XEUA 3N9MA 4B86C 2ECGA 2G45A 3RTRB 3ZPVE 1G25A 2LGLA 2C2LA 2CSYA 1WEMA 3KQIA 4ZDTA 2EGPA 2FUUA 2VJFB 1WEVA 1WIMA 2HDPA 2M3HA 3LQHA 5TBNA 2KWOA 1WEOA 2H0DB 1WEWA 5KH3A 5B78A 2MA6A 2DX8A 3I2DA 2VPEA 1JM7A 1JOCA 4A4BA 2YHOA 1V87A 4WA6A 4GNGA 2KIZA 2ECWA 3N9NA 2L5UA 2JMDA 1HYIA 2MUMA 2NAAA 1MM3A 4AYCB 2FUIA 4Q6FA 4ZUXU 1X4IA 2F6NA 2CKLA 3NG2A 3IHPA 5AIUA 2OXQC 4AP4A 2YW8A 4GNDA 4UP5A 2C2VS 1JM7B 2G6QA 3ZPV1 5FEYA 4AUQB 2KGGA 3MHSA 1X4JA 2MD8C 3M63A 4GNEA 3SOUA 3DQVR 1VD4A 4YC9A 2YSMA 2MNZA 1WE9A 2Y43A 3N9QA 2LGVA 2IDAA 3O70A 2G43A 2LXPC 4X3GA 2L75A 3V43A 3HCUA 2YYRA 1X4UA 2VJEB 2PUYA 1Z60A 3SOWA 4C9ZA 1XWHA 5FB1A 3L1XA 3ZVYA 2MD7B 5TDWA 5G04B 5DKAA 2LRIC 2D8SA 4TKPB 3C5KA 1VYXA 3ZTGA 5B76A 1MM2A 2JMJA 3M99A 1T1HA 4YBSA 4YBTA 4BBQA 3M62A 1ZBDB 2QJ0A 1U6GB 2Y1NA 2LN0A 1WESA 5J3XA 4IC2A 5H9MA 4V3LC 5AITA 1N87A 2KYUA 3PUQA 4NN2A 2K16A 4QF3A 4A0CD 2VNFA 2K4DA 4MVTA 5B75A 4L7XA 2MT5A 5LKXA 3DPLR 1F62A 2YHNA 3ZYQA 1WGMA 5FB0A 3LQJA 2YREA 3ZVZB 3T6RA 3FL2A 3GV4A 4I7CA 4W4UA 5JG6A 1WEEA 3O7AA 4FK5A 4YATA 3N9OA 1FP0A 2KGIA 2YSJA 2KWKA 1WENA 4PPEA 2EODA 2L43A 2EA6A 2RI7A 2F42A 2XB1A 2LDRA 1HYJA 2UZGA 2KREA 3MHHA 4ZQLA 5LCWB 5KH9A 4YBMA 2K17A 2L0BA 1LDKC 3EB5A 2VPBA 2KR4A 5B8DA 4S3OB 1WFKA 2QIZA 4CCGX 4LLBA 4PTBA 2MA5A 4GB0A 5TDRA 1WEQA 4GNFA 2CKLB 2F6JA 3GL6A 2MIQA 5TRBA 1Z2QA 2E6RA 2JRJA 3PHDA 5TABA 3U5NA 4R2YA 2PNXA 3ASLA 3HCSA 3O35A 2RSDA 4CA1A 4R7EA 2MNYA 4FO9A 1RMDA 2BAYA 1BORA 5I3LA 5KH7A 2CT2A 2E6SA 2KU3A 3O33A 2L80A 3O37A 3N9LA 3RPGB 2M1RA 4WZ0A 2KWJA 3HTKC 5H1UA 2LGKA 4WZ3B 3T7LA 5D1KB 3PURA 2JMIA 3ZNIA 1DVPA 4YABA 5D1MB 1WEPA 2K1JA 2YQLA 4I7BA 4S3OC 5G05B 4UI9B 5LKZA 5H1VA 4QF2A 3C6WA 2FSAA 5FERA 4AYCA 2QICA 2HYED 2YT5A 4WZ2A 5G0FA 2M85A 5H1TA 4P5OB 4I7DA 4UP0A 4F52B 5LKUA 1FBVA 3L1ZB 2I50A 4LJNA 1WEUA 2YURA 5C13A 2LQ6A 4A4CA 3KV5A 3KV6A 3QZVA 3O36A 3LQIA 5LKTA 5C11A 2ECVA 3L11A 1IYMA 2ECNA 3HCTA 1CHCA 2VP7A 3N9PA 4FIPA 3RPGC 4AVXA 3EB6A 4LKAA 1LDJB 4V3KC 4LADB 2VJEA 4A49A 4O64A 4L58A 3U5OA 2YU4A 2KFTA 3O34A 2M6MA 5D1LB 3KNVA 4LK9A 2VPGA 4N4FA 1WILA
chains in the Genus database with same CATH superfamily
1Z6UA 2YUCA 5B79A 4MSXA 3KDEC 3LJUX 4N3WA 1E4UA 4R8PK 5EYAF 4IC3A 2YQMA 2LGGA 3U5MA 2LXHC 4BHWA 4XI1A 2VPDA 1VFYA 2AN6A 2ECTA 3U5PA 4OGEA 3LRQA 2ZETC 2ECIA 3FAOA 2VJFA 2KE1A 2KWNA 2LV9A 3SHBA 5B77A 4YAXA 2CSZA 2Y1MA 5DINA 3VK6A 4B7YC 4YADA 4FJCA 1K2FA 2ECJA 2H0DA 3SOXA 2XEUA 3N9MA 4B86C 2ECGA 2G45A 2FFWA 2CRRA 2XOZA 3RTRB 3ZPVE 1G25A 2LGLA 2LAUA 2C2LA 2CSYA 1WEMA 3DWDA 4Z0RA 3KQIA 4ZDTA 2EGPA 2FUUA 2IQJA 2VJFB 1WEVA 1WIMA 2HDPA 2D8UA 2M3HA 3LQHA 5TBNA 2KWOA 1WEOA 2H0DB 1WEWA 5KH3A 5B78A 2MA6A 2DX8A 3I2DA 2VPEA 1JM7A 2DJAA 1JOCA 4A4BA 2YHOA 1V87A 4WA6A 4GNGA 2KIZA 2ECWA 3N9NA 2L5UA 3O47A 2JMDA 1HYIA 2MUMA 2NAAA 5SVIA 5SVYA 1MM3A 4AYCB 2FUIA 4Q6FA 4ZUXU 2B0OE 1X4IA 2F6NA 2CKLA 3NG2A 3IHPA 5AIUA 2OXQC 2CONA 4AP4A 2YW8A 4GNDA 4UP5A 2C2VS 3FANA 1JM7B 4OGCA 2G6QA 3ZPV1 5FEYA 4AUQB 2KGGA 3MHSA 1X4JA 2MD8C 3M63A 2YVRA 4GNEA 3SOUA 3DQVR 1VD4A 4YC9A 2YSMA 4O62A 2MNZA 1WE9A 2Y43A 3N9QA 2LGVA 2IDAA 3O70A 2G43A 1MBMA 2LXPC 4X3GA 2L75A 3V43A 3HCUA 2YYRA 1X4UA 2VJEB 5K3QA 2PUYA 1Z60A 3SOWA 2M13A 4C9ZA 1XWHA 5FB1A 3L1XA 4QQ4A 3ZVYA 3LVRE 2MD7B 5TDWA 5G04B 5DKAA 2LRIC 2D8SA 4TKPB 3C5KA 1VYXA 3ZTGA 5B76A 1MM2A 2JMJA 2RR4A 3FM8C 3M99A 1T1HA 4YBSA 2JUNA 4YBTA 4BBQA 3M62A 1ZBDB 2QJ0A 1U6GB 2Y1NA 2LN0A 1WESA 5J3XA 4IC2A 5H9MA 4V3LC 5AITA 2KKYA 2OWAA 1N87A 2KYUA 3PUQA 4NN2A 2K16A 4QF3A 4A0CD 2VNFA 2K4DA 4MVTA 5B75A 4L7XA 2MT5A 2XP0A 3M7KA 5LKXA 3DPLR 1F62A 2YHNA 3ZYQA 1WGMA 2JM3A 5FB0A 3LQJA 2CSVA 2YREA 3ZVZB 3T6RA 3FL2A 3GV4A 4I7CA 4W4UA 5JG6A 1WEEA 3PLWA 3O7AA 4FK5A 4YATA 2EXUA 3N9OA 1FP0A 2KGIA 2YSJA 2KWKA 2L7PA 1WENA 4PPEA 2EODA 4F1PA 2L43A 2EA6A 2RI7A 2KKXA 2F42A 2CRWA 5SVXA 2XB1A 2LDRA 1HYJA 2UZGA 2KREA 3MHHA 4ZQLA 2FD4A 5LCWB 5KH9A 4YBMA 2K17A 2L0BA 1LDKC 3EB5A 3LDYA 2VPBA 2KR4A 5B8DA 4S3OB 1WFKA 2QIZA 4CCGX 5SVIB 4LLBA 3DDTA 4PTBA 2MA5A 3FJUB 4GB0A 2DSMA 2E61A 1WEQA 4GNFA 5TDRA 2CKLB 2F6JA 2MKEA 3GL6A 2MIQA 3SUBA 5TRBA 1Z2QA 2E6RA 2JRJA 3PHDA 5TABA 3U5NA 4R2YA 2PNXA 3ASLA 3HCSA 3O35A 2RSDA 4CA1A 4R7EA 4H9DA 2MNYA 4FO9A 1RMDA 2BAYA 1BORA 5I3LA 5KH7A 2CT2A 2E6SA 2KU3A 3O33A 2L80A 3O37A 3N9LA 3RPGB 2M1RA 4WZ0A 2KWJA 3HTKC 5H1UA 2LGKA 4WZ3B 2P57A 3T7LA 5D1KB 2EGMA 3PURA 2JMIA 3ZNIA 1DVPA 4YABA 5D1MB 3H7HA 1WEPA 2K1JA 3MDBC 2YQLA 4I7BA 4S3OC 5G05B 4UI9B 3T9KA 5LKZA 5H1VA 4QF2A 3C6WA 2FSAA 5FERA 4AYCA 2QICA 2HYED 2YT5A 4WZ2A 5G0FA 2M85A 5H1TA 4P5OB 4I7DA 4UP0A 4F52B 5LKUA 1FBVA 3L1ZB 2I50A 3LVQE 4LJNA 1WEUA 2YURA 5C13A 2LQ6A 4A4CA 3KV5A 3KV6A 3QZVA 1DCQA 2XOYA 3O36A 3LQIA 5LKTA 5C11A 2ECVA 3L11A 1IYMA 2ECNA 3HCTA 3FEHA 3E2DA 3Q1DA 1CHCA 2VP7A 3N9PA 4FIPA 3RPGC 4AVXA 3EB6A 4LKAA 1LDJB 4V3KC 4LADB 2VJEA 4A49A 4O64A 4L58A 3U5OA 2YU4A 2KFTA 3JUEA 3O34A 2M6MA 5D1LB 4Z0OA 2XOCA 3KNVA 4LK9A 2VPGA 4N4FA 1WILA
chains in the Genus database with same CATH topology
1Z6UA 2YUCA 5B79A 4MSXA 4N3WA 1E4UA 4R8PK 5EYAF 4IC3A 2YQMA 2LGGA 3U5MA 2LXHC 4BHWA 4XI1A 2VPDA 1VFYA 2AN6A 2ECTA 3U5PA 3LRQA 2ZETC 2ECIA 2VJFA 2KE1A 2KWNA 2LV9A 3SHBA 5B77A 4YAXA 2CSZA 2Y1MA 5DINA 3VK6A 4B7YC 4YADA 4FJCA 1K2FA 2ECJA 2H0DA 3SOXA 2XEUA 3N9MA 4B86C 2ECGA 2G45A 3RTRB 3ZPVE 1G25A 2LGLA 2C2LA 2CSYA 1WEMA 3KQIA 4ZDTA 2EGPA 2FUUA 2VJFB 1WEVA 1WIMA 2HDPA 2M3HA 3LQHA 5TBNA 2KWOA 1WEOA 2H0DB 1WEWA 5KH3A 5B78A 2MA6A 2DX8A 3I2DA 2VPEA 1JM7A 1JOCA 4A4BA 2YHOA 1V87A 4WA6A 4GNGA 2KIZA 2ECWA 3N9NA 2L5UA 2JMDA 1HYIA 2MUMA 2NAAA 1MM3A 4AYCB 2FUIA 4Q6FA 4ZUXU 1X4IA 2F6NA 2CKLA 3NG2A 3IHPA 5AIUA 2OXQC 4AP4A 2YW8A 4GNDA 4UP5A 2C2VS 1JM7B 2G6QA 3ZPV1 5FEYA 4AUQB 2KGGA 3MHSA 1X4JA 2MD8C 3M63A 4GNEA 3SOUA 3DQVR 1VD4A 4YC9A 2YSMA 2MNZA 1WE9A 2Y43A 3N9QA 2LGVA 2IDAA 3O70A 2G43A 2LXPC 4X3GA 2L75A 3V43A 3HCUA 2YYRA 1X4UA 2VJEB 2PUYA 1Z60A 3SOWA 4C9ZA 1XWHA 5FB1A 3L1XA 3ZVYA 2MD7B 5TDWA 5G04B 5DKAA 2LRIC 2D8SA 4TKPB 3C5KA 1VYXA 3ZTGA 5B76A 1MM2A 2JMJA 3M99A 1T1HA 4YBSA 4YBTA 4BBQA 3M62A 1ZBDB 2QJ0A 1U6GB 2Y1NA 2LN0A 1WESA 5J3XA 4IC2A 5H9MA 4V3LC 5AITA 1N87A 2KYUA 3PUQA 4NN2A 2K16A 4QF3A 4A0CD 2VNFA 2K4DA 4MVTA 5B75A 4L7XA 2MT5A 5LKXA 3DPLR 1F62A 2YHNA 3ZYQA 1WGMA 5FB0A 3LQJA 2YREA 3ZVZB 3T6RA 3FL2A 3GV4A 4I7CA 4W4UA 5JG6A 1WEEA 3O7AA 4FK5A 4YATA 3N9OA 1FP0A 2KGIA 2YSJA 2KWKA 1WENA 4PPEA 2EODA 2L43A 2EA6A 2RI7A 2F42A 2XB1A 2LDRA 1HYJA 2UZGA 2KREA 3MHHA 4ZQLA 5LCWB 5KH9A 4YBMA 2K17A 2L0BA 1LDKC 3EB5A 2VPBA 2KR4A 5B8DA 4S3OB 1WFKA 2QIZA 4CCGX 4LLBA 4PTBA 2MA5A 4GB0A 5TDRA 1WEQA 4GNFA 2CKLB 2F6JA 3GL6A 2MIQA 5TRBA 1Z2QA 2E6RA 2JRJA 3PHDA 5TABA 3U5NA 4R2YA 2PNXA 3ASLA 3HCSA 3O35A 2RSDA 4CA1A 4R7EA 2MNYA 4FO9A 1RMDA 2BAYA 1BORA 5I3LA 5KH7A 2CT2A 2E6SA 2KU3A 3O33A 2L80A 3O37A 3N9LA 3RPGB 2M1RA 4WZ0A 2KWJA 3HTKC 5H1UA 2LGKA 4WZ3B 3T7LA 5D1KB 3PURA 2JMIA 3ZNIA 1DVPA 4YABA 5D1MB 1WEPA 2K1JA 2YQLA 4I7BA 4S3OC 5G05B 4UI9B 5LKZA 5H1VA 4QF2A 3C6WA 2FSAA 5FERA 4AYCA 2QICA 2HYED 2YT5A 4WZ2A 5G0FA 2M85A 5H1TA 4P5OB 4I7DA 4UP0A 4F52B 5LKUA 1FBVA 3L1ZB 2I50A 4LJNA 1WEUA 2YURA 5C13A 2LQ6A 4A4CA 3KV5A 3KV6A 3QZVA 3O36A 3LQIA 5LKTA 5C11A 2ECVA 3L11A 1IYMA 2ECNA 3HCTA 1CHCA 2VP7A 3N9PA 4FIPA 3RPGC 4AVXA 3EB6A 4LKAA 1LDJB 4V3KC 4LADB 2VJEA 4A49A 4O64A 4L58A 3U5OA 2YU4A 2KFTA 3O34A 2M6MA 5D1LB 3KNVA 4LK9A 2VPGA 4N4FA 1WILA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z6U A;  2YUC A;  5B79 A;  4MSX A;  4N3W A;  1E4U A;  4R8P K;  5EYA F;  4IC3 A;  2YQM A;  2LGG A;  3U5M A;  2LXH C;  4BHW A;  4XI1 A;  2VPD A;  1VFY A;  2AN6 A;  2ECT A;  3U5P A;  3LRQ A;  2ZET C;  2ECI A;  2VJF A;  2KE1 A;  2KWN A;  2LV9 A;  3SHB A;  5B77 A;  4YAX A;  2CSZ A;  2Y1M A;  5DIN A;  3VK6 A;  4B7Y C;  4YAD A;  4FJC A;  1K2F A;  2ECJ A;  2H0D A;  3SOX A;  2XEU A;  3N9M A;  4B86 C;  2ECG A;  2G45 A;  3RTR B;  3ZPV E;  1G25 A;  2LGL A;  2C2L A;  2CSY A;  1WEM A;  3KQI A;  4ZDT A;  2EGP A;  2FUU A;  2VJF B;  1WEV A;  1WIM A;  2HDP A;  2M3H A;  3LQH A;  5TBN A;  2KWO A;  1WEO A;  2H0D B;  1WEW A;  5KH3 A;  5B78 A;  2MA6 A;  2DX8 A;  3I2D A;  2VPE A;  1JM7 A;  1JOC A;  4A4B A;  2YHO A;  1V87 A;  4WA6 A;  4GNG A;  2KIZ A;  2ECW A;  3N9N A;  2L5U A;  2JMD A;  1HYI A;  2MUM A;  2NAA A;  1MM3 A;  4AYC B;  2FUI A;  4Q6F A;  4ZUX U;  1X4I A;  2F6N A;  2CKL A;  3NG2 A;  3IHP A;  5AIU A;  2OXQ C;  4AP4 A;  2YW8 A;  4GND A;  4UP5 A;  2C2V S;  1JM7 B;  2G6Q A;  3ZPV 1;  5FEY A;  4AUQ B;  2KGG A;  3MHS A;  1X4J A;  2MD8 C;  3M63 A;  4GNE A;  3SOU A;  3DQV R;  1VD4 A;  4YC9 A;  2YSM A;  2MNZ A;  1WE9 A;  2Y43 A;  3N9Q A;  2LGV A;  2IDA A;  3O70 A;  2G43 A;  2LXP C;  4X3G A;  2L75 A;  3V43 A;  3HCU A;  2YYR A;  1X4U A;  2VJE B;  2PUY A;  1Z60 A;  3SOW A;  4C9Z A;  1XWH A;  5FB1 A;  3L1X A;  3ZVY A;  2MD7 B;  5TDW A;  5G04 B;  5DKA A;  2LRI C;  2D8S A;  4TKP B;  3C5K A;  1VYX A;  3ZTG A;  5B76 A;  1MM2 A;  2JMJ A;  3M99 A;  1T1H A;  4YBS A;  4YBT A;  4BBQ A;  3M62 A;  1ZBD B;  2QJ0 A;  1U6G B;  2Y1N A;  2LN0 A;  1WES A;  5J3X A;  4IC2 A;  5H9M A;  4V3L C;  5AIT A;  1N87 A;  2KYU A;  3PUQ A;  4NN2 A;  2K16 A;  4QF3 A;  4A0C D;  2VNF A;  2K4D A;  4MVT A;  5B75 A;  4L7X A;  2MT5 A;  5LKX A;  3DPL R;  1F62 A;  2YHN A;  3ZYQ A;  1WGM A;  5FB0 A;  3LQJ A;  2YRE A;  3ZVZ B;  3T6R A;  3FL2 A;  3GV4 A;  4I7C A;  4W4U A;  5JG6 A;  1WEE A;  3O7A A;  4FK5 A;  4YAT A;  3N9O A;  1FP0 A;  2KGI A;  2YSJ A;  2KWK A;  1WEN A;  4PPE A;  2EOD A;  2L43 A;  2EA6 A;  2RI7 A;  2F42 A;  2XB1 A;  2LDR A;  1HYJ A;  2UZG A;  2KRE A;  3MHH A;  4ZQL A;  5LCW B;  5KH9 A;  4YBM A;  2K17 A;  2L0B A;  1LDK C;  3EB5 A;  2VPB A;  2KR4 A;  5B8D A;  4S3O B;  1WFK A;  2QIZ A;  4CCG X;  4LLB A;  4PTB A;  2MA5 A;  4GB0 A;  5TDR A;  1WEQ A;  4GNF A;  2CKL B;  2F6J A;  3GL6 A;  2MIQ A;  5TRB A;  1Z2Q A;  2E6R A;  2JRJ A;  3PHD A;  5TAB A;  3U5N A;  4R2Y A;  2PNX A;  3ASL A;  3HCS A;  3O35 A;  2RSD A;  4CA1 A;  4R7E A;  2MNY A;  4FO9 A;  1RMD A;  2BAY A;  1BOR A;  5I3L A;  5KH7 A;  2CT2 A;  2E6S A;  2KU3 A;  3O33 A;  2L80 A;  3O37 A;  3N9L A;  3RPG B;  2M1R A;  4WZ0 A;  2KWJ A;  3HTK C;  5H1U A;  2LGK A;  4WZ3 B;  3T7L A;  5D1K B;  3PUR A;  2JMI A;  3ZNI A;  1DVP A;  4YAB A;  5D1M B;  1WEP A;  2K1J A;  2YQL A;  4I7B A;  4S3O C;  5G05 B;  4UI9 B;  5LKZ A;  5H1V A;  4QF2 A;  3C6W A;  2FSA A;  5FER A;  4AYC A;  2QIC A;  2HYE D;  2YT5 A;  4WZ2 A;  5G0F A;  2M85 A;  5H1T A;  4P5O B;  4I7D A;  4UP0 A;  4F52 B;  5LKU A;  1FBV A;  3L1Z B;  2I50 A;  4LJN A;  1WEU A;  2YUR A;  5C13 A;  2LQ6 A;  4A4C A;  3KV5 A;  3KV6 A;  3QZV A;  3O36 A;  3LQI A;  5LKT A;  5C11 A;  2ECV A;  3L11 A;  1IYM A;  2ECN A;  3HCT A;  1CHC A;  2VP7 A;  3N9P A;  4FIP A;  3RPG C;  4AVX A;  3EB6 A;  4LKA A;  1LDJ B;  4V3K C;  4LAD B;  2VJE A;  4A49 A;  4O64 A;  4L58 A;  3U5O A;  2YU4 A;  2KFT A;  3O34 A;  2M6M A;  5D1L B;  3KNV A;  4LK9 A;  2VPG A;  4N4F A;  1WIL A; 
#chains in the Genus database with same CATH topology
 1Z6U A;  2YUC A;  5B79 A;  4MSX A;  3KDE C;  3LJU X;  4N3W A;  1E4U A;  4R8P K;  5EYA F;  4IC3 A;  2YQM A;  2LGG A;  3U5M A;  2LXH C;  4BHW A;  4XI1 A;  2VPD A;  1VFY A;  2AN6 A;  2ECT A;  3U5P A;  4OGE A;  3LRQ A;  2ZET C;  2ECI A;  3FAO A;  2VJF A;  2KE1 A;  2KWN A;  2LV9 A;  3SHB A;  5B77 A;  4YAX A;  2CSZ A;  2Y1M A;  5DIN A;  3VK6 A;  4B7Y C;  4YAD A;  4FJC A;  1K2F A;  2ECJ A;  2H0D A;  3SOX A;  2XEU A;  3N9M A;  4B86 C;  2ECG A;  2G45 A;  2FFW A;  2CRR A;  2XOZ A;  3RTR B;  3ZPV E;  1G25 A;  2LGL A;  2LAU A;  2C2L A;  2CSY A;  1WEM A;  3DWD A;  4Z0R A;  3KQI A;  4ZDT A;  2EGP A;  2FUU A;  2IQJ A;  2VJF B;  1WEV A;  1WIM A;  2HDP A;  2D8U A;  2M3H A;  3LQH A;  5TBN A;  2KWO A;  1WEO A;  2H0D B;  1WEW A;  5KH3 A;  5B78 A;  2MA6 A;  2DX8 A;  3I2D A;  2VPE A;  1JM7 A;  2DJA A;  1JOC A;  4A4B A;  2YHO A;  1V87 A;  4WA6 A;  4GNG A;  2KIZ A;  2ECW A;  3N9N A;  2L5U A;  3O47 A;  2JMD A;  1HYI A;  2MUM A;  2NAA A;  5SVI A;  5SVY A;  1MM3 A;  4AYC B;  2FUI A;  4Q6F A;  4ZUX U;  2B0O E;  1X4I A;  2F6N A;  2CKL A;  3NG2 A;  3IHP A;  5AIU A;  2OXQ C;  2CON A;  4AP4 A;  2YW8 A;  4GND A;  4UP5 A;  2C2V S;  3FAN A;  1JM7 B;  4OGC A;  2G6Q A;  3ZPV 1;  5FEY A;  4AUQ B;  2KGG A;  3MHS A;  1X4J A;  2MD8 C;  3M63 A;  2YVR A;  4GNE A;  3SOU A;  3DQV R;  1VD4 A;  4YC9 A;  2YSM A;  4O62 A;  2MNZ A;  1WE9 A;  2Y43 A;  3N9Q A;  2LGV A;  2IDA A;  3O70 A;  2G43 A;  1MBM A;  2LXP C;  4X3G A;  2L75 A;  3V43 A;  3HCU A;  2YYR A;  1X4U A;  2VJE B;  5K3Q A;  2PUY A;  1Z60 A;  3SOW A;  2M13 A;  4C9Z A;  1XWH A;  5FB1 A;  3L1X A;  4QQ4 A;  3ZVY A;  3LVR E;  2MD7 B;  5TDW A;  5G04 B;  5DKA A;  2LRI C;  2D8S A;  4TKP B;  3C5K A;  1VYX A;  3ZTG A;  5B76 A;  1MM2 A;  2JMJ A;  2RR4 A;  3FM8 C;  3M99 A;  1T1H A;  4YBS A;  2JUN A;  4YBT A;  4BBQ A;  3M62 A;  1ZBD B;  2QJ0 A;  1U6G B;  2Y1N A;  2LN0 A;  1WES A;  5J3X A;  4IC2 A;  5H9M A;  4V3L C;  5AIT A;  2KKY A;  2OWA A;  1N87 A;  2KYU A;  3PUQ A;  4NN2 A;  2K16 A;  4QF3 A;  4A0C D;  2VNF A;  2K4D A;  4MVT A;  5B75 A;  4L7X A;  2MT5 A;  2XP0 A;  3M7K A;  5LKX A;  3DPL R;  1F62 A;  2YHN A;  3ZYQ A;  1WGM A;  2JM3 A;  5FB0 A;  3LQJ A;  2CSV A;  2YRE A;  3ZVZ B;  3T6R A;  3FL2 A;  3GV4 A;  4I7C A;  4W4U A;  5JG6 A;  1WEE A;  3PLW A;  3O7A A;  4FK5 A;  4YAT A;  2EXU A;  3N9O A;  1FP0 A;  2KGI A;  2YSJ A;  2KWK A;  2L7P A;  1WEN A;  4PPE A;  2EOD A;  4F1P A;  2L43 A;  2EA6 A;  2RI7 A;  2KKX A;  2F42 A;  2CRW A;  5SVX A;  2XB1 A;  2LDR A;  1HYJ A;  2UZG A;  2KRE A;  3MHH A;  4ZQL A;  2FD4 A;  5LCW B;  5KH9 A;  4YBM A;  2K17 A;  2L0B A;  1LDK C;  3EB5 A;  3LDY A;  2VPB A;  2KR4 A;  5B8D A;  4S3O B;  1WFK A;  2QIZ A;  4CCG X;  5SVI B;  4LLB A;  3DDT A;  4PTB A;  2MA5 A;  3FJU B;  4GB0 A;  2DSM A;  2E61 A;  1WEQ A;  4GNF A;  5TDR A;  2CKL B;  2F6J A;  2MKE A;  3GL6 A;  2MIQ A;  3SUB A;  5TRB A;  1Z2Q A;  2E6R A;  2JRJ A;  3PHD A;  5TAB A;  3U5N A;  4R2Y A;  2PNX A;  3ASL A;  3HCS A;  3O35 A;  2RSD A;  4CA1 A;  4R7E A;  4H9D A;  2MNY A;  4FO9 A;  1RMD A;  2BAY A;  1BOR A;  5I3L A;  5KH7 A;  2CT2 A;  2E6S A;  2KU3 A;  3O33 A;  2L80 A;  3O37 A;  3N9L A;  3RPG B;  2M1R A;  4WZ0 A;  2KWJ A;  3HTK C;  5H1U A;  2LGK A;  4WZ3 B;  2P57 A;  3T7L A;  5D1K B;  2EGM A;  3PUR A;  2JMI A;  3ZNI A;  1DVP A;  4YAB A;  5D1M B;  3H7H A;  1WEP A;  2K1J A;  3MDB C;  2YQL A;  4I7B A;  4S3O C;  5G05 B;  4UI9 B;  3T9K A;  5LKZ A;  5H1V A;  4QF2 A;  3C6W A;  2FSA A;  5FER A;  4AYC A;  2QIC A;  2HYE D;  2YT5 A;  4WZ2 A;  5G0F A;  2M85 A;  5H1T A;  4P5O B;  4I7D A;  4UP0 A;  4F52 B;  5LKU A;  1FBV A;  3L1Z B;  2I50 A;  3LVQ E;  4LJN A;  1WEU A;  2YUR A;  5C13 A;  2LQ6 A;  4A4C A;  3KV5 A;  3KV6 A;  3QZV A;  1DCQ A;  2XOY A;  3O36 A;  3LQI A;  5LKT A;  5C11 A;  2ECV A;  3L11 A;  1IYM A;  2ECN A;  3HCT A;  3FEH A;  3E2D A;  3Q1D A;  1CHC A;  2VP7 A;  3N9P A;  4FIP A;  3RPG C;  4AVX A;  3EB6 A;  4LKA A;  1LDJ B;  4V3K C;  4LAD B;  2VJE A;  4A49 A;  4O64 A;  4L58 A;  3U5O A;  2YU4 A;  2KFT A;  3JUE A;  3O34 A;  2M6M A;  5D1L B;  4Z0O A;  2XOC A;  3KNV A;  4LK9 A;  2VPG A;  4N4F A;  1WIL A; 
#chains in the Genus database with same CATH homology
 1Z6U A;  2YUC A;  5B79 A;  4MSX A;  4N3W A;  1E4U A;  4R8P K;  5EYA F;  4IC3 A;  2YQM A;  2LGG A;  3U5M A;  2LXH C;  4BHW A;  4XI1 A;  2VPD A;  1VFY A;  2AN6 A;  2ECT A;  3U5P A;  3LRQ A;  2ZET C;  2ECI A;  2VJF A;  2KE1 A;  2KWN A;  2LV9 A;  3SHB A;  5B77 A;  4YAX A;  2CSZ A;  2Y1M A;  5DIN A;  3VK6 A;  4B7Y C;  4YAD A;  4FJC A;  1K2F A;  2ECJ A;  2H0D A;  3SOX A;  2XEU A;  3N9M A;  4B86 C;  2ECG A;  2G45 A;  3RTR B;  3ZPV E;  1G25 A;  2LGL A;  2C2L A;  2CSY A;  1WEM A;  3KQI A;  4ZDT A;  2EGP A;  2FUU A;  2VJF B;  1WEV A;  1WIM A;  2HDP A;  2M3H A;  3LQH A;  5TBN A;  2KWO A;  1WEO A;  2H0D B;  1WEW A;  5KH3 A;  5B78 A;  2MA6 A;  2DX8 A;  3I2D A;  2VPE A;  1JM7 A;  1JOC A;  4A4B A;  2YHO A;  1V87 A;  4WA6 A;  4GNG A;  2KIZ A;  2ECW A;  3N9N A;  2L5U A;  2JMD A;  1HYI A;  2MUM A;  2NAA A;  1MM3 A;  4AYC B;  2FUI A;  4Q6F A;  4ZUX U;  1X4I A;  2F6N A;  2CKL A;  3NG2 A;  3IHP A;  5AIU A;  2OXQ C;  4AP4 A;  2YW8 A;  4GND A;  4UP5 A;  2C2V S;  1JM7 B;  2G6Q A;  3ZPV 1;  5FEY A;  4AUQ B;  2KGG A;  3MHS A;  1X4J A;  2MD8 C;  3M63 A;  4GNE A;  3SOU A;  3DQV R;  1VD4 A;  4YC9 A;  2YSM A;  2MNZ A;  1WE9 A;  2Y43 A;  3N9Q A;  2LGV A;  2IDA A;  3O70 A;  2G43 A;  2LXP C;  4X3G A;  2L75 A;  3V43 A;  3HCU A;  2YYR A;  1X4U A;  2VJE B;  2PUY A;  1Z60 A;  3SOW A;  4C9Z A;  1XWH A;  5FB1 A;  3L1X A;  3ZVY A;  2MD7 B;  5TDW A;  5G04 B;  5DKA A;  2LRI C;  2D8S A;  4TKP B;  3C5K A;  1VYX A;  3ZTG A;  5B76 A;  1MM2 A;  2JMJ A;  3M99 A;  1T1H A;  4YBS A;  4YBT A;  4BBQ A;  3M62 A;  1ZBD B;  2QJ0 A;  1U6G B;  2Y1N A;  2LN0 A;  1WES A;  5J3X A;  4IC2 A;  5H9M A;  4V3L C;  5AIT A;  1N87 A;  2KYU A;  3PUQ A;  4NN2 A;  2K16 A;  4QF3 A;  4A0C D;  2VNF A;  2K4D A;  4MVT A;  5B75 A;  4L7X A;  2MT5 A;  5LKX A;  3DPL R;  1F62 A;  2YHN A;  3ZYQ A;  1WGM A;  5FB0 A;  3LQJ A;  2YRE A;  3ZVZ B;  3T6R A;  3FL2 A;  3GV4 A;  4I7C A;  4W4U A;  5JG6 A;  1WEE A;  3O7A A;  4FK5 A;  4YAT A;  3N9O A;  1FP0 A;  2KGI A;  2YSJ A;  2KWK A;  1WEN A;  4PPE A;  2EOD A;  2L43 A;  2EA6 A;  2RI7 A;  2F42 A;  2XB1 A;  2LDR A;  1HYJ A;  2UZG A;  2KRE A;  3MHH A;  4ZQL A;  5LCW B;  5KH9 A;  4YBM A;  2K17 A;  2L0B A;  1LDK C;  3EB5 A;  2VPB A;  2KR4 A;  5B8D A;  4S3O B;  1WFK A;  2QIZ A;  4CCG X;  4LLB A;  4PTB A;  2MA5 A;  4GB0 A;  5TDR A;  1WEQ A;  4GNF A;  2CKL B;  2F6J A;  3GL6 A;  2MIQ A;  5TRB A;  1Z2Q A;  2E6R A;  2JRJ A;  3PHD A;  5TAB A;  3U5N A;  4R2Y A;  2PNX A;  3ASL A;  3HCS A;  3O35 A;  2RSD A;  4CA1 A;  4R7E A;  2MNY A;  4FO9 A;  1RMD A;  2BAY A;  1BOR A;  5I3L A;  5KH7 A;  2CT2 A;  2E6S A;  2KU3 A;  3O33 A;  2L80 A;  3O37 A;  3N9L A;  3RPG B;  2M1R A;  4WZ0 A;  2KWJ A;  3HTK C;  5H1U A;  2LGK A;  4WZ3 B;  3T7L A;  5D1K B;  3PUR A;  2JMI A;  3ZNI A;  1DVP A;  4YAB A;  5D1M B;  1WEP A;  2K1J A;  2YQL A;  4I7B A;  4S3O C;  5G05 B;  4UI9 B;  5LKZ A;  5H1V A;  4QF2 A;  3C6W A;  2FSA A;  5FER A;  4AYC A;  2QIC A;  2HYE D;  2YT5 A;  4WZ2 A;  5G0F A;  2M85 A;  5H1T A;  4P5O B;  4I7D A;  4UP0 A;  4F52 B;  5LKU A;  1FBV A;  3L1Z B;  2I50 A;  4LJN A;  1WEU A;  2YUR A;  5C13 A;  2LQ6 A;  4A4C A;  3KV5 A;  3KV6 A;  3QZV A;  3O36 A;  3LQI A;  5LKT A;  5C11 A;  2ECV A;  3L11 A;  1IYM A;  2ECN A;  3HCT A;  1CHC A;  2VP7 A;  3N9P A;  4FIP A;  3RPG C;  4AVX A;  3EB6 A;  4LKA A;  1LDJ B;  4V3K C;  4LAD B;  2VJE A;  4A49 A;  4O64 A;  4L58 A;  3U5O A;  2YU4 A;  2KFT A;  3O34 A;  2M6M A;  5D1L B;  3KNV A;  4LK9 A;  2VPG A;  4N4F A;  1WIL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...