5DINA

Structural basis for the indispensable role of a unique zinc finger motif in lnx2 ubiquitination
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
120
structure length
120
Chain Sequence
PLCFECGQQHWTRENHLYNYQNEVDDDLVCHICLQPLLQPLDTPCGHTFCYKCLRNFLQEKDFCPLDRKRLHFKLCKKSSILVHKLLDKLLVLCPFSSVCKDVMQRCDLEAHLKNRCPGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the indispensable role of a unique zinc finger motif in LNX2 ubiquitination.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Ligand of Numb protein X 2
total genus 25
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature ec 6.3.2.19: Transferred entry: 2.3.2.23, 2.3.2.27 and 6.2.1.45.
pdb deposition date 2015-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5dinA00
2EA6A 4GNEA 3NG2A 2EODA 4IC3A 2L0BA 2YHNA 5H1TA 2LN0A 4WZ0A 3O35A 4YBSA 2JMJA 2KWOA 1WEMA 4I7CA 5J3XA 2PNXA 3N9NA 4BBQA 4CA1A 2NAAA 5AITA 2YURA 2RI7A 3O70A 1HYIA 2HDPA 4GB0A 3N9MA 4YABA 3PUQA 4YAXA 3DQVR 3C5KA 2VJEA 5H9MA 2KU3A 2ECJA 1IYMA 2L80A 5G04B 3O34A 2RSDA 2BAYA 2IDAA 5D1LB 4A4BA 4GNFA 2XB1A 2ECVA 4FIPA 5B78A 5TABA 5DKAA 3HCUA 3V43A 2Y1NA 1BORA 1WEUA 2YQLA 2D8SA 5H1VA 2CT2A 4WZ2A 2KWKA 3FL2A 2EGPA 4ZDTA 1RMDA 1Z2QA 2VPDA 4V3LC 3HCSA 2VJEB 5I3LA 1K2FA 2AN6A 4NN2A 3I2DA 1WEPA 4A4CA 3L1XA 3PURA 1Z60A 4F52B 5D1KB 2VP7A 2VPGA 1LDKC 3M99A 1WILA 4FK5A 2L5UA 4LADB 4I7DA 2M85A 4QF2A 2YT5A 5LCWB 5KH9A 4Q6FA 3LQIA 1U6GB 2YU4A 3ZVYA 5B8DA 2H0DA 1G25A 2G45A 3LQHA 4GNGA 2LV9A 5D1MB 3KV5A 3RTRB 2H0DB 2K1JA 2LGVA 2JRJA 5KH3A 2KGGA 2MNYA 4IC2A 4LKAA 3N9QA 4R2YA 4LK9A 3O37A 4LLBA 3O7AA 2CSZA 2I50A 2QJ0A 3ZPVE 3N9OA 4UI9B 2VNFA 2ZETC 2E6SA 5FEYA 3U5MA 5G05B 2KR4A 4A0CD 2F42A 4MSXA 1FBVA 1HYJA 2K16A 2MNZA 5DINA 2MD8C 3ASLA 3GV4A 5LKUA 1DVPA 2YSMA 5TDRA 1N87A 5FERA 2ECTA 5FB0A 1WEVA 3ZTGA 2G6QA 2ECIA 2C2VS 2K17A 2QIZA 4S3OC 3SOXA 1WENA 4L7XA 2E6RA 1T1HA 1X4UA 1VYXA 2QICA 2HYED 4R7EA 1MM3A 2ECGA 2LDRA 2MA6A 2VJFB 2ECWA 4ZUXU 2VJFA 3HCTA 3KV6A 4UP0A 1LDJB 3O36A 4AYCB 2LQ6A 1MM2A 2UZGA 3HTKC 3IHPA 2KYUA 3LRQA 4R8PK 5EYAF 5LKZA 1JM7A 2F6NA 2VPEA 2F6JA 4O64A 2FUUA 3U5NA 1V87A 2KGIA 4N3WA 2JMIA 4QF3A 1F62A 4S3OB 2MA5A 3L11A 2PUYA 4I7BA 3L1ZB 2LXHC 2OXQC 4XI1A 1WEQA 2MD7B 4P5OB 3T6RA 5TDWA 3DPLR 2KFTA 5H1UA 4WA6A 4C9ZA 2VPBA 5B77A 3MHHA 3T7LA 2FSAA 4FJCA 3C6WA 2K4DA 1JOCA 2YHOA 2Y43A 4A49A 5C11A 4LJNA 1X4IA 4TKPB 3ZNIA 4MVTA 4BHWA 5TBNA 5JG6A 2KE1A 3MHSA 5B75A 2LGKA 4PTBA 3QZVA 1X4JA 2YW8A 2M6MA 4X3GA 4AYCA 3RPGC 5FB1A 2KREA 1WIMA 2M3HA 4B86C 2L43A 2FUIA 2MUMA 2XEUA 2YSJA 2DX8A 2LGGA 3M62A 2ECNA 5C13A 2KIZA 2MIQA 3KNVA 1VFYA 3SHBA 2CKLA 4CCGX 2CKLB 2YUCA 2Y1MA 2YREA 4YADA 3KQIA 3N9LA 4B7YC 3VK6A 4PPEA 3LQJA 3PHDA 2KWJA 5LKTA 5KH7A 3O33A 2G43A 4UP5A 1E4UA 3EB5A 4W4UA 4YC9A 4YATA 4AP4A 2C2LA 1XWHA 5LKXA 2MT5A 3GL6A 1WGMA 4GNDA 3U5OA 2YQMA 1CHCA 4AVXA 2M1RA 4YBMA 1WEOA 3EB6A 1WE9A 1WFKA 2CSYA 4AUQB 3N9PA 4WZ3B 3ZYQA 4V3KC 2YYRA 4YBTA 3M63A 2L75A 3U5PA 5AIUA 1ZBDB 2LXPC 5B79A 4FO9A 1WEWA 1Z6UA 3SOUA 1WEEA 4ZQLA 5TRBA 3SOWA 2KWNA 5B76A 4N4FA 2JMDA 1JM7B 1WESA 5G0FA 1FP0A 3ZVZB 3RPGB 3ZPV1 2LRIC 4L58A 2LGLA 1VD4A
chains in the Genus database with same CATH superfamily
2EA6A 2EXUA 4QQ4A 4GNEA 3NG2A 2EODA 4IC3A 2L0BA 2YHNA 5H1TA 2LN0A 2XP0A 3O35A 4WZ0A 2JMJA 4YBSA 2KWOA 1WEMA 4I7CA 3O47A 5J3XA 3DWDA 2PNXA 3N9NA 4BBQA 4CA1A 2NAAA 5AITA 2YURA 3LVRE 2RI7A 3O70A 1HYIA 2HDPA 4GB0A 3N9MA 4YABA 2LAUA 3PUQA 4YAXA 3DQVR 3C5KA 2D8UA 2VJEA 5H9MA 2KU3A 2ECJA 1IYMA 2L80A 5G04B 3O34A 2RSDA 3FJUB 2BAYA 2IDAA 5D1LB 4A4BA 4GNFA 2XB1A 2ECVA 4FIPA 5B78A 5TABA 5DKAA 3HCUA 3V43A 2Y1NA 1BORA 1WEUA 2YQLA 2D8SA 2E61A 5H1VA 5SVYA 2CT2A 4WZ2A 2KWKA 3FL2A 2EGPA 4ZDTA 1RMDA 1Z2QA 2VPDA 4V3LC 2DSMA 3HCSA 2VJEB 5I3LA 1K2FA 2AN6A 2FD4A 4NN2A 3I2DA 2XOYA 1WEPA 4A4CA 3L1XA 3PURA 1Z60A 4F52B 5D1KB 2VP7A 2VPGA 2CRRA 1LDKC 3M99A 1WILA 4FK5A 2L5UA 4LADB 3DDTA 4I7DA 2M85A 4QF2A 2YT5A 5LCWB 5KH9A 4Q6FA 2DJAA 3LQIA 1U6GB 2YU4A 3ZVYA 5B8DA 2H0DA 1G25A 2G45A 3LQHA 3FAOA 4GNGA 2LV9A 5D1MB 3KV5A 3RTRB 2H0DB 2K1JA 2OWAA 2LGVA 2JRJA 5KH3A 2KGGA 2MNYA 2RR4A 4IC2A 4LKAA 3N9QA 4R2YA 4LK9A 2IQJA 3O37A 4LLBA 3O7AA 2CSZA 2I50A 2QJ0A 3ZPVE 3N9OA 4UI9B 4F1PA 2VNFA 2ZETC 2E6SA 5FEYA 3U5MA 5G05B 2KR4A 4H9DA 4A0CD 2F42A 4MSXA 1FBVA 1HYJA 2B0OE 2K16A 2MNZA 4Z0RA 5DINA 2MD8C 1MBMA 3ASLA 3GV4A 5LKUA 3KDEC 1DVPA 2YSMA 5TDRA 1N87A 5FERA 2ECTA 5FB0A 2CONA 4OGCA 1WEVA 3ZTGA 2G6QA 2ECIA 2C2VS 2K17A 2QIZA 4S3OC 3SOXA 1WENA 3LJUX 4L7XA 2E6RA 1T1HA 1X4UA 1VYXA 2QICA 4R7EA 2HYED 1MM3A 2ECGA 2LDRA 2MA6A 2VJFB 2ECWA 3T9KA 4ZUXU 2VJFA 3HCTA 3KV6A 4UP0A 1LDJB 3O36A 4AYCB 2EGMA 2LQ6A 1MM2A 2UZGA 3HTKC 3PLWA 3IHPA 2KYUA 3LRQA 4R8PK 2KKXA 5EYAF 5LKZA 1JM7A 2F6NA 2VPEA 3JUEA 2F6JA 4O64A 2FUUA 3U5NA 1V87A 2JM3A 2KGIA 4N3WA 2JMIA 2KKYA 4QF3A 1F62A 4S3OB 2MA5A 3L11A 2PUYA 4I7BA 3H7HA 3L1ZB 2LXHC 2FFWA 2OXQC 4XI1A 1WEQA 2MD7B 4P5OB 3T6RA 5TDWA 3E2DA 3DPLR 2KFTA 5H1UA 3FANA 4WA6A 2L7PA 4C9ZA 2VPBA 5B77A 3MHHA 3T7LA 5SVIB 2FSAA 4FJCA 3C6WA 2K4DA 1JOCA 3FM8C 5K3QA 2YHOA 5SVXA 2YVRA 2Y43A 4A49A 4OGEA 2JUNA 5C11A 2MKEA 4LJNA 1X4IA 4TKPB 3LDYA 3ZNIA 4MVTA 4BHWA 5TBNA 5JG6A 2KE1A 3MHSA 5B75A 2LGKA 4PTBA 3QZVA 1X4JA 2YW8A 2M6MA 4X3GA 4AYCA 3RPGC 5FB1A 2KREA 3Q1DA 1WIMA 2M3HA 4B86C 3MDBC 2L43A 2XOZA 2FUIA 2MUMA 2XEUA 2P57A 2YSJA 2DX8A 2LGGA 3M62A 2ECNA 3SUBA 5C13A 3FEHA 2KIZA 2MIQA 3M7KA 3KNVA 1VFYA 3SHBA 2CKLA 4CCGX 2CKLB 2YUCA 2Y1MA 2YREA 4YADA 3KQIA 3N9LA 2CSVA 4B7YC 3VK6A 4PPEA 3LQJA 3PHDA 2KWJA 5LKTA 5KH7A 3O33A 2G43A 4UP5A 1E4UA 2XOCA 3EB5A 4W4UA 4YC9A 4YATA 4AP4A 2C2LA 1XWHA 5LKXA 4O62A 2MT5A 3GL6A 1WGMA 4GNDA 3U5OA 2YQMA 1CHCA 4AVXA 3LVQE 2M1RA 4YBMA 1WEOA 3EB6A 1WE9A 1WFKA 2CSYA 4AUQB 2M13A 3N9PA 4WZ3B 3ZYQA 4V3KC 2YYRA 4YBTA 3M63A 2L75A 3U5PA 5AIUA 1ZBDB 2LXPC 5B79A 4FO9A 1WEWA 1Z6UA 2CRWA 3SOUA 1WEEA 4ZQLA 5TRBA 3SOWA 1DCQA 2KWNA 5B76A 4N4FA 2JMDA 1JM7B 1WESA 5G0FA 1FP0A 4Z0OA 3ZVZB 3RPGB 3ZPV1 2LRIC 5SVIA 4L58A 2LGLA 1VD4A
chains in the Genus database with same CATH topology
2EA6A 4GNEA 3NG2A 2EODA 4IC3A 2L0BA 2YHNA 5H1TA 2LN0A 4WZ0A 3O35A 4YBSA 2JMJA 2KWOA 1WEMA 4I7CA 5J3XA 2PNXA 3N9NA 4BBQA 4CA1A 2NAAA 5AITA 2YURA 2RI7A 3O70A 1HYIA 2HDPA 4GB0A 3N9MA 4YABA 3PUQA 4YAXA 3DQVR 3C5KA 2VJEA 5H9MA 2KU3A 2ECJA 1IYMA 2L80A 5G04B 3O34A 2RSDA 2BAYA 2IDAA 5D1LB 4A4BA 4GNFA 2XB1A 2ECVA 4FIPA 5B78A 5TABA 5DKAA 3HCUA 3V43A 2Y1NA 1BORA 1WEUA 2YQLA 2D8SA 5H1VA 2CT2A 4WZ2A 2KWKA 3FL2A 2EGPA 4ZDTA 1RMDA 1Z2QA 2VPDA 4V3LC 3HCSA 2VJEB 5I3LA 1K2FA 2AN6A 4NN2A 3I2DA 1WEPA 4A4CA 3L1XA 3PURA 1Z60A 4F52B 5D1KB 2VP7A 2VPGA 1LDKC 3M99A 1WILA 4FK5A 2L5UA 4LADB 4I7DA 2M85A 4QF2A 2YT5A 5LCWB 5KH9A 4Q6FA 3LQIA 1U6GB 2YU4A 3ZVYA 5B8DA 2H0DA 1G25A 2G45A 3LQHA 4GNGA 2LV9A 5D1MB 3KV5A 3RTRB 2H0DB 2K1JA 2LGVA 2JRJA 5KH3A 2KGGA 2MNYA 4IC2A 4LKAA 3N9QA 4R2YA 4LK9A 3O37A 4LLBA 3O7AA 2CSZA 2I50A 2QJ0A 3ZPVE 3N9OA 4UI9B 2VNFA 2ZETC 2E6SA 5FEYA 3U5MA 5G05B 2KR4A 4A0CD 2F42A 4MSXA 1FBVA 1HYJA 2K16A 2MNZA 5DINA 2MD8C 3ASLA 3GV4A 5LKUA 1DVPA 2YSMA 5TDRA 1N87A 5FERA 2ECTA 5FB0A 1WEVA 3ZTGA 2G6QA 2ECIA 2C2VS 2K17A 2QIZA 4S3OC 3SOXA 1WENA 4L7XA 2E6RA 1T1HA 1X4UA 1VYXA 2QICA 2HYED 4R7EA 1MM3A 2ECGA 2LDRA 2MA6A 2VJFB 2ECWA 4ZUXU 2VJFA 3HCTA 3KV6A 4UP0A 1LDJB 3O36A 4AYCB 2LQ6A 1MM2A 2UZGA 3HTKC 3IHPA 2KYUA 3LRQA 4R8PK 5EYAF 5LKZA 1JM7A 2F6NA 2VPEA 2F6JA 4O64A 2FUUA 3U5NA 1V87A 2KGIA 4N3WA 2JMIA 4QF3A 1F62A 4S3OB 2MA5A 3L11A 2PUYA 4I7BA 3L1ZB 2LXHC 2OXQC 4XI1A 1WEQA 2MD7B 4P5OB 3T6RA 5TDWA 3DPLR 2KFTA 5H1UA 4WA6A 4C9ZA 2VPBA 5B77A 3MHHA 3T7LA 2FSAA 4FJCA 3C6WA 2K4DA 1JOCA 2YHOA 2Y43A 4A49A 5C11A 4LJNA 1X4IA 4TKPB 3ZNIA 4MVTA 4BHWA 5TBNA 5JG6A 2KE1A 3MHSA 5B75A 2LGKA 4PTBA 3QZVA 1X4JA 2YW8A 2M6MA 4X3GA 4AYCA 3RPGC 5FB1A 2KREA 1WIMA 2M3HA 4B86C 2L43A 2FUIA 2MUMA 2XEUA 2YSJA 2DX8A 2LGGA 3M62A 2ECNA 5C13A 2KIZA 2MIQA 3KNVA 1VFYA 3SHBA 2CKLA 4CCGX 2CKLB 2YUCA 2Y1MA 2YREA 4YADA 3KQIA 3N9LA 4B7YC 3VK6A 4PPEA 3LQJA 3PHDA 2KWJA 5LKTA 5KH7A 3O33A 2G43A 4UP5A 1E4UA 3EB5A 4W4UA 4YC9A 4YATA 4AP4A 2C2LA 1XWHA 5LKXA 2MT5A 3GL6A 1WGMA 4GNDA 3U5OA 2YQMA 1CHCA 4AVXA 2M1RA 4YBMA 1WEOA 3EB6A 1WE9A 1WFKA 2CSYA 4AUQB 3N9PA 4WZ3B 3ZYQA 4V3KC 2YYRA 4YBTA 3M63A 2L75A 3U5PA 5AIUA 1ZBDB 2LXPC 5B79A 4FO9A 1WEWA 1Z6UA 3SOUA 1WEEA 4ZQLA 5TRBA 3SOWA 2KWNA 5B76A 4N4FA 2JMDA 1JM7B 1WESA 5G0FA 1FP0A 3ZVZB 3RPGB 3ZPV1 2LRIC 4L58A 2LGLA 1VD4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EA6 A;  4GNE A;  3NG2 A;  2EOD A;  4IC3 A;  2L0B A;  2YHN A;  5H1T A;  2LN0 A;  4WZ0 A;  3O35 A;  4YBS A;  2JMJ A;  2KWO A;  1WEM A;  4I7C A;  5J3X A;  2PNX A;  3N9N A;  4BBQ A;  4CA1 A;  2NAA A;  5AIT A;  2YUR A;  2RI7 A;  3O70 A;  1HYI A;  2HDP A;  4GB0 A;  3N9M A;  4YAB A;  3PUQ A;  4YAX A;  3DQV R;  3C5K A;  2VJE A;  5H9M A;  2KU3 A;  2ECJ A;  1IYM A;  2L80 A;  5G04 B;  3O34 A;  2RSD A;  2BAY A;  2IDA A;  5D1L B;  4A4B A;  4GNF A;  2XB1 A;  2ECV A;  4FIP A;  5B78 A;  5TAB A;  5DKA A;  3HCU A;  3V43 A;  2Y1N A;  1BOR A;  1WEU A;  2YQL A;  2D8S A;  5H1V A;  2CT2 A;  4WZ2 A;  2KWK A;  3FL2 A;  2EGP A;  4ZDT A;  1RMD A;  1Z2Q A;  2VPD A;  4V3L C;  3HCS A;  2VJE B;  5I3L A;  1K2F A;  2AN6 A;  4NN2 A;  3I2D A;  1WEP A;  4A4C A;  3L1X A;  3PUR A;  1Z60 A;  4F52 B;  5D1K B;  2VP7 A;  2VPG A;  1LDK C;  3M99 A;  1WIL A;  4FK5 A;  2L5U A;  4LAD B;  4I7D A;  2M85 A;  4QF2 A;  2YT5 A;  5LCW B;  5KH9 A;  4Q6F A;  3LQI A;  1U6G B;  2YU4 A;  3ZVY A;  5B8D A;  2H0D A;  1G25 A;  2G45 A;  3LQH A;  4GNG A;  2LV9 A;  5D1M B;  3KV5 A;  3RTR B;  2H0D B;  2K1J A;  2LGV A;  2JRJ A;  5KH3 A;  2KGG A;  2MNY A;  4IC2 A;  4LKA A;  3N9Q A;  4R2Y A;  4LK9 A;  3O37 A;  4LLB A;  3O7A A;  2CSZ A;  2I50 A;  2QJ0 A;  3ZPV E;  3N9O A;  4UI9 B;  2VNF A;  2ZET C;  2E6S A;  5FEY A;  3U5M A;  5G05 B;  2KR4 A;  4A0C D;  2F42 A;  4MSX A;  1FBV A;  1HYJ A;  2K16 A;  2MNZ A;  5DIN A;  2MD8 C;  3ASL A;  3GV4 A;  5LKU A;  1DVP A;  2YSM A;  5TDR A;  1N87 A;  5FER A;  2ECT A;  5FB0 A;  1WEV A;  3ZTG A;  2G6Q A;  2ECI A;  2C2V S;  2K17 A;  2QIZ A;  4S3O C;  3SOX A;  1WEN A;  4L7X A;  2E6R A;  1T1H A;  1X4U A;  1VYX A;  2QIC A;  2HYE D;  4R7E A;  1MM3 A;  2ECG A;  2LDR A;  2MA6 A;  2VJF B;  2ECW A;  4ZUX U;  2VJF A;  3HCT A;  3KV6 A;  4UP0 A;  1LDJ B;  3O36 A;  4AYC B;  2LQ6 A;  1MM2 A;  2UZG A;  3HTK C;  3IHP A;  2KYU A;  3LRQ A;  4R8P K;  5EYA F;  5LKZ A;  1JM7 A;  2F6N A;  2VPE A;  2F6J A;  4O64 A;  2FUU A;  3U5N A;  1V87 A;  2KGI A;  4N3W A;  2JMI A;  4QF3 A;  1F62 A;  4S3O B;  2MA5 A;  3L11 A;  2PUY A;  4I7B A;  3L1Z B;  2LXH C;  2OXQ C;  4XI1 A;  1WEQ A;  2MD7 B;  4P5O B;  3T6R A;  5TDW A;  3DPL R;  2KFT A;  5H1U A;  4WA6 A;  4C9Z A;  2VPB A;  5B77 A;  3MHH A;  3T7L A;  2FSA A;  4FJC A;  3C6W A;  2K4D A;  1JOC A;  2YHO A;  2Y43 A;  4A49 A;  5C11 A;  4LJN A;  1X4I A;  4TKP B;  3ZNI A;  4MVT A;  4BHW A;  5TBN A;  5JG6 A;  2KE1 A;  3MHS A;  5B75 A;  2LGK A;  4PTB A;  3QZV A;  1X4J A;  2YW8 A;  2M6M A;  4X3G A;  4AYC A;  3RPG C;  5FB1 A;  2KRE A;  1WIM A;  2M3H A;  4B86 C;  2L43 A;  2FUI A;  2MUM A;  2XEU A;  2YSJ A;  2DX8 A;  2LGG A;  3M62 A;  2ECN A;  5C13 A;  2KIZ A;  2MIQ A;  3KNV A;  1VFY A;  3SHB A;  2CKL A;  4CCG X;  2CKL B;  2YUC A;  2Y1M A;  2YRE A;  4YAD A;  3KQI A;  3N9L A;  4B7Y C;  3VK6 A;  4PPE A;  3LQJ A;  3PHD A;  2KWJ A;  5LKT A;  5KH7 A;  3O33 A;  2G43 A;  4UP5 A;  1E4U A;  3EB5 A;  4W4U A;  4YC9 A;  4YAT A;  4AP4 A;  2C2L A;  1XWH A;  5LKX A;  2MT5 A;  3GL6 A;  1WGM A;  4GND A;  3U5O A;  2YQM A;  1CHC A;  4AVX A;  2M1R A;  4YBM A;  1WEO A;  3EB6 A;  1WE9 A;  1WFK A;  2CSY A;  4AUQ B;  3N9P A;  4WZ3 B;  3ZYQ A;  4V3K C;  2YYR A;  4YBT A;  3M63 A;  2L75 A;  3U5P A;  5AIU A;  1ZBD B;  2LXP C;  5B79 A;  4FO9 A;  1WEW A;  1Z6U A;  3SOU A;  1WEE A;  4ZQL A;  5TRB A;  3SOW A;  2KWN A;  5B76 A;  4N4F A;  2JMD A;  1JM7 B;  1WES A;  5G0F A;  1FP0 A;  3ZVZ B;  3RPG B;  3ZPV 1;  2LRI C;  4L58 A;  2LGL A;  1VD4 A; 
#chains in the Genus database with same CATH topology
 2EA6 A;  2EXU A;  4QQ4 A;  4GNE A;  3NG2 A;  2EOD A;  4IC3 A;  2L0B A;  2YHN A;  5H1T A;  2LN0 A;  2XP0 A;  3O35 A;  4WZ0 A;  2JMJ A;  4YBS A;  2KWO A;  1WEM A;  4I7C A;  3O47 A;  5J3X A;  3DWD A;  2PNX A;  3N9N A;  4BBQ A;  4CA1 A;  2NAA A;  5AIT A;  2YUR A;  3LVR E;  2RI7 A;  3O70 A;  1HYI A;  2HDP A;  4GB0 A;  3N9M A;  4YAB A;  2LAU A;  3PUQ A;  4YAX A;  3DQV R;  3C5K A;  2D8U A;  2VJE A;  5H9M A;  2KU3 A;  2ECJ A;  1IYM A;  2L80 A;  5G04 B;  3O34 A;  2RSD A;  3FJU B;  2BAY A;  2IDA A;  5D1L B;  4A4B A;  4GNF A;  2XB1 A;  2ECV A;  4FIP A;  5B78 A;  5TAB A;  5DKA A;  3HCU A;  3V43 A;  2Y1N A;  1BOR A;  1WEU A;  2YQL A;  2D8S A;  2E61 A;  5H1V A;  5SVY A;  2CT2 A;  4WZ2 A;  2KWK A;  3FL2 A;  2EGP A;  4ZDT A;  1RMD A;  1Z2Q A;  2VPD A;  4V3L C;  2DSM A;  3HCS A;  2VJE B;  5I3L A;  1K2F A;  2AN6 A;  2FD4 A;  4NN2 A;  3I2D A;  2XOY A;  1WEP A;  4A4C A;  3L1X A;  3PUR A;  1Z60 A;  4F52 B;  5D1K B;  2VP7 A;  2VPG A;  2CRR A;  1LDK C;  3M99 A;  1WIL A;  4FK5 A;  2L5U A;  4LAD B;  3DDT A;  4I7D A;  2M85 A;  4QF2 A;  2YT5 A;  5LCW B;  5KH9 A;  4Q6F A;  2DJA A;  3LQI A;  1U6G B;  2YU4 A;  3ZVY A;  5B8D A;  2H0D A;  1G25 A;  2G45 A;  3LQH A;  3FAO A;  4GNG A;  2LV9 A;  5D1M B;  3KV5 A;  3RTR B;  2H0D B;  2K1J A;  2OWA A;  2LGV A;  2JRJ A;  5KH3 A;  2KGG A;  2MNY A;  2RR4 A;  4IC2 A;  4LKA A;  3N9Q A;  4R2Y A;  4LK9 A;  2IQJ A;  3O37 A;  4LLB A;  3O7A A;  2CSZ A;  2I50 A;  2QJ0 A;  3ZPV E;  3N9O A;  4UI9 B;  4F1P A;  2VNF A;  2ZET C;  2E6S A;  5FEY A;  3U5M A;  5G05 B;  2KR4 A;  4H9D A;  4A0C D;  2F42 A;  4MSX A;  1FBV A;  1HYJ A;  2B0O E;  2K16 A;  2MNZ A;  4Z0R A;  5DIN A;  2MD8 C;  1MBM A;  3ASL A;  3GV4 A;  5LKU A;  3KDE C;  1DVP A;  2YSM A;  5TDR A;  1N87 A;  5FER A;  2ECT A;  5FB0 A;  2CON A;  4OGC A;  1WEV A;  3ZTG A;  2G6Q A;  2ECI A;  2C2V S;  2K17 A;  2QIZ A;  4S3O C;  3SOX A;  1WEN A;  3LJU X;  4L7X A;  2E6R A;  1T1H A;  1X4U A;  1VYX A;  2QIC A;  4R7E A;  2HYE D;  1MM3 A;  2ECG A;  2LDR A;  2MA6 A;  2VJF B;  2ECW A;  3T9K A;  4ZUX U;  2VJF A;  3HCT A;  3KV6 A;  4UP0 A;  1LDJ B;  3O36 A;  4AYC B;  2EGM A;  2LQ6 A;  1MM2 A;  2UZG A;  3HTK C;  3PLW A;  3IHP A;  2KYU A;  3LRQ A;  4R8P K;  2KKX A;  5EYA F;  5LKZ A;  1JM7 A;  2F6N A;  2VPE A;  3JUE A;  2F6J A;  4O64 A;  2FUU A;  3U5N A;  1V87 A;  2JM3 A;  2KGI A;  4N3W A;  2JMI A;  2KKY A;  4QF3 A;  1F62 A;  4S3O B;  2MA5 A;  3L11 A;  2PUY A;  4I7B A;  3H7H A;  3L1Z B;  2LXH C;  2FFW A;  2OXQ C;  4XI1 A;  1WEQ A;  2MD7 B;  4P5O B;  3T6R A;  5TDW A;  3E2D A;  3DPL R;  2KFT A;  5H1U A;  3FAN A;  4WA6 A;  2L7P A;  4C9Z A;  2VPB A;  5B77 A;  3MHH A;  3T7L A;  5SVI B;  2FSA A;  4FJC A;  3C6W A;  2K4D A;  1JOC A;  3FM8 C;  5K3Q A;  2YHO A;  5SVX A;  2YVR A;  2Y43 A;  4A49 A;  4OGE A;  2JUN A;  5C11 A;  2MKE A;  4LJN A;  1X4I A;  4TKP B;  3LDY A;  3ZNI A;  4MVT A;  4BHW A;  5TBN A;  5JG6 A;  2KE1 A;  3MHS A;  5B75 A;  2LGK A;  4PTB A;  3QZV A;  1X4J A;  2YW8 A;  2M6M A;  4X3G A;  4AYC A;  3RPG C;  5FB1 A;  2KRE A;  3Q1D A;  1WIM A;  2M3H A;  4B86 C;  3MDB C;  2L43 A;  2XOZ A;  2FUI A;  2MUM A;  2XEU A;  2P57 A;  2YSJ A;  2DX8 A;  2LGG A;  3M62 A;  2ECN A;  3SUB A;  5C13 A;  3FEH A;  2KIZ A;  2MIQ A;  3M7K A;  3KNV A;  1VFY A;  3SHB A;  2CKL A;  4CCG X;  2CKL B;  2YUC A;  2Y1M A;  2YRE A;  4YAD A;  3KQI A;  3N9L A;  2CSV A;  4B7Y C;  3VK6 A;  4PPE A;  3LQJ A;  3PHD A;  2KWJ A;  5LKT A;  5KH7 A;  3O33 A;  2G43 A;  4UP5 A;  1E4U A;  2XOC A;  3EB5 A;  4W4U A;  4YC9 A;  4YAT A;  4AP4 A;  2C2L A;  1XWH A;  5LKX A;  4O62 A;  2MT5 A;  3GL6 A;  1WGM A;  4GND A;  3U5O A;  2YQM A;  1CHC A;  4AVX A;  3LVQ E;  2M1R A;  4YBM A;  1WEO A;  3EB6 A;  1WE9 A;  1WFK A;  2CSY A;  4AUQ B;  2M13 A;  3N9P A;  4WZ3 B;  3ZYQ A;  4V3K C;  2YYR A;  4YBT A;  3M63 A;  2L75 A;  3U5P A;  5AIU A;  1ZBD B;  2LXP C;  5B79 A;  4FO9 A;  1WEW A;  1Z6U A;  2CRW A;  3SOU A;  1WEE A;  4ZQL A;  5TRB A;  3SOW A;  1DCQ A;  2KWN A;  5B76 A;  4N4F A;  2JMD A;  1JM7 B;  1WES A;  5G0F A;  1FP0 A;  4Z0O A;  3ZVZ B;  3RPG B;  3ZPV 1;  2LRI C;  5SVI A;  4L58 A;  2LGL A;  1VD4 A; 
#chains in the Genus database with same CATH homology
 2EA6 A;  4GNE A;  3NG2 A;  2EOD A;  4IC3 A;  2L0B A;  2YHN A;  5H1T A;  2LN0 A;  4WZ0 A;  3O35 A;  4YBS A;  2JMJ A;  2KWO A;  1WEM A;  4I7C A;  5J3X A;  2PNX A;  3N9N A;  4BBQ A;  4CA1 A;  2NAA A;  5AIT A;  2YUR A;  2RI7 A;  3O70 A;  1HYI A;  2HDP A;  4GB0 A;  3N9M A;  4YAB A;  3PUQ A;  4YAX A;  3DQV R;  3C5K A;  2VJE A;  5H9M A;  2KU3 A;  2ECJ A;  1IYM A;  2L80 A;  5G04 B;  3O34 A;  2RSD A;  2BAY A;  2IDA A;  5D1L B;  4A4B A;  4GNF A;  2XB1 A;  2ECV A;  4FIP A;  5B78 A;  5TAB A;  5DKA A;  3HCU A;  3V43 A;  2Y1N A;  1BOR A;  1WEU A;  2YQL A;  2D8S A;  5H1V A;  2CT2 A;  4WZ2 A;  2KWK A;  3FL2 A;  2EGP A;  4ZDT A;  1RMD A;  1Z2Q A;  2VPD A;  4V3L C;  3HCS A;  2VJE B;  5I3L A;  1K2F A;  2AN6 A;  4NN2 A;  3I2D A;  1WEP A;  4A4C A;  3L1X A;  3PUR A;  1Z60 A;  4F52 B;  5D1K B;  2VP7 A;  2VPG A;  1LDK C;  3M99 A;  1WIL A;  4FK5 A;  2L5U A;  4LAD B;  4I7D A;  2M85 A;  4QF2 A;  2YT5 A;  5LCW B;  5KH9 A;  4Q6F A;  3LQI A;  1U6G B;  2YU4 A;  3ZVY A;  5B8D A;  2H0D A;  1G25 A;  2G45 A;  3LQH A;  4GNG A;  2LV9 A;  5D1M B;  3KV5 A;  3RTR B;  2H0D B;  2K1J A;  2LGV A;  2JRJ A;  5KH3 A;  2KGG A;  2MNY A;  4IC2 A;  4LKA A;  3N9Q A;  4R2Y A;  4LK9 A;  3O37 A;  4LLB A;  3O7A A;  2CSZ A;  2I50 A;  2QJ0 A;  3ZPV E;  3N9O A;  4UI9 B;  2VNF A;  2ZET C;  2E6S A;  5FEY A;  3U5M A;  5G05 B;  2KR4 A;  4A0C D;  2F42 A;  4MSX A;  1FBV A;  1HYJ A;  2K16 A;  2MNZ A;  5DIN A;  2MD8 C;  3ASL A;  3GV4 A;  5LKU A;  1DVP A;  2YSM A;  5TDR A;  1N87 A;  5FER A;  2ECT A;  5FB0 A;  1WEV A;  3ZTG A;  2G6Q A;  2ECI A;  2C2V S;  2K17 A;  2QIZ A;  4S3O C;  3SOX A;  1WEN A;  4L7X A;  2E6R A;  1T1H A;  1X4U A;  1VYX A;  2QIC A;  2HYE D;  4R7E A;  1MM3 A;  2ECG A;  2LDR A;  2MA6 A;  2VJF B;  2ECW A;  4ZUX U;  2VJF A;  3HCT A;  3KV6 A;  4UP0 A;  1LDJ B;  3O36 A;  4AYC B;  2LQ6 A;  1MM2 A;  2UZG A;  3HTK C;  3IHP A;  2KYU A;  3LRQ A;  4R8P K;  5EYA F;  5LKZ A;  1JM7 A;  2F6N A;  2VPE A;  2F6J A;  4O64 A;  2FUU A;  3U5N A;  1V87 A;  2KGI A;  4N3W A;  2JMI A;  4QF3 A;  1F62 A;  4S3O B;  2MA5 A;  3L11 A;  2PUY A;  4I7B A;  3L1Z B;  2LXH C;  2OXQ C;  4XI1 A;  1WEQ A;  2MD7 B;  4P5O B;  3T6R A;  5TDW A;  3DPL R;  2KFT A;  5H1U A;  4WA6 A;  4C9Z A;  2VPB A;  5B77 A;  3MHH A;  3T7L A;  2FSA A;  4FJC A;  3C6W A;  2K4D A;  1JOC A;  2YHO A;  2Y43 A;  4A49 A;  5C11 A;  4LJN A;  1X4I A;  4TKP B;  3ZNI A;  4MVT A;  4BHW A;  5TBN A;  5JG6 A;  2KE1 A;  3MHS A;  5B75 A;  2LGK A;  4PTB A;  3QZV A;  1X4J A;  2YW8 A;  2M6M A;  4X3G A;  4AYC A;  3RPG C;  5FB1 A;  2KRE A;  1WIM A;  2M3H A;  4B86 C;  2L43 A;  2FUI A;  2MUM A;  2XEU A;  2YSJ A;  2DX8 A;  2LGG A;  3M62 A;  2ECN A;  5C13 A;  2KIZ A;  2MIQ A;  3KNV A;  1VFY A;  3SHB A;  2CKL A;  4CCG X;  2CKL B;  2YUC A;  2Y1M A;  2YRE A;  4YAD A;  3KQI A;  3N9L A;  4B7Y C;  3VK6 A;  4PPE A;  3LQJ A;  3PHD A;  2KWJ A;  5LKT A;  5KH7 A;  3O33 A;  2G43 A;  4UP5 A;  1E4U A;  3EB5 A;  4W4U A;  4YC9 A;  4YAT A;  4AP4 A;  2C2L A;  1XWH A;  5LKX A;  2MT5 A;  3GL6 A;  1WGM A;  4GND A;  3U5O A;  2YQM A;  1CHC A;  4AVX A;  2M1R A;  4YBM A;  1WEO A;  3EB6 A;  1WE9 A;  1WFK A;  2CSY A;  4AUQ B;  3N9P A;  4WZ3 B;  3ZYQ A;  4V3K C;  2YYR A;  4YBT A;  3M63 A;  2L75 A;  3U5P A;  5AIU A;  1ZBD B;  2LXP C;  5B79 A;  4FO9 A;  1WEW A;  1Z6U A;  3SOU A;  1WEE A;  4ZQL A;  5TRB A;  3SOW A;  2KWN A;  5B76 A;  4N4F A;  2JMD A;  1JM7 B;  1WES A;  5G0F A;  1FP0 A;  3ZVZ B;  3RPG B;  3ZPV 1;  2LRI C;  4L58 A;  2LGL A;  1VD4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...