4MVTA

Crystal structure of sumo e3 ligase pias3
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
283
structure length
255
Chain Sequence
DVTMKPLPFYEVYGELIRPTTLFEEAHFTFALTPQQVQQILTSRDYTIQVQLRFCLCETSCPQEDYFPPNLFVKVNGKLCPLPGYKRPSRPINITPLARLSATVPNTIVVNWSSRNYSLSVYLVRQLTAGTLLQKLRAKGIRNPDHSRALIKEKLTADPDSEVATTSLRVSLMCPLGKMRLTVPCRALTCAHLQSFDAALYLQMNEKKPTWTCPVCDKKAPYESLIIDGLFMEILSSCSDCDEIQFMEDGSWCPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords E3 SUMO-protein ligase PIAS3
publication title Crystal structure of SUMO E3 Ligase PIAS3
rcsb
source organism Homo sapiens
total genus 63
structure length 255
sequence length 283
chains with identical sequence B, C, D
ec nomenclature ec 6.3.2.-:
pdb deposition date 2013-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02891 zf-MIZ MIZ/SP-RING zinc finger
A PF14324 PINIT PINIT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.780 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4mvtA01
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4mvtA02
5B76A 3L1XA 2KWJA 4QF2A 4FIPA 4GNDA 1WEVA 5B79A 1WEMA 2UZGA 1Z2QA 2YQMA 4WA6A 2L5UA 3SOXA 4PPEA 1JOCA 2G45A 4B7YC 1WIMA 2F42A 3DQVR 2OXQC 4LK9A 1FBVA 2YSJA 4A4BA 1X4JA 2QJ0A 5FB1A 2E6SA 1JM7A 1Z60A 1WILA 2PNXA 1LDKC 4ZUXU 3ZTGA 2KFTA 4L7XA 3EB5A 4AVXA 4MVTA 4V3KC 5DINA 1WEWA 2QICA 2LDRA 4LADB 2F6JA 1XWHA 5TRBA 1WEPA 2G43A 2KR4A 1VD4A 3LRQA 1MM3A 2KGGA 3MHSA 1WENA 4YBSA 3ZVYA 4V3LC 4AP4A 4B86C 3ZPVE 3L11A 4YBMA 2ECGA 2YT5A 2YREA 5B78A 2MNZA 4GNEA 5D1KB 2YSMA 4F52B 3FL2A 2FUIA 5H1VA 2AN6A 4WZ3B 2YU4A 2KIZA 2FUUA 5AITA 2LGVA 2MD7B 3T6RA 4YADA 1IYMA 4GNGA 2L0BA 5TBNA 2RI7A 2MD8C 1WEEA 2ECTA 1WE9A 3V43A 3HTKC 5EYAF 2CKLB 5C13A 2XEUA 1G25A 3LQHA 1X4IA 2K4DA 3U5OA 1HYJA 3O34A 1FP0A 4BBQA 3PHDA 3PURA 2EGPA 4I7BA 2JMJA 1E4UA 2JMIA 1T1HA 1DVPA 4N4FA 3HCTA 3M62A 2YQLA 1WGMA 3NG2A 2L80A 2VPBA 2LRIC 3O36A 4W4UA 3ZPV1 2VJEA 2LXHC 3N9MA 4GNFA 4X3GA 2PUYA 4PTBA 4R2YA 2H0DB 2CT2A 4CCGX 3MHHA 2LXPC 3SHBA 2LGKA 2CKLA 1MM2A 4A0CD 2D8SA 3L1ZB 3SOWA 2ECVA 1CHCA 3KQIA 3O33A 5B75A 4XI1A 2ECWA 4R7EA 2E6RA 5G05B 5B77A 4FO9A 2VPEA 1X4UA 5FEYA 3RTRB 1WEOA 5KH3A 2YHOA 5KH9A 4NN2A 2IDAA 3GL6A 4YATA 5TDRA 2H0DA 2KWOA 4S3OB 2L43A 2LGLA 2M3HA 4P5OB 2LN0A 2VJFB 1WEUA 3O70A 4LLBA 1ZBDB 3O37A 4QF3A 3C5KA 2K17A 1WESA 3O35A 1LDJB 3O7AA 1HYIA 2KU3A 4L58A 3EB6A 2ECJA 4Q6FA 5LKZA 1RMDA 3N9LA 3N9OA 2VPDA 2K1JA 2LGGA 2YW8A 5B8DA 4FJCA 2MT5A 4ZQLA 4YBTA 2LQ6A 4CA1A 2VNFA 2ECIA 2MA5A 2ECNA 5FERA 3N9PA 2KYUA 2VJFA 4R8PK 5G04B 5TABA 3C6WA 2EODA 2BAYA 5TDWA 4GB0A 2C2VS 3RPGB 4AUQB 5D1LB 2DX8A 5DKAA 2RSDA 2MNYA 4UI9B 4S3OC 2MUMA 3ASLA 4WZ0A 3PUQA 2EA6A 3VK6A 2Y1MA 5FB0A 5LKXA 2CSYA 4LKAA 3SOUA 3U5PA 3U5MA 5JG6A 2Y1NA 4TKPB 3QZVA 4UP5A 2M1RA 2MA6A 4I7DA 1N87A 3U5NA 5H9MA 3IHPA 3N9NA 4LJNA 2F6NA 1V87A 4I7CA 2CSZA 2HYED 3T7LA 3M99A 3KNVA 2KWNA 2JMDA 3M63A 2MIQA 2HDPA 2KE1A 5J3XA 3KV5A 4C9ZA 3KV6A 2YURA 1Z6UA 2M85A 4FK5A 4A4CA 4AYCB 4YABA 3ZNIA 3ZVZB 5LKTA 3DPLR 2XB1A 3ZYQA 5LKUA 4YAXA 4O64A 3I2DA 1K2FA 2VPGA 4IC3A 3RPGC 4MSXA 1BORA 2M6MA 5G0FA 2KWKA 4IC2A 3N9QA 4WZ2A 5C11A 3LQJA 5H1UA 1U6GB 1VYXA 2FSAA 5LCWB 2KGIA 4N3WA 5I3LA 4BHWA 2K16A 1WEQA 2QIZA 2KREA 1VFYA 2L75A 4AYCA 2VP7A 2JRJA 4ZDTA 2YYRA 2YHNA 2C2LA 5H1TA 2YUCA 3GV4A 2G6QA 5AIUA 4YC9A 4UP0A 2VJEB 5D1MB 2NAAA 3HCSA 2ZETC 2LV9A 1WFKA 3LQIA 5KH7A 1JM7B 1F62A 3HCUA 2I50A 2Y43A 4A49A
chains in the Genus database with same CATH superfamily
5AC92 2DJAA 4LHNA 4BIOA 4E8CA 4HN0A 3ZFEA 1L7QA 2WFPA 3GDBA 2VVEA 3RFRA 1MS5A 1DFQA 1N1SA 1V6NA 1WWYA 3CNAA 3I49A 1PVC3 1Z2QA 2MEV3 3AYAA 4D3WA 3L2YA 3SOXA 4JTOA 2YFUA 4JKKA 5FRAA 1LGBA 4PPEA 2NPIA 4B7YC 1DYKA 5KHHA 5L73A 1OQ1A 4AI8A 5ABJA 3E5QA 3DQVR 1W8FA 3ZTGA 4ZPIA 5A70A 3OB8A 3ZFFA 5C71A 1W2OA 3OF1A 3IIAA 5C70A 3CKHA 2BOIA 4XTMA 3DL3A 3ZXGA 4A4BA 3VBRA 2OXBA 4YW7A 1LR5A 5CKNA 2QJ0A 1GKBA 5FY7A 2WZEA 2BRTA 1JHJA 2VJXA 4Q0SA 4Z8BA 4ARYA 3O1MA 1K42A 1JYNA 2AC1A 5M0TA 1CONA 4RS5C 5IK7A 2CSVA 4YW4A 3IIIA 5I0RA 3EO6A 5FZMA 1Z60A 3AX4A 5A6XA 2BGCA 4XBLA 2CWMA 1ND2B 3QH6A 1GP6A 3EB7A 3ACHA 3ROUA 1AR91 3E1F1 4CCOA 1JMUB 1QHDA 2BW8A 3OGGA 2VZ3A 3T4HB 4LO8A 2ZEXA 5JUVA 5LW9A 4S2DA 4IE4A 4QPGB 4XFFA 4TYSA 1GQGA 2EXJA 4UFJA 4W6XA 4AEKA 2KFTA 4JHZA 4AVXA 4MVTA 1H1MA 4XQ4A 2PHTA 3ZOIA 5DINA 5LBCA 1QJEA 4MZUA 1JN2P 3CMGA 1OD3A 2Q1FA 1ULGA 2F6JA 5A3NA 4GKXA 1A8DA 2VUJA 1SCSA 1YFUA 1R093 2F4LA 4BIFA 1ND3A 5JXJA 1BK1A 3PIGA 4M0NA 1NCRB 2WAOA 2PA7A 1GYKA 3UESA 1JZ7A 4BQXA 1YQCA 1MM3A 3K48A 1SCRA 3KV4A 2D6NA 1YFWA 4FOWA 5IK5A 2VM9A 3DPRA 5T5PA 4HXCA 2LTNA 3DYMA 5IVFA 3HBZA 4YVSB 5FYSA 4XUNA 1WW5A 3J7MA 3NL1A 1PVC2 1SLTA 2MEV2 4UFHA 3U1XA 3HMYA 4FPKA 1LHNA 2HWD2 3C2UA 1J84A 1QH7A 4KWKA 2NZ9A 4YGBA 4OYUA 3NO8A 3CDZB 4YBSA 1RC6A 1XOYA 3OY8A 3WDYA 1ZBE1 3IM0A 1FV2A 2Y6JA 5C5UA 4V3LC 4FOQA 1N3QA 4W6YA 4AVVA 1UCXA 5AC91 1G9FA 4G3YC 3ZSMA 3T30A 4XF1A 1CAWB 3POBA 1OFNA 4L0PA 5A32B 3FFQA 5IFPA 1LECA 2D3SA 4YBMA 1H30A 3MIGA 2WFF3 3ZYJB 3ZN6A 2YREA 5FKBA 5KXCA 1UIJA 3MV11 4QQOA 3AC0A 5D1KB 2BBAA 2E7AA 1PMHX 1I5ZA 2GU9A 2VH9A 3WDVA 3TEZA 4C91A 3FL2A 3T9KA 5J36A 4XAAA 2AN6A 2YY1A 1YIFA 4FT8A 5FO8B 1SPPA 1VBB3 5ANNA 5FZ1A 3JQWA 1LOBA 3BTYA 2CRWA 1QWRA 1G86A 3FX3A 1IPSA 3T1MA 4PI0A 1OLME 1LEMA 2XH6A 2G1MA 5FJKA 1TE1B 5FPLA 1J1TA 4J1XA 2GC2A 4QB1A 4Y1YA 1PNGA 2VW1A 5A6QA 2EGMA 5I0DA 1RUOA 1MQTA 2VBBA 3MLLA 1RUF3 1ULPA 1UYYA 2GNDA 3H3LA 3OPWA 4PIYA 1LOFC 4YW5A 4CEWB 3LVQE 3DF0A 4JV4A 4N53A 4R9DA 5TBNA 1UZ0A 3NNMA 1CZVA 3OGVA 5CU1A 2QUOA 5LY1A 1WW4A 5EYYA 5CISA 1V6JA 3IMMA 4GZ9A 3J9SA 5GZEA 4HMZA 5KXBA 1R092 2UURA 1CR7A 1X8EA 1UIKA 4QX5A 1WD3A 3NJXA 2QQJA 2XMLA 4JGZC 5FYHA 3HTKC 1KITA 3OUJA 2B7YA 3ZM8A 3M7AA 1W6PA 3H0OA 5C9AC 5FZOB 4BLIA 4BMBA 2M13A 3FBMA 4RFRB 2ZGLA 3LQHA 2K4DA 5AVPA 3WZ1A 3POJA 2FBEA 2ZGQA 4AFMA 1W6OA 1KJRA 4HL0A 4NAOA 4XJUA 1OF4A 1JYVA 1HYJA 3VBHB 2WNUC 4KQ7A 3TRSB 2D8UA 2Z69A 4Z0OA 1LCLA 3U37A 5KHIA 3JQXA 4QXBA 1E4UA 3B02A 1QXRA 4QKFA 1A3KA 2YGLA 1QOSA 4XF4A 3JZVA 1DVPA 2QZ2A 3J26N 3K3NA 5DUXA 4IEWA 2YQLA 3M62A 3KF3A 4A6SA 2WFF2 1BXHA 5K4LA 4FPCA 2BP6A 2WS93 2A6XA 3AXDA 1PVC1 1JHNA 2MEV1 4COZA 4EN9B 3MDBC 4BH9A 4BMEA 2HWD1 4C0BA 2XLGA 2YXSA 1CPMA 1S2EA 4YG3A 3T2PA 1W2UA 5FZHA 3ES1A 4EN7B 5LK7B 2A70A 2Z79A 1SLLA 5LRRA 4AWDA 3VKFC 3BALA 4YZ1A 4W4UA 4EWEA 4FPEA 4YVWB 1VPHA 4JQTA 1KS5A 2JG9C 2PUYA 4NVPA 4KMQA 4DIQA 2DYCA 3UYJA 3VGIA 2FCTA 4Y26A 3T08A 1CX1A 4I09A 2BV4A 1ENSA 3N4MA 4CXWA 3MHHA 2P3KA 1LB2A 1RUF2 1H8TA 2DBIA 2VZOA 2Q30A 4F1PA 2P6HA 2W1SA 3AMQA 3AVSA 3LWCA 4FPLA 4LA2A 4C1WA 4EN0A 2CKLA 4UW3A 3OGJA 1XYNA 1UZWA 1JZ4A 3HNMA 3J8F3 4MXWB 3APBA 4Q4V3 4AVAA 4RD7A 4LE3A 4RSUA 2YBKA 2X05A 4AAPA 4MOAA 2VXJA 4AL9A 2E33A 4OUMA 5CKQA 4DS0A 5CA6A 1CHCA 4XCAA 3VKOA 4A44A 2IUWA 3MYXA 4D7SA 2TEPA 4YLZA 3CO2A 3FJUB 5LATA 4URAA 5DG1A 2XJTA 1W6NA 2FHRA 3PU8A 4DO0A 1S2BA 5JR2A 5G05B 4FO9A 2JWPA 3KSCA 5K0UA 3ST7A 1W3XA 4AE2A 4B1MA 3O1OA 3MIDA 5FBZA 3E6DA 2VCAA 2RE9A 3LDKA 2VPEA 3MI8A 3IAQA 2GALA 1R091 4NIDA 1F8VA 2VUAA 2BU9A 2P3JA 3FHQA 1W0PA 3IB3A 5E88A 3WP5A 3WF0A 4AGGA 4Y33A 2Y26A 4DQAA 5LCWL 1ULFA 1WZXA 2GMMA 2K2SA 1WEOA 5FXVA 2QQOA 5F32A 2YBSA 5KH9A 5C4WC 1V0AA 1EPWA 1LOAA 2CHHA 2ES3A 3MUZ1 4Z1VA 2IDAA 2WS92 2UY8A 1AR63 5TDRA 2GC3A 2J1UA 2VTFA 2HKXA 2P37A 3A23A 3ACIA 2H0DA 2KWOA 4QXHA 2WINB 4S2GA 3GALA 3A22A 4DMIA 3V0AB 5F37A 3AMMA 2OYZA 2M3HA 4NROA 5D8AC 4B29A 4P5OB 4AEMA 1IKQA 3B00A 2WA3A 3FL7A 4XIOA 3VBOA 3RZKA 4PDWB 4HVOA 5JVVA 4AGVA 4I01A 2VJFB 4OI4A 3LB9A 1HX6A 4CP9A 4DRVA 5D21A 2JDHA 3X29B 4QF3A 1BBT3 2WFF1 3FWEA 3RI9A 1PX3A 3I97A 1JODA 2HBUA 4XW3A 3A0KA 1K5MA 2DSMA 2K17A 4CDWB 1YQ5A 3VLBB 2F4PA 1CIWA 4Q0PA 1DBNA 4L97A 2Y38A 4OHXA 2Y64A 4IV3C 1W8TA 1HYIA 1W8UA 3J8F2 2JG8B 4E4SA 4Q4V2 3ZLIA 3O7OA 3ZDVA 1I9RA 2XHNA 1JS9A 1UWWA 1JUHA 4B4RA 3GZEA 2ARBA 3UGFA 1QGLA 2WT1A 1QIQA 1GP4A 3J7NA 3OBAA 3QOPA 4XDOA 1BLZA 1DGLA 1OURA 2Z4FA 1YNAA 3E5UA 3PJQA 4LEJA 4XJZA 2ECJA 4Q6FA 2PHXA 1NAEA 5FZ7A 5K0UC 5JPMB 2CNAA 1RUF1 1YFXA 3BVCA 4IEOA 2OQ6A 1P8JA 5FZ4A 2JECA 2VPDA 2LGGA 4PI2A 4INDA 1SLAA 4JGYA 2G19A 4QT6A 3T2OA 5CFCA 2CV6A 3LEGA 4ZHNA 4FJCA 5B8DA 4MV2A 2KR2A 2YU1A 1XE8A 4MGKE 1KDKA 3B01A 4A7KA 4CEYA 1C3HA 1DCQA 5FPBA 4B4PA 1B09A 5HCAA 2XKPA 2ZGKA 2QQKA 4KGQA 4ZU7A 1XNCA 1Y9GA 1ZZ6A 2BOJA 4IE7A 1LHVA 2IXCA 3FLRA 4HK8A 4JVAA 2ECIA 1NKGA 2R043 4RGAA 5GLUA 2MA5A 3VBRB 2MKEA 3BIEA 1YIPA 4A2UA 4BB3A 1HB2A 1POQA 3DXTA 4QPIA 5L7OA 3RJRA 1Q8SA 4IV1A 5KR7A 1AR62 3CEWA 3SMHA 2ZS6B 4XXPA 3RWNA 3NRUA 2X29A 3NMBA 1H1AA 2BUKA 1VIWB 4WVWA 1MS4A 2EIEA 1PGL2 2Q0AA 5DUUA 4ZS3A 3RPGB 2PQSA 2FDHA 5T5OA 4FPYA 2W39A 5D1LB 5A6ZA 2G9GA 2DX8A 4I0AA 2RSDA 2MNYA 1BBT2 1VMHA 4UI9B 4QHBA 1NUKA 3S57A 5FO7B 3Q1DA 2WS91 5LBFA 4C8DA 1ULDA 2IWGB 3LFMA 2JKXA 2XJRA 3MLJA 5IVVA 3SXWA 2RDRA 3H3ZA 3KT1A 3J4UH 2UY9A 2E51A 5E6HA 2P4EA 2WQ4A 5F3IA 2PAMA 3AP6A 4GIQA 2Y1MA 5FB0A 1ND3B 3O5SA 4AI9A 1GLHA 2CSYA 1QJU3 2DUOA 3KCCA 3QCWA 4EQVA 2PTMA 5LY2A 1ST8A 4TWTA 3ABZA 3QZVA 4FFHA 3WG4A 4CDQB 1H9WA 5A1FA 4RR3C 5GLZA 1N87A 4W4ZA 1QOTA 2VG9A 2RDQA 4I0WB 1DLLA 2YU2A 4IEXA 4QU2A 5F8PA 4ES8A 2QBXA 3LOIA 4D6RA 2F6NA 1V87A 3AYCA 3VBSA 1JTZX 2BNOA 1S0BA 2E7TA 2ZX0A 5JOZA 3LIGA 1APNA 1ZM1A 2CSZA 2WNVB 3J8F1 3NWKA 5FBJA 5JMOA 4Q4V1 1XNTA 4ARXA 2RS13 3V0BB 1R1A3 2V09A 1GMMA 4D6QA 4AQ6A 2R30A 2W46A 5EWSA 5F5IA 2ZHNA 4RGGA 5IAXA 4U36A 2DCKA 1WLCA 2R042 3M2MA 3D8CA 3B7MA 1REEA 3H42B 3ZN6B 4DXZA 5I0TA 4QWNA 1DQ0A 2QDNA 1RIRA 3B3QE 4A7ZA 4YM2A 2MHFA 5EPAA 3KV5A 5GZGA 3AKSA 1QJX3 1V6IA 3KV6A 1GP5A 4NMIA 4XJ8A 4MX3A 3VDDA 3POIA 3VHPA 3IKWA 3IAPA 4FOYA 1UY0A 5EFUA 1WLTA 4YFZA 5AFBA 1IGOA 5D1IA 2M85A 1NLRA 5DAVA 1RUG3 1DQ2A 1CN1A 3PTYA 4EN6B 4BXFA 1C5IA 2GDFA 2WABA 4DUXA 2B46X 1D2QA 3Q8CA 3O12A 2GP5A 3OBRA 3DPLR 5LKTA 4HLTA 3WQ7A 4N7UA 1K12A 1UMIA 4HSJA 1OOPC 4JDOA 3HT1A 3IDEA 4KG8A 5DUVA 5FUIA 3DECA 5LASA 4O64A 2VPGA 3KDEC 2Z42A 1AR61 2EALA 4GH4C 4IC3A 1CPNA 3HAGA 4F83A 2XG3A 2ZCWA 2YG0A 1FMD3 3FHIB 3URFA 1U0AA 2P2KA 3H7HA 1E5IA 1PGL1 3H50A 2KKYA 1NXD1 4P02B 1O3TA 1QJU2 1W2TA 3W59A 3KHBA 4GAZA 5C5TA 3K3OA 2WLPA 4Y22B 2C6SA 5FY1A 5IHRA 2KGIA 2QQNA 1I3HA 1W6PB 5CZKA 3ZXKA 5K3QA 5L36A 2LUWA 4QB6A 1BBT1 3PIJA 2CAUA 2DFBA 3KMHA 2XJUA 4NPLA 3S5AA 3VBFC 2A6YA 5FFOC 1W6OB 2VNGA 3FAOA 4OGEA 3ILRA 4XZPA 4CDUC 2DCTA 2IXHA 3RWKX 5CADA 3T0DA 1OVSA 1JOPA 1MS3A 3G6JB 4HANA 3WV6A 3VKNA 2D6OX 1HLCA 1LGCA 1TQ5A 2VL4A 2RS12 1CJPA 1QJY3 1LRHA 1R1A2 1T6GC 4XF3A 1AL0G 1LEDA 2VZTA 3GJBA 1NZCA 1X9PA 4HZFA 4HPKA 3WP4A 2RJKA 3V64A 2WNEA 3ORJA 1U5ZA 1XSRA 4FPFA 1JYWA 5LRSA 2R1BA 4QX0A 4Q27A 5SV8A 4M3CB 1AVBA 2XXZA 4Y20B 4O65A 4AEDA 3MUY1 3OUIA 3W5NA 2YYRA 1MZ5A 4LUMA 1QJX2 1SEFA 3I2JA 1C8M3 4Q29A 4P9LA 4XBNA 1YJKA 2UYBA 5HPOA 3ACLA 1CESA 1GOGA 2A73B 4YM1A 4UW5A 4FP2A 1RUG2 4J25A 4BWOA 3HCSA 1RUNA 2WAAA 3VZOA 2Y0OA 4OCTA 4CUBA 1POV0 2R041 5KH7A 4CXYA 4XF0A 3LQCA 1F2NA 3VBUC 5A6YA 1HV0A 3MIEA 4ZU5A 3VZKA 4CYDA 1UPIA 2E31A 5FUNA 1EUUA 3M3CA 5FK8A 1URXA 2E7QA 2VQTA 5FMCA 3VL8A 3USUB 3WG3A 4AQTA 3ZMNA 1Z7S3 3M70A 2IVJA 1VP6A 1AHSA 4UT5A 2W1QA 5FOBB 1HXS3 3LEKA 2ZOEB 4KH9A 4LLOA 4A49A 4XUQA 2P3YA 5B76A 3WW2A 1Z0HA 1FNZA 4QF2A 2WWSA 1B35C 2GMPA 4J1WA 4XUTA 4BOWA 4O7XA 4GNDA 4XZUG 1WEMA 2XUEA 3LDBA 4HN1A 2X5IC 1W6QA 1XBFA 2FZ1A 3AMHA 1Y9QA 3N7LA 5J09A 3PLWA 2ARCA 2YQMA 3W21A 1ZRCA 5EZWA 4Q4X3 5HXVA 3LF7A 2D6MA 2G45A 2O1QA 2W52A 2XHKA 3LA2A 1HB1A 3CF6E 1D2SA 4BQ3A 1WLDA 1HW5A 3M3QA 1QJY2 2WT0A 5L19A 4XMAA 4LKFA 1QJU1 4K1ZA 4LE4A 4CCDA 2J42A 3PHMA 1O8SA 2HWB3 2PELA 2R16A 3SH4A 1FBVA 1OC1A 5DUWA 1JI6A 5CIRA 4QDSA 3WNMA 4META 2GMEA 4GWJA 5A33A 3IDAA 1Q8OA 1ZZ8A 5G05L 2IFRA 1MACA 4MHRA 4COWA 1VMJA 1AR93 5C7GA 5FJHA 2E6SA 4UWDA 4XAEA 4BM8A 1C8M2 1JM7A 3FJSA 3U07A 3FLPA 3ES4A 1SFYA 2V73A 2RS11 1OKOA 4NHXA 2ZAAA 4D8MA 4D6SA 3N36A 3H8XA 1R1A1 5JZGB 5HBAA 3I2FA 3RZHA 4QHOA 4CP9B 1W06A 1POV3 3OD0A 4FPOB 2OW4A 4ISQA 3VD7A 1Z78A 2NQYA 4XHXA 2PQQA 5F2WA 3HQUA 1K5MB 3MIFA 1DQ1A 2X09A 1ACCA 2O8QA 3FLTA 1QJX1 1Z7S2 5FY0A 2LAUA 1YXWA 4A3XA 4K3UA 2AZ5A 4Q1RA 1XWHA 5TRBA 2K0GA 5LBEA 4LKSA 4P9IA 4QGNA 1KJLA 1QNYA 5JOYA 1HXS2 2G43A 1RUG1 3ZXFA 2A3YA 1W3VA 2QQUA 3ZVXA 3KGLA 3PUHA 3VZLA 5LEJA 1MEC2 2XGXA 2VW0A 3HQRA 3MHSA 1CAVB 2LS6A 3NW4A 5FZBA 3HN1A 3AKTA 2DCJA 1WCQA 1LU1A 1WD4A 3NNJA 2VZ1A 3RZLA 1L7RA 3AFKA 4BQ1A 4CCCA 1WENA 2Q1MA 3FUQA 4S2HA 1CD3G 1ZBE3 3KQRA 5JXGA 4Q4X2 1XRUA 2XVGA 5BPXA 2DVBA 2LRPA 4ASKA 3GGLA 2KA3A 3DXUA 3NAPB 5FUPA 3ZN4A 4HG6B 5GLWA 5T55A 3VDAA 4CPBA 4F7ZA 4AP4A 2HWB2 4IDZA 4OZOA 4QHZA 2WLQA 4R4XA 3AJYA 1U5IA 2ZBJA 3GM8A 4G9SB 2J22A 4XQWA 1LOFA 1XYOA 1QQP3 5BV6A 3K4AA 5F5AA 3L11A 2YT5A 4OUSA 2DDUA 5B78A 5B4XA 3CJXA 4QGLA 2P34A 5FQ0A 3UT0A 4IV1B 4MG2A 4QKNA 4O62A 5F5CA 5H1VA 2GNTA 1JW6A 4XFGA 1W9SA 3WHTA 3RDIA 2PLV3 3NQHA 4YZ4A 3O1RA 3E2DA 4WZ3B 2Q1ZB 2PHRA 4JGZA 4Z82A 1SBFA 2YU4A 3U4SA 2R49A 4QQHA 4XACA 3TYJA 1QJY1 5C8CB 2ZZJA 5FZCA 1Q3EA 5C9AA 4I2OA 3I3BA 2BERA 2A75A 2FCVA 2DWRA 1O4ZA 2QE3A 4EYUA 2GNMA 1FATA 1UN1A 3A0NA 4UAPA 4AYUA 4N9HA 4DY3A 4YADA 2P6CA 2GC1A 1ND2C 4GMP0 2WNUA 4R4ZA 2L0BA 2QQMA 3ENRA 4PJYA 2JICA 3IT8A 4K8FA 4Q4Y1 4QXKA 4QX1A 2RI7A 5BNNB 3FM8C 1C8M1 2B5HA 3OUHA 5F5QA 5LBBA 1O4YA 4QPGC 1RTVA 1WKYA 1WE9A 4LBOA 4BK5A 4HKLA 2GZWA 3B69A 3AFGA 3B9IA 4IEPA 2W95A 1ULOA 3WD5A 1DGWX 4UI9L 1SFNA 4QKDA 1RITA 1PGSA 3ZSLA 1JZ2A 1X4IA 4P14A 2DU1A 3NVCA 3POSA 1ZBE2 3JD73 2F17A 4CTEA 1YHFA 1NCRC 3VBSB 1Z7S1 4XABA 2VXRA 5ANQA 4AI1A 5SVIA 1FP0A 2ZZQA 2JG9A 1HXS1 2Y6GA 2EGPA 4I7BA 2DVGA 3H8OA 3FN9A 4YVSC 1U12A 4E2QA 4B1LA 1MEC1 2JMIA 1HB3A 2VVDA 4B4QA 1US3A 1QQP2 2HWD3 1MR5A 4Y3OA 3ZYIB 1WGMA 4EWDA 3NG2A 4H7MA 2R073 2OPKA 1RXGA 2L80A 4QAWA 1NE6A 2Y60A 4Q4X1 3H1YA 1QY4A 3RYKA 1MS8A 2PLV2 1MZ6A 3POEA 3OGSA 4RQPB 2VJEA 2LXHC 5I8TA 3ZPV1 1FAYA 4IEZA 3WDXA 1S0FA 2VNOA 3DN7A 4KWUA 2ZGUA 4QD2A 2HWB1 4EROA 4PTBA 1X7NA 2DUPA 3B93A 1NYWA 5FY4A 4AI0A 2ZTNA 4ZZ8A 3ZFGC 4BISA 3U11A 2BEOA 3RI8A 2CT2A 4CCGX 4NO4A 1BVP1 1V9U3 3N7MA 1X8MA 3HN3A 3PUIA 2LGKA 1F5FA 4GMP3 3DUIA 4EN8B 2ZMNA 1NLSA 3IDCB 3E97A 4K6BA 2WC2A 3WW1A 3N7JA 2Y6FA 3WVJA 1VBD2 3CL1A 4BU2A 2JIJA 4Z2AA 1YFYA 2R0HA 2W1WA 3O1TA 1ZRFA 4A0CD 3THTA 5BNOB 3L1ZB 3BOWA 3Q8EA 3SOWA 5C4WA 1GOHA 5A3LA 2QDRA 1O3RA 3TB0A 4BE3A 4EZHA 1CAXA 3FC0A 2ZJCA 1F35A 1POV1 2BGOA 1H6YA 2ZHLA 3GBFA 3R05A 2VE1A 1G9DA 4TN7A 3IWZA 4WM8B 5E1RA 4E8DA 3O33A 3MGUA 2RS53 2ZGRA 4JQRA 4NRQA 1DGWA 3JD72 3MW4A 5JIAA 2VD7A 4HSLA 3L2HA 1R083 4TLGA 2W3JA 5D8AA 4AVTA 5IVJA 2L9LA 3LPFA 4R9BA 2W92A 1X4UA 2WO7A 5FEYA 2D5HA 2JB8A 2ADEA 1WBLA 3RTRB 1C1FA 2ZPXA 3Q8FA 1RB8G 2YHOA 5T54A 1TMF3 3UGGA 1RUI3 4GQ7A 4XEZA 4IW3A 3BU7A 3VBHC 4DINB 1CAUB 2NMNA 1AXZA 1UX6A 2R072 4AEDB 4CCEA 4B8EA 5FZGA 4IV3A 2ZHKA 4JAAA 1NA1B 2D3RA 1ZBA3 2JDMA 4UFKA 3WP3A 4S3OB 4OI1A 4KWJA 4AFCA 1BK0A 3OYWB 2EXIA 4AR2A 3LVRE 4SBVA 1SDDB 2WA4A 1RJ7A 5KC5A 2HYXA 2I45A 5A80A 3H9AA 1ZRIA 3WX5A 4HETA 3PVNA 3FZ3A 1QQP1 1IOAA 1W28A 3WDUA 2YDEA 1CVNA 1NE4A 1V9U2 3U75A 4XOGA 1LESA 3BTAA 4IETA 3C5KA 4LBQA 1C1LA 4CA9A 2FQPA 4YVWC 2EAAA 1UYPA 1I6XA 1R64A 4Y4YA 2PLV1 4HT1T 3AZYA 3O7AA 1KFUL 5FPXA 5KHJA 1PNFA 4L58A 4Y1VA 1UO9A 2VBDA 5I8YA 1FI2A 2EA7A 2WR9A 3POGA 3EB6A 4AFBA 4URTA 2FDGA 2BDRA 4CCMA 2BQPA 5J7MA 2ZGNA 3ATGA 3WNNA 4AK3A 5H9MA 3MBWA 5DZGA 2WZPP 2RS52 3ZIWA 1MPXA 3N9OA 4CCKA 1E5SA 5L9RA 3I2GA 1R082 3FBYA 4LHSA 4YNIA 3TEYA 1ZA7A 1VBD1 4QQPA 1W99A 3H7JA 1IQAA 3POWA 4CCJA 3RMXA 4NHKA 1Y9MA 5C3QA 4WM7A 2WSVA 1UYZA 3D4KA 2LQ6A 1RXFA 1AX1A 1TMF2 1UU4A 1HN0A 1RUI2 3IPVB 4SLIA 5KBFA 2JUNA 1GV9A 3AP4A 3TEXA 1ZYBA 3FEHA 2X8KA 4LORA 1F4AA 4NAMA 1FOD3 1KXGA 5G04B 3EBRA 5F1RA 1QNWA 3T3YA 3C6WA 3JD71 4BQ2A 2GSYA 1UKGA 2BAYA 4Q5OA 4Q8LA 1SLIA 1IG0A 4GD4A 4H2AA 4OQ9A 1ZBA2 5TDWA 3WNKA 3U0ZA 2ZKNA 2P57A 2A7AA 4WBBA 4GWMA 3SCHA 1S55A 4AUQB 1H6XA 5T5LA 4XE9A 1W8HA 4XJ9A 1ZZ7A 1IS6A 5JXHA 4YGDA 4RR3A 4IEVA 5IJRA 2JDAA 4NIIA 4O9EA 2FDJA 1OI6A 1W8ZA 3N7KA 3GCWA 1Q56A 1OSGA 1RYYA 2Q5TA 1X33A 5H9QA 5JOXA 5DKAA 1ALYA 5FPVA 5FPZA 1RVF3 2R071 3PU3A 1KD7A 5GJ6A 2MUMA 3PUQA 4IEYA 2VTXJ 5C3SA 2OZJA 4TXWA 1SHWB 3E6BA 4PDWC 3HWJA 2YC0A 2QFEA 3KWVA 1OQEA 3PLQA 2VZUA 4AI3A 2HWC3 3N3HA 2O0OA 1XU1A 4GB33 5B4NA 4NIGA 1X50A 2H6BA 2OIIA 5JSOA 1SBDA 3U5PA 4ONUA 3RNSA 5J96B 4UP5A 3I59B 4CDWC 2M1RA 4CP2A 1NOVA 3DDTA 2JDUA 2F6BA 3D0JA 1H9PA 1V9U1 4PQ9A 3VZNA 4IXLA 3WNPA 4GMP1 2JG8C 1OVPA 3U78A 1QDCA 2HEWF 3AB0A 2WNOA 4LJNA 1FXZA 1PK6B 3I8TA 4O61A 4UW4A 1IPKA 2WWJA 4WVZA 3WQBA 1VJ2A 5CG8A 5FYMA 2ZMKA 1UY2A 4OMDA 2HYED 3T7LA 4XC9A 2E32A 3M99A 1PO23 1GWKA 1XYPA 4MGSA 4P9WA 4CPBD 3HD8B 2VMHA 2J1SA 4UFMA 2K46A 3GNEA 3O0XA 1OOPA 3WLUA 1W6MB 3KNVA 2ZX2A 3PVEA 2KWNA 3GYDA 4Y5TA 1W8WA 2R1DA 4GH4A 2RS51 2R7EB 2MIQA 2QQLA 3UKTA 1FOD2 3JUUA 1SLBA 2KE1A 2VBPA 1RHI3 1AL22 2J7MA 1R081 2ZEYA 3WT3A 3C3VA 1A8MA 5IVYA 2XJQA 2FZ2A 1RMU3 1OLRA 4P08A 2QVSB 5I0SA 4JCKA 2OS2A 3CJIB 1TG7A 2C5DA 3VBRC 4DFSA 4FK5A 1G8WA 4IE5A 4AYCB 1PGW2 3ZDSA 5CFDB 4UF0B 5CEHA 2VULA 2HH9A 2MNGA 1TMF1 1HKDA 3CZUA 5FYVA 1NXMA 1RUI1 3VBFA 4FSJA 2VMFA 2FD8A 4DXSA 2V5YA 1PO13 3OSDA 5FV3A 3ZYQA 3BPSA 1RVF2 3ILNA 5F6LB 4CDUA 1K2FA 2WNUB 3VL9A 3RPGC 1ENXA 3BU0A 1N3OA 2OUJA 1BORA 3OEBA 2YUEA 1NCQC 2M6MA 1WGPA 1ZBA1 4W65A 2HWC2 3W58A 4WZ2A 5C11A 1K5JA 4YW1A 3RYRA 2ORXA 3M3OA 3LQJA 4BQWA 4GB32 5FOJB 4KNCA 2FSAA 1M4WA 4LA3A 3EHKA 2PXJA 3B5LB 3SH3A 5FZDA 5JI7A 4Y5Z0 3WF4A 4F3JA 3I3MA 5I3LA 5JCTA 1MVQA 3D6EA 2NP0A 5EQUA 1O8PA 4Q0UA 2QIZA 4E9KA 3OBTA 5A3UA 5IFTA 1J83A 3BPZA 3GBWA 1OLMA 1X36A 4FAGA 2XDVA 1VFYA 4CDQC 5FY8A 4BYYA 3D82A 4IGOA 4LBKA 4AG4A 2VOWA 1GNHA 1PO22 4B3NA 3ZFEB 5FLIA 2CSGA 3FE5A 4L8QA 3VBUA 5CVRA 4AHYA 3OOXA 3EXUA 5DQ0A 4YSFA 1W9TA 2E6VA 4QB2A 3WF2A 1HQWA 2O14A 4GKYA 1ZVFA 4ZDTA 1IS3A 2AEYA 2WNVC 1J1LA 3SLIA 3MW2A 5ABJB 2ERFA 1VALA 4LHKA 3PVBB 2XUMA 4A4AA 1GWMA 3ZFFB 1RHI2 5J37A 3N35A 3LCPA 2WQZC 4JKLA 4YZ2A 2YUCA 3GV4A 1RMU2 5AIUA 1JOJA 5FYUA 4OHVA 5LZ6A 5FDBA 3ZXLA 4YM0A 1B35A 3T2QA 2VJEB 4TLFA 3AP5A 3O1UA 5FYZA 1Q8PA 5D2AA 2ZETC 1WFKA 2X5IA 5FMBA 3FANA 1AXKA 1OH3A 4ASMB 2DTYA 2OQ7A 2PAKA 3KF5A 5BNPC 1PO12 3I4IA 3M3IA 4LIUA 1F62A 1QXPA 2YROA 1FOD1 2G9FA 1N1TA 1OKQA 2D44A 2ZGSA 4LO6B 4ZXKA 1KRIA 4IEQA 4BHPA 1GNZA 2I50A 1AL21 2WO3A 3WXPA 4LITA 4Y5SA 4MLOA 2C9AA 2SLIA 4FFGA 4PIXA 4UBGA 2QQIA 3NJYA 4AI2A 4LK7A 3D5OA 2B8MA 5CB7A 3TBDA 4E27A 5IK8A 1PGW1 2VO5A 3OCPA 3I54A 4ZONA 2RJ2A 5DZEA 1I1EA 4AVSA 1CAXB 3T4VA 4YGEA 4HOOA 3T2TA 1VBC3 1D7PM 2CWSA 1VB4A 3C7FA 3OD4A 3ZSJA 2PHFA 5B79A 4QM8A 2VU9A 4PBOA 4CRQA 3QH7A 2UU8A 1O59A 1RVF1 4AEJA 1LOCA 1Q5OA 2JEMA 4IERA 1GWLA 1ULCA 5JOWA 3NNFA 2VQAA 1W03A 2E61A 2ZA9A 1ZX5A 3S30A 1WIMA 1W8NA 4NPRA 1KGYA 1DIWA 1REDA 3G7DA 1YYNA 2F42A 3O14A 1XPWA 2HWC1 2OXQC 4JC1A 1WCUA 1GNYA 3DPRB 4GB31 2H0VA 2W9XA 3WP6A 3AM2A 4LK9A 2YSJA 4AFDA 3MF6A 5FXWA 4CUAA 3PTRB 5TSWA 2H6CA 2PHDA 5T5JA 4QM9A 3KT7A 3OY8B 1V70A 4BA6A 4M01A 3M7KA 2W08A 4RN5A 5CKMA 2CONA 2D93A 4MUVA 2JJ6A 5DG2A 4YWAA 5J1XA 2VOVA 3I2OA 4FTEA 1EY2A 1AYM3 2ZHMA 1PO21 1O91A 3DKQA 1X82A 5KXDA 4ZUXU 1PVXA 1PZ7A 3ZYRA 3NJZA 3O0WA 3ZX7A 2ATFA 4AHXA 2DBNA 5APAA 5GZDA 4L7XA 4V3KC 3UK9A 4UBHA 3WCRA 4JHTA 1EP0A 4RFT0 1SPPB 3AKRA 5KWRA 4LBQD 5GLTA 4FOVA 4XUPA 1RHI1 1WEWA 3BI3A 2VVFA 3R6SA 3BUCA 1RMU1 4LADB 2AUYA 3NKGA 2BFUL 1UW8A 1BYHA 2O8OA 3BB6A 5J3UA 1CJDA 2C1FA 4M3CF 2KR4A 2WJSA 1MQTB 4Q4W3 2VZSA 1JUIA 3MEPA 1VD4A 3LRQA 3P1IA 4LHLA 4CU8A 2KGGA 2XBO3 4N53B 1VBC2 2ARXA 5JDBA 3KD4A 3BIWE 4CU6A 2C4XA 3AL5A 3MDPA 5CBLA 1PO11 3AZZA 3W20A 3A7QA 4OUEA 2ENRA 1ZZBA 2VZRA 2OT7A 4N43A 5EV7A 4ATEA 2RJLA 4MGTA 5FZKA 1LOEA 5FWEA 1VR3A 2VNVA 3HPNA 5GM0A 3RZGA 3VKMA 5JWPA 5DDJ3 5K9YA 1RJ8A 3NV4A 4KL1A 3GBGA 4WM7B 5LB6A 3IDBB 4CE8A 4LOTA 4X6QB 1OMIA 4B86C 1WLWA 4N90A 3WF1A 4ZZ5A 3ZPVE 1KQRA 4ZXEA 5GZCA 3GZTB 3CLPA 3MLKA 4XFIA 3TNQA 1ND2A 2A3XA 1Y43B 2YBPA 3C7OA 3M1HA 5JIUA 2ECGA 2D97A 1AR82 4FAHA 4F52B 1OHFA 1FV3A 2J1RA 3GCXA 3ZYPA 3K46A 1S0CA 2EXHA 1CZSA 4QPGA 4XURA 1JYXA 2FCUA 4ORFA 3CHXA 2JENA 4CDXA 2VUDA 1DF0A 5AFEA 5JSPA 2VECA 2KIZA 4E4HA 1AYM2 2A71A 1W9WA 2ZX1A 1EPZA 4Y1ZA 1QMJA 1YUDA 4GJYA 3VHNA 4Q4Y3 2YC2A 2CL2A 1GQPA 5FK7A 4OQ8A 2ILMA 1NCRA 4LPLA 5G04L 4GNGA 1IYMA 1N1VA 5EXOA 5JZGC 2EXUA 1U5YA 3M4FA 1BCXA 2YV8A 5DAPA 5JLVA 4YW3A 4YVSA 3H1WA 4IESA 2ECTA 2PFWA 3V43A 2AREA 1W8OA 4Q4W2 1DQ6A 1UQXA 1WMDA 2D7FA 4Y1XA 2XWJB 4CP1A 1H8TB 3AL6A 3Q8BA 5JMCA 5EYAF 2XBO2 3HNBM 3ECQA 3RZMA 2WT2A 3OEAA 1COV3 1EUTA 2CKLB 2LALA 4OULA 2XEUA 4I3PA 5BY5A 1D4M3 2Q8CA 3O1SA 1CAWA 3U5OA 5A32A 2VMCA 1STMA 1QJZA 1HQNA 2YFZA 3K75B 2WWUA 1FYUA 5A7PA 4AF9A 1OT5A 3O34A 5SV5A 1MEC3 4P9YA 2IXLA 4BBQA 3MZHA 5DDJ2 1XE7A 2CU5A 4E2SA 1G9CA 2FMYA 3GXUA 3ZFGA 4RS5A 5DAXA 3T0AA 1T1HA 1W6NB 3HR9A 1VBC1 1W39A 5JR7B 3AVRA 1PHMA 3HCTA 4GH4B 3HNYM 5K0UB 1LULA 2HJIA 4NRMA 4ASLA 3NAPC 1AX2A 2VCBA 2WIIB 4IE6A 1SDWA 2Q4SA 4DXTA 5KHKA 3NJVA 1GSLA 2LRIC 1UOFA 1C5HA 2W0XA 4P9JA 3WOGA 1YEWA 4PIZA 3O36A 4W6WA 5LWBA 3N9MA 4MGQA 2XJVA 4QXCA 2BFUS 1JH5A 1AX0A 1KEXA 4A7YA 2YB7A 5SVIB 2H0DB 4Q4Y2 1GUIA 2JKBA 1UOBA 4JRAA 1AR81 5EHDA 2LXPC 1H2KA 3R4DB 4LXLA 4XDQA 1IZ3A 5A7NA 4XHBA 1VRH3 3C7EA 4KBBA 5C8CC 1ZZ9A 3BOPA 4LT5A 1NLQA 1PM4A 4HKOA 2EICA 3VBOB 5FZOA 2DUQA 2RR4A 4A3ZA 1BKZA 4MGIE 2Y8KA 1AYM1 4LJHA 4Q8KA 2ECVA 5FZEA 4L99A 3BGAA 3VBHA 5FZ3A 4PF1A 3WSOA 2EF6A 1GBGA 1COV2 3AMNA 5BNNC 2YZ4A 3HT2A 1FPN3 1NQDA 3UL2A 2FFWA 4XI1A 1D4M2 2W2IA 4XIKA 2ZGTA 1S0IA 4FTBA 4OFGA 4RYDA 5B77A 1ENQA 3LSDA 4GXLA 3DV8A 1S0DA 2EXKA 4RGKA 3IMNA 4YG0A 1UF2C 2QZ3A 2ZX4A 1UZVA 4Q4W1 5A7OA 3SKVA 2IXJA 3OPTA 3SUBA 2W68A 5KH3A 1XJAA 5FZ0A 2L7PA 4L11A 2XBO1 3KZ4C 4L9BA 1HJFA 5EJ1B 4D7YA 3GZUC 3MIBA 4JGYB 5CFCB 3THPA 1QH6A 4P00B 4YFWA 4XXAA 1XE0A 4YVWA 1IS4A 3ELNA 3AYDA 2GP3A 4CEYB 4H14A 5IW0A 4DEVA 1LOGA 2XJSA 4LMFA 3LKJA 5FPAA 3P3NA 1AXYA 1DYOA 1WCDJ 4YZ3A 2V4AA 2QTWB 2HEYF 4AOCA 3RZZA 1J3QA 5DDJ1 2QQPA 2L43A 1VAVA 1OD5A 4NIHA 3ZXDA 1LNSA 3S0MA 2LN0A 4QPIB 5A7WA 2J1AA 4FPJA 5L7OB 4OGCA 3O70A 4LLBA 2JDZA 5JAXA 1EAH3 2YGMA 3IN9A 3INAA 3LAGA 2XP0A 5DABA 3O37A 2B42B 1UMZA 4COVA 1YI7A 4GJZA 1L7LA 2CGOA 2IVIB 3RVHA 4RQPC 1VRH2 2BJSA 4LLFA 1X9TA 4Z07A 1V00A 1JXNA 3VUOA 2RS33 3LA3A 4OLLA 3LPGA 1LDJB 4XYXA 4YZ5A 2J1TA 4KBZA 5GZFA 3ZIXA 1J3RA 1VAMA 1F15A 3CZJA 3OJBA 2JDPA 3VB9A 4V2WA 5FZIA 5LEKA 2AR6A 1K3IA 3MW3A 3RJ2X 5K8SA 1H2MA 2BWAA 1G9AA 3F2ZA 5FYTA 1VBD3 1FPN2 1S0GA 2HWF3 3N9LA 3KCYA 1WCKA 3QLQA 5BNOC 1QJFA 1IPJA 3SHRA 4RL7A 1LHOA 4Y4RA 4BQ5A 2VOXA 2K1JA 3H3UA 2G9ZA 3POYA 1XB9A 3PL0A 2H0BA 4Z92B 4WM8C 5A3OA 5FZAA 1XU2A 2JIGA 3B94A 5FZFA 2OKXA 4ES9A 2E26A 2PMWB 4JX0A 4PT6A 5FWJA 1COV1 2QQWA 5IVBA 2ECNA 5KXEA 4QX3A 5FERA 3N9PA 3S7IA 3ACFA 4PDWA 1D4M1 1H1IA 1UD1A 3AJZA 2KYUA 2VJFA 4R8PK 5TABA 5FYYA 5JPNB 2GNBA 2EODA 1O5UA 4AQSA 4MH0E 5EP9A 3USSA 1VLNA 2WKKA 4YYOA 5L9VA 2C2VS 2ADDA 3Q8AA 2YPJA 4CDWA 1CQ9A 1GOFA 4E4ZA 5FCCA 4Y24A 1YLLA 1KFXL 1EAH2 2D43A 1ONAA 5IUQA 1JU3A 2JG8A 2QQVA 2OPWA 3VDDB 1NA1C 1SG3A 1VAKA 4ZY9A 3SKJE 4S3OC 3B9CA 3CIHA 1W2AX 4WZ0A 3WY6A 3LZZA 3WQ1A 3ZYHA 4C90A 3GHNA 2RS32 4NHYA 3EMRA 2VNRA 1UNBA 4M3CE 2D98A 4H55A 2JX9A 5C3PA 3LEIA 5K7PA 5HV4A 4ZS2A 2D6PA 4KU7A 3CBNA 4L2NA 4XBQA 5LKXA 1ZA4A 1JZ6A 3WNXA 5DMYA 1HJGA 4LKAA 2B9UA 4AAXA 5F3GA 3SOUA 3U5MA 4TKPB 3K2OA 2FDIA 4DUVA 2MA6A 3M3EA 1GFF2 2ARAA 4CCNA 4I7DA 5IATA 2HWF2 1Q8QA 4ZKTB 4P5YA 2UWAA 1VRH1 5FKCA 4I3GA 2QCSB 2X10A 4N43B 3N9NA 5B2GB 1O6UA 5EYXA 1OH4A 4D94A 4W8JA 4CEWC 3O1PA 1DG6A 4I7CA 1QOOA 1RUH3 3THDA 5FP4A 2XOZA 3LGRA 3WR0A 2ZGMA 1V6OA 2RDNA 2NLRA 4UYBA 4HONA 1HRV3 2DCYA 1PIV2 4V1PA 1E57A 4DY5A 2WRAA 2ZKLA 4NE9A 4WZFA 4B7EA 2I2SA 2V5DA 5J98B 1O7FA 1LODA 4R9AA 1ZREA 4M4PA 2JMDA 1WW6A 3M63A 1FPN1 1O4TA 2ETEA 5L9BA 5KHGA 3MFCA 4IEUA 1NCQA 1RUE3 3LOBA 4XFHA 1BMV2 2JE7A 2DU0A 2PYTA 2ZABA 2HDPA 3V65A 1O3SA 3LJUX 2XVLA 4XF9A 1PMJX 1YWKA 2VMGA 4RA0A 4UFLA 1Z6UA 4CDXB 3MHZA 2P5BA 3ZYFA 2QKDA 4C1XA 1W2NA 4HPKB 3WG1A 1ASJ3 1JYCA 3S6PA 2GH8A 5FYIA 5E8AA 4QQ4A 1YCIA 3QBQA 4Q0VA 4QKBA 1N3PA 3ZNIA 2EIGA 3ZVZB 4KU8A 1C4RA 2XLAA 3AKQA 2R0FA 2WL1A 2XB1A 1CIYA 5C8WA 3BODA 5LKUA 2TUNA 4CUCA 1DGRN 2X53S 3VV1A 2WYSA 2B0OE 2FD4A 4MGZE 1A78A 5J48A 4CDQA 2XWBB 5C3OA 4MSXA 1XXNA 4Q2FA 4BXSV 2IQJA 1OA2A 5FXXA 2XVKA 4RHV3 5G0FA 3N9QA 3PJYA 1UAIA 4YM3A 2ZX3A 3C7GA 4DNYA 2P17A 2R32A 1M06G 5HV0A 1A6CA 1DZRA 4WVVA 4BZ4A 4PLOA 1EAH1 2WNVA 4PLMA 4A6OA 2D3PA 3RZJA 3RYPA 3V0BA 1JZ3A 4BHWA 4LTAA 1UKRA 1SLCA 4NOTA 1S0EA 3D0SA 1WEQA 1W9YA 4JKMA 1AJKA 4WVMA 2KREA 2RS31 2VNFA 1RUH2 3MIHA 4LBLA 4N7IA 3KLSA 3MPBA 4NWWA 3RQ0A 2A6WA 1WMEA 1HRV2 1LJ7A 2K9ZA 1W6QB 4RS5B 3ZFGB 3DWDA 5BNPA 2RG4A 4GWNA 1MVEA 1PK6C 5FP9A 1TME3 1DGRA 4ISRA 5HI0A 5FP8A 1GZWA 2ORZA 2HWF1 2D5FA 3H7YA 3KVAA 1RUE2 1JU4A 5F6KA 3TN93 1DHKB 1MS0A 5CYYA 1UL9A 2C2LA 5H1TA 1KS4A 2W47A 2MPFA 4EJRA 3WCSA 2G6QA 1WW7A 2HWE3 5FY5A 4DXRA 4GULA 1ASJ2 4DPNA 2CDPA 1W0NA 2JD9A 3K77A 1YRZA 2VGDA 1WMXA 5DZFA 5IVCA 2NAAA 4LO5B 2Y6KA 1PIV1 4LR4A 2DFCA 3ZSEA 2RM23 4CXXA 3HBKA 4QQLA 5FTTC 5A33B 1DZTA 1PM7A 4MYEA 3A21A 2N7GA 5A3PA 1AL23 2WQ8A 4GA9A 2G4IA 2KM2A 4WV8A 1JM7B 1MZFA 1BMV1 1OUSA 1EYBA 2C26A 3CJIC 1WA4A 4Y22A 5LA0A 2A6ZA 5CFDC 1CGPA 4PQQA 4RHV2 3CQOA 1NZIA 1JYTA 2OWAA 5DN2A 2BZDA 3L1XA 4DRRA 2KWJA 2VMDA 4BCUA 3U4XA 4LK6A 4FIPA 1WEVA 1ULEA 2YC4A 3BKZA 3R4UA 2VQUA 4LIVA 3ETPA 3I7DA 1REFA 1XQNA 2YHJA 4FCAA 4LUKA 3ZKYA 1QDOA 4XFBA 2VZQA 1SACA 4JZRA 3VDCA 4CVUA 2BPA2 2WN2A 5DAQA 3O0VA 1RUJ3 4ZU4A 5CAZA 4WA6A 2BVVA 2L5UA 3SH5A 5FPUA 2OUHA 2RMU3 4OZXA 2ZEZA 2B4KA 2Y33A 3I2IA 4QX8A 1JOCA 4YAXA 4M3CA 4P5HA 3AYEA 4Y20A 3WNOA 3H8RA 3VD3A 2JDYA 4R52A 2VY0A 4MGYE 4BLJA 3HQXA 1UY3A 2A1XA 1ZZCA 2W87A 5E89A 1YC61 4N8MA 2VR4A 1TNRA 1XSQA 1GANA 2W1UA 2Y6HA 3QD6A 2BYVE 5EJZB 5FMOL 5FIXA 4W50A 2FMDA 1TME2 1VBB2 3OG2A 4QDQA 5FLHA 3UJOA 4ATFA 2ZGOA 4R8HA 1X4JA 3UKNA 2B45X 5FB1A 3BYWA 1D0GA 1W90A 3HIFA 5I0UA 1DQ4A 5LA9A 3TN92 3ZFEC 1MZEA 3FUOA 1S0JA 5HCBA 2D6LX 1RUH1 2HWE2 4WZCA 1UPSA 1WILA 3GHMA 2PNXA 1LDKC 4V2VA 3USUA 1HRV1 4EE2A 5IT6A 4N9IA 5ABJC 1MBMA 2RM22 5A7WB 5FQ0B 1BVVA 1VBA3 2DF7A 4G4FA 3ZFFC 3WW3A 1LAJA 3EB5A 3ZR5A 4XDPA 3T0BA 1JYIA 1RUE1 4JGZB 4UW6A 5A1AA 2OA2A 2QICA 2FDFA 5ACA3 2LDRA 5C9AB 4LULA 1WMFA 3K4DA 3VDBA 2PHWA 4DZGA 1DDLA 1ASJ1 1WEPA 4Z0RA 1PX4A 4FVVA 1UU6A 3LD8A 3SEEA 2QNKA 1WCSA 4NJ4A 1BQPA 3TWIA 1LKNA 1UOGA 2VCMA 5BYNA 4K1YA 1JBCA 1OQDA 1YQ6A 1LGNA 1TEIA 4M0HA 1RINA 1XNDA 1RUJ2 2PAEA 1BJQA 2LM3A 2VQ0A 4FXKB 4Q1PA 4QX2A 2RMU2 4PHZA 2GN7A 5FY9A 4RHV1 5HXMA 1JZ5A 3T09A 5H9PA 5A3TA 1VRBA 4X6RB 5BXXA 3ZVYA 3SNMA 4E4DX 5HCFA 4AGRA 3FFZA 3AZXA 5JSRA 1T2XA 1NX9A 4NPMA 2ZEWA 3VHRA 2RDSA 1SQ4A 4YG6A 4X8NA 3AP7A 1ND3C 5ISLA 5IK4A 2RR13 3NKTA 1WA6X 3E5XA 2XL7A 3JBG3 5T50A 1W04A 2BNMA 3MF9A 3MO4A 3OTFA 3TAYA 5JZGA 2MNZA 3NNGA 2A5ZA 4TTGA 4GNEA 4H9DA 3HVDA 2JG9B 3KQ4B 2B9VA 2DVFA 2HYKA 2YSMA 3DPRC 1AR73 1F4HA 4D0QA 2FUIA 5T3NA 4AHWA 2VOTA 3SCGA 2YMZA 2ID4A 4GALA 3V56A 4DUWA 2SBAA 2WO2A 2XJPA 1E5RA 1D4VB 3POFA 2B39A 1MS1A 1WUVA 1ZNPA 4H3WA 1CZTA 3BTXA 2AGSA 5I8SA 4IL7A 1VBA2 4CP0A 4LBJA 4NUBA 2FUUA 4QQ2A 5AITA 1UZZA 2LGVA 1TME1 1VBB1 2BTVC 3ME2A 3MICA 1W9FA 3C7HA 4IQPA 5BNPB 2MD7B 3JUEA 5IVEA 1SFPA 3T6RA 1QEXA 2IXKA 1WBFA 4HKWA 1V6LA 3TN91 1SMVA 1IG3A 3NV1A 1CAVA 2CRRA 2EVXA 1OUXA 4LNVA 3U10A 4LQRA 2JM3A 5ACA2 1UYXA 3I3EA 4D69A 2MD8C 1H4GA 2HWE1 1PZ9A 5SVYA 1JZ8A 2GC0A 1WEEA 2ET1A 2JD4A 2TBVA 1DQ5A 3ZYBA 2UWBA 2WZR3 2CYFA 2RM21 5FO9B 4K8RB 1UOJA 3LA7A 4LKEA 2J1EA 2V4VA 4OHZA 2WO1A 4OVEA 3ZXEA 3O47A 1H2LA 5LK5A 3NAPA 1E5HA 3PUAA 3PVOA 4UOJA 5KC6A 5C13A 4UXAA 3RRDA 1V6MA 1G25A 2VOKA 5FMOS 4LO4B 1CX4A 4NWVA 5I91A 1MQTC 1N47A 5C4WB 4BK4A 1NY72 5F3CA 2WYFA 1GZ9A 3KB5A 4N53C 2LW8A 3FHAA 2I74A 1Y7BA 3DYPA 3PHDA 3PURA 3S7EA 2XOCA 2RV9A 2W94A 3EQEA 3J7LA 5ERLA 2JMJA 3SQOA 4A42A 4AHZA 2LROA 1OF3A 1UZYA 4BQ4A 3JB8A 4PCRA 4OHYA 1OA4A 2RR12 4L92A 1PMIA 4PF5A 4NIAA 2J1VA 3JBG2 5C8CA 4N4FA 4A45A 5D8AB 2XL9A 3FMGA 3WQ0A 4FTSA 1BHGA 4NHMA 4XILA 1BEV3 4EV0A 4QMAA 1NCQB 1RGSA 3UJQA 1RUJ1 4WM7C 2DVDA 2IC1A 5FXZA 2VPBA 1F5JA 1AR72 3ZR6A 2RVAA 1GR3A 2RMU1 4K20A 1F9KA 2IZWA 1T6BX 2DCZA 2CY6A 2HLEA 2VW2A 3I3QA 3JXSA 4TZDA 3L9JT 4C0HA 2VPVA 1BZWA 1J58A 1QXJA 1XNKA 3LIHA 4XJAA 1AR83 5A7QA 4GNFA 1ZRRA 4FBFA 1RUC3 4AZZA 3BN6A 1S1AA 1U5XA 3VZJA 5BNNA 4X3GA 4R2YA 1W0OA 2C0ZA 2XQRA 3ASIA 4IV3B 4XUOA 3R4SA 4Q26A 3P3PA 2ZGPA 2JXAA 4AFAA 1VB2A 2AACA 3AMPA 5C3RA 3SHBA 4XVHA 5GALA 3T1LA 5FZLA 4I30A 3LEMA 1HN1A 2AENA 3AZWA 1AYN3 4QPWA 1LTEA 4LKDA 2VMEA 5F7UA 1MM2A 3O1VA 3W5MA 2R063 5LA1A 3KT4A 1EV13 2VUCA 2D8SA 1KDMA 1ODMA 1TZOA 3VD5A 1F31A 2WZR2 5H9RA 2CGPA 2Y0IA 1IQDC 1UXXX 3MV01 1Y4WA 1G6NA 1N1YA 1VBA1 3LE0A 2CDOA 4ET7A 5IYYA 4LBQB 3AZVA 3KQIA 3IBMA 5LA2A 4COYA 3KCXA 5B75A 4NR1A 4DEQA 4YW2A 1I5PA 2Q8EA 2ECWA 4AVBA 1HRI3 1SBEA 1GICA 3C8XA 5GKAC 2E6RA 4TSVA 4R7EA 4B7KA 5ACA1 1H8TC 4WVMB 3THCA 3VD4A 2YVRA 2BWCA 3ZN5A 1UU5A 2AH2A 1JOBA 1RUD3 5F39A 3SISA 2UWCA 2XQXA 2Q8OA 3WDTA 1NT0A 4DOUA 1S2KA 2FDKA 2WUHA 3EYPA 5E16A 3WW4A 1OXCA 1Q8VA 3ZO0B 4UFIA 1QKQA 2IXIA 4RQPA 4NN2A 1IS5A 1GZWB 4LBMA 3SITA 1G9BA 2P3IA 4LOSA 4I0BA 1BEV2 3ZMOA 5CNAA 1L3JA 3GL6A 4YATA 2P1BA 3BTZA 1H4HA 4XCBA 5A1LA 1PZ8A 3TOJA 1LHUA 1D0HA 1NY71 4FQZA 3WHUA 2VZPA 4EWAA 5FP3A 3ZKUA 4PBPA 5A3MA 2VTXA 2LGLA 3VN4A 3PMEA 4JDNA 3I2HA 2YPDA 3A4UA 5IAVA 4CUGA 2OVUA 2WBKA 5DXDA 1IKPA 1RUC2 4KWLA 4NHLA 3ZPOA 1QU0A 4FFIA 4CSWA 1WEUA 2RR11 2XB6C 5GLVA 4ITCA 3JBG1 3E6CC 5BNOA 3AXEA 1ZBDB 2XONA 2ZMLA 2XOYA 3JB4C 3LDRA 2BGPA 2PHUA 2E53A 4QX7A 4X8PA 4QPYA 2UZGA 2EIBA 1AR71 3OBZA 1AYN2 3LSEA 1NQJA 1ODNA 4LO7A 4WM8A 1WESA 4XETA 3O35A 3Q9OA 3PMSA 1NG0A 2XR4A 1OLQA 3RGBA 2R062 3NSTA 4RR3B 3WUCA 3WF3A 2DTWA 2UYAA 1EV12 2EIDA 4I02A 3WEZA 2KU3A 2VCCA 4KI5M 2AEZA 2TNFA 4NN0A 2W91A 3S5QA 3TEWA 3VBOC 4IGPA 4MHUA 4QGMA 5BNQA 5LKZA 3CU7A 3MFAA 4JDMA 1RMDA 1C28A 4Q0QA 3WDWA 1VBE3 4YW6A 1HRI2 3HEIA 1LHWA 3DGTA 2JB4A 4BQYA 4U2AA 2YW8A 3SCFA 1LENA 5C6CA 1VE0A 5FZ6A 1CAUA 2MT5A 1K5MC 2VAUA 3M8LA 3UNPA 1C57A 1RUD2 4FPHA 3KV9A 3IZOA 5FAXA 5DPNA 1UY1A 4ZQLA 4YBTA 2WZR1 3KS7A 1NA1A 1H8VA 4CA1A 4E2GA 2Z5WA 4CU9A 1HV1A 3OYWA 1DLCA 4MSVA 3R0RA 5FMDA 4YARA 1AZDA 5FLJA 3LFIA 5EJ3A 5I93A 2A3WA 2XOMA 1FNYA 4BDVB 5FREA 4M00A 2BVBA 2V72A 3JCIA 1J3PA 4R9CA 3SC7X 3ZYGA 2D6KA 3ILFA 3TNPB 1J59A 2Y34A 1H2NA 1OOPB 4GB0A 1MS9A 2XLFA 4AXOA 4JGYC 5CFCC 4IUGA 2Q8DA 3K4ZA 2WN3A 3UETA 4FP3A 4FI9A 1FMD2 4CEYC 3UKVA 1R1ZA 4Z2WA 3GZAA 4PLNA 4P9GA 3NNLA 5FR3A 2OX0A 3OGRA 3VZMA 3MPPG 1BEV1 1AUYA 4KG0A 3RPQA 4CEWA 4F8AA 4HFSA 3ASLA 2GH2A 2EA6A 1FT9A 2ZACA 3ITQA 4XJWA 3VK6A 2NN8A 4QPIC 5L7OC 4HVRA 3ALQA 3JU9A 4IV1C 5JXIA 1LU2A 3VBFB 2D40A 4HK9A 2CGNA 3GF6A 1YQ2A 5F9TA 1ZRDA 1RUC1 4CDUB 5FZ9A 2JE8A 5JG6A 2Y1NA 2ET7A 1IHMA 1S4CA 4K9SA 3WINE 3EJKA 2JE9A 1HQLA 1GU3A 2XKOA 3U5NA 3AK0A 1VBE2 2HBTA 3IHPA 1OA3A 4FXGB 1HB4A 1AYN1 3IPVA 4FQ4A 2GN3A 5FYBA 4AQ2A 1DZQA 4LBNA 1TNFA 3UGHA 3H1MA 2R061 3DEMA 1RL3A 2KXLA 1EV11 5AVAA 1FX5A 3WG2A 5CG9A 3PNAA 2YYOA 1UX7A 4J6GA 4FPGA 1VMFA 2KKXA 3AP9A 4H7LA 3P5BA 4JRLA 2GAUA 1H0BA 4FFFA 4OI2A 4YGCA 2WZ8A 3ZXJA 1GZCA 3HJRA 4OHWA 4XTPA 1AF9A 4JTNA 3H8UA 1DU3D 1DP0A 1HRI1 3KVBA 1YQ8A 3ON7A 5J3XA 4P9XA 4MXVA 2JDNA 3VBUB 3VD9A 2YURA 1HDKA 4NRPA 4C9ZA 5F3EA 4AVCA 2DVAA 1DCSA 2Y6LA 1RUD1 3VBSC 3HOBA 2Z2SB 1O3QA 3WNLA 4Y1UA 2NMOA 3ETQA 4A4CA 3P6BA 4YABA 3WUDA 4HVQA 5BUVA 3DCQA 4OI0A 4COUA 3I3DA 4CZSA 1O5LA 3AKPA 4AW7A 1W05A 4GWIA 5DAWA 3I2DA 3PDQA 3W9AA 4CCLA 5HCHA 1B35B 4IGQA 3I59A 4CU7A 2PHLA 3D3AA 1AJOA 5IWFA 2X5IB 2KWKA 4IC2A 4MXWA 1UXZA 3VDDC 1OPMA 1PK6A 1XC6A 2VC9A 4XPVA 1U6GB 5SVXA 5AC93 2EAKA 1VYXA 1FMD1 5H1UA 1OPOA 4XQDA 4XFAA 2HEVF 1HIXA 5LCWB 1YO8A 3ZPYA 4S2FA 3RMYA 3DKWA 3VKLA 2DURA 3F95A 4N3WA 2KD7A 1TVGA 4A41A 3NV2A 3KGZA 2RHPA 4YPJA 1C8NA 2IFWA 2A6VA 1Y3TA 2C9KA 1W6MA 4XFCA 5H9SA 2K16A 2WSUA 1GZTA 5FZ8A 3RG0A 2NM1A 3ZSKA 4MADA 3U14A 1K45A 4K7JA 1AR92 2XPJA 2I07B 4IE0A 3VHOA 5JI9A 1UY4A 1XNBA 4N43C 3SEPA 4KGGA 2CTVA 2E63A 2OZ6A 3CJIA 1DYPA 4DB5A 2L75A 1YJLA 4BJ0A 2NYYA 4AYCA 4EZ4A 2JRJA 3I2KA 2VP7A 2PN5A 4O9GA 1XNAA 4UF0A 5CFDA 3RS6A 1VBE1 5F2SA 2JDKA 4QDRA 4OMCA 4K40A 5C33A 2ZAHA 3UV9A 2YHNA 3QACA 2WDBA 4BPZA 1PIV3 1QF3A 2W5FA 1SZBA 5EIYB 3V0AA 1ENRA 4YC9A 3KM5A 4UP0A 3DYOA 4HBNA 5A7SA 4D7TA 4MO3M 5D1MB 3J7HA 1A34A 3KHCA 2VMIA 2ZXQA 2LV9A 3ZXAC 1G7YA 4K21A 3LQIA 5FP7A 5A3WA 2R6QA 1US2A 2C24A 4QU1A 3LDYA 3ACGA 5T52A 4CDXC 1Q43A 3RSJA 4M4RA 3HCUA 4XMIA 2DV9A 3BCWA 2Y43A 1OFSA 3NV3A 3OPZA 2QJVA 3PUSA 4AEDC 2CAVA 1V6KA 1OBNA 2AYHA 3K51A 1GQHA 1UMHA 2VZVA 3GJAA 5FYCA 2BBVA 1CWPA 2BNNA 4YRDA 1YI9A 2E9QA
chains in the Genus database with same CATH topology
5AC92 4LHNA 4BIOA 4HN0A 3ZFEA 2WFPA 2VVEA 1MS5A 1DFQA 1N1SA 1V6NA 3CNAA 1Z2QA 1PVC3 2MEV3 3AYAA 4D3WA 3L2YA 3SOXA 4JTOA 5FRAA 4PPEA 4B7YC 1LGBA 2NPIA 1DYKA 5KHHA 5L73A 1OQ1A 4AI8A 5ABJA 3E5QA 3DQVR 3ZFFA 3OF1A 3IIAA 4XTMA 3DL3A 3ZXGA 4A4BA 3VBRA 1LR5A 2QJ0A 1GKBA 4Z8BA 4Q0SA 1CONA 4RS5C 5IK7A 4YW4A 5I0RA 3EO6A 1Z60A 3AX4A 2BGCA 4XBLA 2CWMA 1ND2B 3QH6A 3ROUA 1AR91 1QHDA 2BW8A 3OGGA 4LO8A 4S2DA 4QPGB 4XFFA 4AEKA 4TYSA 1GQGA 2EXJA 2KFTA 4W6XA 3ZTGA 4AVXA 4MVTA 1H1MA 4XQ4A 2PHTA 5DINA 4MZUA 1JN2P 1ULGA 2F6JA 4GKXA 1A8DA 2VUJA 1SCSA 1YFUA 1R093 4BIFA 1ND3A 1BK1A 4M0NA 1NCRB 2PA7A 1GYKA 1MM3A 3K48A 1SCRA 2D6NA 1YFWA 4FOWA 5IK5A 3DPRA 5T5PA 2LTNA 3HBZA 4YVSB 4FTEA 1WW5A 3NL1A 1PVC2 1SLTA 2MEV2 3HMYA 4FPKA 1LHNA 2HWD2 3C2UA 1QH7A 4KWKA 2NZ9A 4YGBA 3NO8A 4YBSA 1RC6A 3OY8A 3WDYA 1ZBE1 3IM0A 1FV2A 4V3LC 4FOQA 1N3QA 4W6YA 4AVVA 1UCXA 5AC91 1G9FA 4G3YC 3ZSMA 4XF1A 1CAWB 1OFNA 5A32B 3FFQA 1LECA 2D3SA 4YBMA 1H30A 3MIGA 2WFF3 3ZYJB 3ZN6A 2YREA 5KXCA 1UIJA 4QQOA 5D1KB 2GU9A 2E7AA 2VH9A 1I5ZA 3WDVA 4F52B 3FL2A 4C91A 5J36A 2AN6A 2YY1A 1YIFA 4FT8A 5FO8B 1VBB3 3JQWA 1LOBA 1QWRA 1G86A 3FX3A 3T1MA 1LEMA 2XH6A 1TE1B 1J1TA 4J1XA 2GC2A 4Y1YA 1PNGA 2VW1A 1RUOA 1MQTA 3MLLA 1RUF3 2GNDA 4CEWB 4PIYA 1LOFC 4YW5A 3DF0A 4JV4A 4N53A 4R9DA 5TBNA 5CU1A 2QUOA 1WW4A 5EYYA 1V6JA 3J9SA 4HMZA 5KXBA 2UURA 1R092 1CR7A 1X8EA 1UIKA 4QX5A 1WD3A 3HTKC 4JGZC 1KITA 2B7YA 3M7AA 1W6PA 3H0OA 5C9AC 4BLIA 4BMBA 3FBMA 2ZGLA 3LQHA 2K4DA 5AVPA 3WZ1A 4AFMA 2FBEA 2ZGQA 1W6OA 1KJRA 4HL0A 4XJUA 1HYJA 3VBHB 2WNUC 4KQ7A 3TRSB 2Z69A 1LCLA 5KHIA 3JQXA 1E4UA 3B02A 1QXRA 1A3KA 2YGLA 1QOSA 4XF4A 3JZVA 1DVPA 2QZ2A 3J26N 5DUXA 4IEWA 2YQLA 3M62A 2WFF2 1BXHA 4FPCA 2WS93 2A6XA 3AXDA 1PVC1 1JHNA 2MEV1 4COZA 4EN9B 4BH9A 4BMEA 2HWD1 4C0BA 2XLGA 2YXSA 1CPMA 4YG3A 1W2UA 3ES1A 4EN7B 5LK7B 2A70A 2Z79A 1SLLA 5LRRA 4AWDA 3VKFC 3BALA 4YZ1A 4W4UA 4EWEA 4FPEA 4YVWB 1KS5A 2JG9C 2PUYA 4NVPA 2DYCA 3VGIA 4Y26A 4I09A 1ENSA 3N4MA 3MHHA 2P3KA 1LB2A 1RUF2 1H8TA 2Q30A 3AMQA 3LWCA 4FPLA 4LA2A 4C1WA 4EN0A 2CKLA 4UW3A 3OGJA 1XYNA 3J8F3 4MXWB 3APBA 4Q4V3 4AVAA 4RD7A 4LE3A 4RSUA 5CA6A 4OUMA 4DS0A 1CHCA 3VKOA 4D7SA 3MYXA 2TEPA 4YLZA 3CO2A 5DG1A 2XJTA 1W6NA 2FHRA 1S2BA 5G05B 4FO9A 3KSCA 4AE2A 5K0UA 3ST7A 3MIDA 5FBZA 3E6DA 2RE9A 2VPEA 3MI8A 2GALA 1R091 1F8VA 2VUAA 5E88A 2P3JA 3WP5A 1W0PA 4AGGA 2Y26A 4DQAA 1WEOA 1ULFA 2K2SA 2GMMA 5KH9A 5C4WC 1EPWA 1LOAA 2ES3A 4Z1VA 2IDAA 2WS92 2UY8A 1AR63 5TDRA 2GC3A 2H0DA 2HKXA 2P37A 2KWOA 2WINB 4S2GA 3GALA 4DMIA 3V0AB 3AMMA 2OYZA 2M3HA 5D8AC 4B29A 4P5OB 4AEMA 1IKQA 3B00A 2WA3A 4XIOA 3VBOA 4PDWB 4HVOA 5JVVA 4AGVA 4I01A 2VJFB 4OI4A 3LB9A 1HX6A 4DRVA 3X29B 4QF3A 1BBT3 2WFF1 3FWEA 3RI9A 4XW3A 3A0KA 1K5MA 2K17A 4CDWB 3VLBB 2F4PA 1CIWA 4Q0PA 1DBNA 4L97A 2Y38A 4OHXA 4IV3C 1HYIA 3J8F2 2JG8B 4E4SA 4Q4V2 3O7OA 1I9RA 1JUHA 4B4RA 2ARBA 1QGLA 2WT1A 3QOPA 1DGLA 3PJQA 1YNAA 3E5UA 4LEJA 4XJZA 2ECJA 4Q6FA 2PHXA 5JPMB 2CNAA 1RUF1 1YFXA 4IEOA 2VPDA 2JECA 2LGGA 4INDA 1SLAA 4JGYA 4QT6A 5CFCA 4FJCA 5B8DA 2CV6A 4MV2A 1XE8A 4MGKE 1KDKA 3B01A 4A7KA 4CEYA 1C3HA 4B4PA 1B09A 5HCAA 2XKPA 2ZGKA 4KGQA 4ZU7A 1XNCA 1ZZ6A 4JVAA 2VNFA 1LHVA 2IXCA 3FLRA 4HK8A 2ECIA 5GLUA 2R043 4RGAA 2MA5A 3VBRB 1YIPA 4A2UA 4QPIA 5L7OA 3RJRA 1Q8SA 4IV1A 1AR62 3CEWA 3SMHA 2ZS6B 4XXPA 3RWNA 2X29A 1H1AA 2BUKA 1VIWB 4WVWA 1MS4A 1PGL2 2Q0AA 5DUUA 3RPGB 5T5OA 4FPYA 2W39A 5D1LB 2G9GA 2DX8A 4I0AA 2RSDA 2MNYA 1BBT2 4UI9B 4QHBA 5FO7B 2WS91 1ULDA 2IWGB 3MLJA 2XJRA 3SXWA 3H3ZA 3KT1A 3J4UH 2UY9A 2E51A 2WQ4A 2PAMA 3AP6A 4GIQA 2Y1MA 5FB0A 1ND3B 3O5SA 1GLHA 2CSYA 1QJU3 2DUOA 3KCCA 3QCWA 2PTMA 4TWTA 3QZVA 4CDQB 3WG4A 1H9WA 4RR3C 5GLZA 1N87A 1QOTA 2VG9A 4I0WB 4IEXA 1DLLA 4QU2A 5H9MA 4ES8A 3LOIA 2F6NA 1V87A 3AYCA 3VBSA 1JTZX 2BNOA 1S0BA 2E7TA 2ZX0A 5JOZA 1APNA 1ZM1A 2CSZA 2WNVB 3J8F1 3NWKA 4Q4V1 2RS13 3V0BB 1R1A3 2V09A 4AQ6A 2R30A 5EWSA 2ZHNA 4RGGA 4U36A 2DCKA 1WLCA 2R042 3M2MA 3D8CA 3B7MA 1REEA 3ZN6B 4DXZA 5I0TA 1DQ0A 2QDNA 1RIRA 3B3QE 4A7ZA 4YM2A 2MHFA 5GZGA 3KV5A 3AKSA 1QJX3 1V6IA 3VDDA 3KV6A 4XJ8A 5BNPB 4MX3A 3VHPA 3IKWA 4FOYA 5EFUA 5AFBA 1WLTA 4YFZA 1IGOA 5D1IA 2M85A 1NLRA 1RUG3 1DQ2A 1CN1A 3PTYA 4EN6B 1C5IA 2GDFA 2B46X 1D2QA 3O12A 5LKTA 3OBRA 3DPLR 4HLTA 3WQ7A 4N7UA 4JDOA 4HSJA 5GZEA 1OOPC 4YAXA 3HT1A 3IDEA 4KG8A 5DUVA 4O64A 2VPGA 2Z42A 1AR61 2EALA 4GH4C 4IC3A 1CPNA 3HAGA 4F83A 2XG3A 2ZCWA 1FMD3 3FHIB 3URFA 1U0AA 2P2KA 1PGL1 3H50A 1NXD1 1O3TA 1QJU2 3W59A 4Y22B 2WLPA 2KGIA 1I3HA 1W6PB 3ZXKA 5L36A 2LUWA 1BBT1 2CAUA 2DFBA 3KMHA 2XJUA 3VBFC 2A6YA 5FFOC 1W6OB 2VNGA 3ILRA 4XZPA 4CDUC 2DCTA 2IXHA 5CADA 3G6JB 1MS3A 4HANA 3WV6A 3VKNA 2D6OX 1HLCA 1LGCA 1TQ5A 2RS12 1CJPA 1QJY3 1LRHA 1R1A2 1T6GC 4XF3A 1AL0G 1LEDA 1NZCA 4HZFA 4HPKA 3WP4A 2RJKA 3V64A 2WNEA 1U5ZA 4FPFA 5LRSA 2R1BA 4Q27A 5SV8A 4M3CB 1AVBA 4Y20B 4AEDA 2YYRA 1MZ5A 4LUMA 1QJX2 1SEFA 1C8M3 4Q29A 4P9LA 4XBNA 1YJKA 2UYBA 3ACLA 1CESA 2A73B 4YM1A 4UW5A 4FP2A 1RUG2 4BWOA 3HCSA 1RUNA 3VZOA 2Y0OA 1POV0 2R041 5KH7A 4XF0A 1F2NA 3VBUC 1HV0A 3MIEA 4ZU5A 3VZKA 4CYDA 1UPIA 3M3CA 1URXA 2E7QA 3VL8A 3WG3A 3USUB 4AQTA 3ZMNA 1Z7S3 3M70A 1VP6A 1AHSA 5FOBB 1HXS3 2ZOEB 4KH9A 4LLOA 4A49A 5B76A 3WW2A 1Z0HA 1FNZA 4QF2A 2WWSA 1B35C 2GMPA 4J1WA 4GNDA 4BOWA 1WEMA 4HN1A 2X5IC 1W6QA 2FZ1A 3AMHA 3N7LA 1Y9QA 5J09A 2YQMA 1ZRCA 5EZWA 4Q4X3 5HXVA 2D6MA 2G45A 2O1QA 2W52A 2XHKA 3LA2A 3CF6E 1D2SA 1WLDA 1HW5A 3M3QA 1QJY2 2WT0A 5L19A 4XMAA 1QJU1 4K1ZA 4LE4A 3PHMA 2HWB3 2PELA 2R16A 3SH4A 1FBVA 5DUWA 5CIRA 4META 2GMEA 5A33A 1Q8OA 1ZZ8A 2IFRA 1MACA 4COWA 1AR93 2E6SA 4BM8A 1C8M2 1JM7A 3FJSA 3U07A 3FLPA 3ES4A 1SFYA 2V73A 2RS11 2ZAAA 3N36A 1R1A1 5JZGB 5HBAA 1POV3 3OD0A 4FPOB 2OW4A 4ISQA 1Z78A 2NQYA 4XHXA 2PQQA 1K5MB 3MIFA 1DQ1A 2O8QA 3FLTA 1QJX1 1Z7S2 1YXWA 4A3XA 4K3UA 2AZ5A 4Q1RA 1XWHA 5TRBA 2K0GA 4QGNA 4P9IA 1KJLA 1QNYA 5JOYA 1HXS2 2G43A 1RUG1 3ZXFA 2A3YA 3ZVXA 3KGLA 3VZLA 5LEJA 1MEC2 2XGXA 2VW0A 3MHSA 1CAVB 3NW4A 3HN1A 3AKTA 2DCJA 1LU1A 1WD4A 3AFKA 4BQ1A 1WENA 2Q1MA 3FUQA 4S2HA 1CD3G 1ZBE3 3KQRA 4Q4X2 1XRUA 2XVGA 5BPXA 2DVBA 2KA3A 3NAPB 3ZN4A 5GLWA 5T55A 4AP4A 4F7ZA 2HWB2 2WLQA 4R4XA 3AJYA 1U5IA 2ZBJA 4G9SB 4XQWA 5CAZA 5BV6A 1LOFA 1XYOA 1QQP3 3L11A 2YT5A 4OUSA 5B78A 3CJXA 4QGLA 2P34A 5FQ0A 4IV1B 5H1VA 2GNTA 1JW6A 4XFGA 3WHTA 3RDIA 2PLV3 4YZ4A 4WZ3B 2Q1ZB 2PHRA 4JGZA 4Z82A 1SBFA 2YU4A 5C8CB 2R49A 4QQHA 3TYJA 1QJY1 2ZZJA 1Q3EA 5C9AA 4I2OA 2A75A 2DWRA 1O4ZA 2QE3A 2GNMA 1FATA 1UN1A 3A0NA 4AYUA 4N9HA 4DY3A 4YADA 2GC1A 1ND2C 4GMP0 2WNUA 4R4ZA 2L0BA 4PJYA 3ENRA 4Q4Y1 2JICA 3IT8A 4K8FA 4QXKA 2RI7A 5BNNB 1C8M1 2B5HA 5F5QA 1O4YA 4QPGC 1RTVA 1WE9A 4LBOA 4HKLA 2GZWA 3B69A 3AFGA 3B9IA 4IEPA 3WD5A 1DGWX 1SFNA 1RITA 1PGSA 3ZSLA 1X4IA 4P14A 2DU1A 3NVCA 3POSA 1ZBE2 3JD73 4CTEA 1YHFA 1NCRC 3VBSB 1Z7S1 2VXRA 4AI1A 1FP0A 2ZZQA 2JG9A 1HXS1 2EGPA 4I7BA 2DVGA 4YVSC 1U12A 4E2QA 2JMIA 1MEC1 2VVDA 4B4QA 1QQP2 2HWD3 1MR5A 3ZYIB 1WGMA 4EWDA 3NG2A 4H7MA 2R073 2OPKA 2L80A 1NE6A 4Q4X1 3H1YA 1QY4A 3RYKA 1MS8A 2PLV2 1MZ6A 4RQPB 2VJEA 2LXHC 3ZPV1 1FAYA 4IEZA 3WDXA 1S0FA 2VNOA 3DN7A 2ZGUA 4QD2A 2HWB1 4EROA 4PTBA 1X7NA 2DUPA 3B93A 1NYWA 4AI0A 2ZTNA 3ZFGC 3U11A 2BEOA 3RI8A 2CT2A 4CCGX 4NO4A 1BVP1 1V9U3 3N7MA 1X8MA 2LGKA 1F5FA 4GMP3 3DUIA 4EN8B 2ZMNA 1NLSA 3IDCB 3E97A 4K6BA 2WC2A 3WW1A 3N7JA 3WVJA 1VBD2 3CL1A 1ZRFA 1YFYA 2R0HA 4A0CD 3THTA 5BNOB 3L1ZB 3BOWA 3SOWA 5C4WA 5A3LA 2QDRA 1O3RA 3TB0A 4BE3A 1CAXA 3FC0A 2ZJCA 1POV1 2ZHLA 3GBFA 3R05A 1G9DA 3IWZA 4WM8B 5E1RA 3O33A 3MGUA 2RS53 2ZGRA 4JQRA 1DGWA 3JD72 3MW4A 5JIAA 4HSLA 3L2HA 1R083 5D8AA 4AVTA 4R9BA 1X4UA 5FEYA 2D5HA 1WBLA 3RTRB 1C1FA 2ZPXA 1RB8G 2YHOA 5T54A 1TMF3 1RUI3 4GQ7A 4XEZA 3BU7A 3VBHC 4DINB 1CAUB 2NMNA 1AXZA 1UX6A 2R072 4AEDB 4B8EA 4IV3A 2ZHKA 4JAAA 1NA1B 2D3RA 1ZBA3 3WP3A 4S3OB 4OI1A 4KWJA 4AFCA 3OYWB 2EXIA 4SBVA 2WA4A 1RJ7A 5KC5A 2I45A 3H9AA 3WX5A 4HETA 3PVNA 3FZ3A 1QQP1 1IOAA 3WDUA 2YDEA 1CVNA 1NE4A 1V9U2 4XOGA 1LESA 3BTAA 4IETA 3C5KA 4LBQA 1C1LA 2FQPA 4YVWC 2EAAA 1I6XA 4Y4YA 2PLV1 4HT1T 3AZYA 3O7AA 1KFUL 5FPXA 5KHJA 1PNFA 4L58A 4Y1VA 5I8YA 1FI2A 2EA7A 3EB6A 4AFBA 4URTA 2BQPA 5J7MA 2ZGNA 3ATGA 4AK3A 5DZGA 2WZPP 2RS52 3ZIWA 3N9OA 1R082 3FBYA 4YNIA 1VBD1 4QQPA 3H7JA 1IQAA 3POWA 3RMXA 4NHKA 4WM7A 2WSVA 3D4KA 2LQ6A 1AX1A 1TMF2 1UU4A 1RUI2 3IPVB 4SLIA 5KBFA 1GV9A 3AP4A 1ZYBA 2X8KA 1FOD3 1KXGA 5G04B 3EBRA 5F1RA 1QNWA 3C6WA 3JD71 2GSYA 1UKGA 2BAYA 4Q8LA 1SLIA 1ZBA2 5TDWA 3U0ZA 2ZKNA 2A7AA 4WBBA 4GWMA 3SCHA 1S55A 4AUQB 5T5LA 4XE9A 4XJ9A 1ZZ7A 1IS6A 4YGDA 4RR3A 4IEVA 4O9EA 3N7KA 1OI6A 5H9QA 1Q56A 1OSGA 2Q5TA 5JOXA 1X33A 5DKAA 1ALYA 5FPZA 1RVF3 2R071 1KD7A 5GJ6A 2MUMA 4IEYA 3PUQA 2OZJA 3E6BA 4PDWC 3HWJA 2YC0A 2QFEA 1OQEA 3PLQA 4AI3A 2HWC3 3N3HA 2O0OA 1XU1A 4GB33 1X50A 2H6BA 2OIIA 5JSOA 1SBDA 3U5PA 4ONUA 3RNSA 5J96B 4UP5A 3I59B 4CDWC 2M1RA 4CP2A 1NOVA 2F6BA 3D0JA 1H9PA 1V9U1