4MVTA

Crystal structure of sumo e3 ligase pias3
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
283
structure length
255
Chain Sequence
DVTMKPLPFYEVYGELIRPTTLFEEAHFTFALTPQQVQQILTSRDYTIQVQLRFCLCETSCPQEDYFPPNLFVKVNGKLCPLPGYKRPSRPINITPLARLSATVPNTIVVNWSSRNYSLSVYLVRQLTAGTLLQKLRAKGIRNPDHSRALIKEKLTADPDSEVATTSLRVSLMCPLGKMRLTVPCRALTCAHLQSFDAALYLQMNEKKPTWTCPVCDKKAPYESLIIDGLFMEILSSCSDCDEIQFMEDGSWCPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 SUMO-protein ligase PIAS3
publication title Crystal structure of SUMO E3 Ligase PIAS3
rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 63
structure length 255
sequence length 283
chains with identical sequence B, C, D
ec nomenclature ec 6.3.2.-:
pdb deposition date 2013-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02891 zf-MIZ MIZ/SP-RING zinc finger
A PF14324 PINIT PINIT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.780 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4mvtA01
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4mvtA02
2LQ6A 3ZPVE 5B77A 3C5KA 2M85A 4V3LC 2VJEB 5B78A 5LKTA 4FO9A 3T7LA 2HYED 1JOCA 2KU3A 1E4UA 3PUQA 4GNDA 2Y1NA 1VFYA 2YSMA 4LJNA 5KH7A 4PTBA 3LRQA 2KWKA 2CKLB 1G25A 2D8SA 2L80A 2KGIA 2ECWA 2YHNA 1X4JA 4AUQB 2C2VS 2RSDA 3RPGC 1WILA 2JRJA 2M3HA 4O64A 5AIUA 5KH3A 1JM7A 4R7EA 3MHSA 4GNGA 4YADA 1WEWA 2L43A 3M63A 3PHDA 1WEPA 4S3OB 2MD7B 1RMDA 5G0FA 2YURA 4AP4A 3M62A 2KWOA 2KWNA 4BHWA 2VJFB 5TRBA 2JMIA 3U5NA 1IYMA 4A49A 1LDKC 2LGVA 3L1ZB 2VPBA 5LKUA 2VPDA 1DVPA 2F42A 5DKAA 4YABA 3O33A 2ECGA 2MUMA 3U5OA 5JG6A 2YQMA 5KH9A 2MA6A 2K16A 5H1VA 2YQLA 5B79A 3ZVZB 2FUIA 4B86C 4FIPA 2PUYA 4ZQLA 2H0DA 2K17A 3V43A 2YREA 4ZDTA 4LLBA 1Z60A 4FK5A 3KV6A 2YW8A 3LQIA 2HDPA 3DPLR 3VK6A 3O35A 4QF3A 1VYXA 4QF2A 5TABA 1X4IA 5TDRA 2ECVA 5H1UA 5LKZA 4A4CA 4YBMA 3O34A 4Q6FA 2MNZA 5FERA 3GV4A 2CSYA 4YC9A 4UP5A 2C2LA 5LKXA 1VD4A 2G45A 2ECNA 4I7CA 4I7DA 3C6WA 5TBNA 2YSJA 4S3OC 3N9OA 4LK9A 3HCTA 3O37A 2K1JA 3KQIA 2VPEA 4CCGX 2G6QA 2KE1A 5D1LB 4I7BA 2F6NA 3U5PA 2LN0A 2NAAA 4ZUXU 3N9MA 1N87A 3RTRB 4A0CD 5TDWA 5LCWB 1XWHA 3FL2A 3ASLA 3DQVR 5I3LA 4IC3A 3SOUA 1U6GB 2I50A 2QIZA 3HTKC 4X3GA 2M1RA 3SOXA 3EB5A 2MIQA 3QZVA 4NN2A 2Y1MA 2Y43A 1HYJA 4PPEA 4AYCB 1ZBDB 2JMJA 3N9LA 1WFKA 4V3KC 5B75A 5C11A 4IC2A 4B7YC 4F52B 2MA5A 4N3WA 3N9NA 3EB6A 4L58A 5H1TA 1F62A 2JMDA 4WZ0A 1Z6UA 5D1KB 1FBVA 2LXHC 4R2YA 2LV9A 1WESA 3U5MA 2XEUA 4MVTA 2AN6A 2KGGA 3KV5A 2YYRA 3RPGB 1FP0A 2LXPC 1T1HA 3M99A 4YATA 4YAXA 5B8DA 2LGKA 3ZNIA 2KIZA 4C9ZA 3N9QA 2KR4A 3HCUA 5DINA 5FB1A 4UI9B 2QJ0A 3O70A 2CT2A 1WEOA 2VNFA 3O36A 3ZVYA 2VJEA 5AITA 3PURA 1WIMA 3GL6A 3T6RA 2VPGA 2ECTA 3I2DA 2H0DB 2KYUA 4LKAA 4CA1A 2IDAA 3ZTGA 4GNFA 3NG2A 4YBTA 5J3XA 1HYIA 2CKLA 5EYAF 2KREA 4MSXA 2L75A 1WEEA 1BORA 4FJCA 3SOWA 2L0BA 2YHOA 1WEUA 2LDRA 2RI7A 2BAYA 2ZETC 2ECJA 4N4FA 2YUCA 2E6SA 2KWJA 2VJFA 2G43A 3SHBA 4R8PK 2KFTA 3MHHA 4AYCA 5B76A 2VP7A 1WGMA 2F6JA 2K4DA 1WEQA 4GB0A 3KNVA 5FEYA 4TKPB 3LQJA 4YBSA 1WE9A 4L7XA 2M6MA 2XB1A 5FB0A 4AVXA 2FUUA 4W4UA 3IHPA 4XI1A 2ECIA 2CSZA 2LGGA 1MM3A 3L1XA 1K2FA 4A4BA 4UP0A 1JM7B 4WZ2A 2PNXA 2QICA 1X4UA 2FSAA 4BBQA 2LRIC 1WEVA 2E6RA 1WEMA 1V87A 2EA6A 3O7AA 1WENA 3LQHA 2EGPA 2YU4A 4P5OB 4GNEA 5D1MB 4WA6A 5G05B 2EODA 3ZYQA 4WZ3B 2MD8C 5G04B 5H9MA 5C13A 2OXQC 4LADB 2MT5A 3L11A 3ZPV1 2YT5A 2UZGA 3HCSA 1LDJB 1Z2QA 3N9PA 2DX8A 1CHCA 2L5UA 1MM2A 2MNYA 2LGLA
chains in the Genus database with same CATH superfamily
4I0BA 2LQ6A 3BIEA 1PMJX 5GJ6A 1OLME 3VBOA 5IVVA 1MQTC 1ASJ1 1RINA 4YZ5A 1YLLA 2WZR3 4XQ4A 5LWBA 4OFGA 5JUVA 1G9AA 2M85A 4M3CB 2Q8OA 3TN92 4JQRA 4GMP3 4QXKA 3SCFA 5DUUA 3RNSA 1S0DA 2BYVE 2QQLA 4HFSA 4Q4Y1 3TOJA 4GNDA 4ZY9A 2JDKA 3BOPA 4V2VA 4D7YA 3DYPA 2RDSA 1EP0A 1W6QB 2Z69A 1U12A 1W2NA 5J96B 3JBG1 4HONA 2FZ1A 1YIPA 2CL2A 3BU7A 4LKSA 4OMCA 3EQEA 1YFUA 3I3EA 3UNPA 3VBUB 4LJNA 3UKNA 3F95A 3O5SA 1U5YA 3SKVA 1JOBA 4QX3A 1C5IA 3ZYPA 2CKLB 3U07A 3VDDA 3ILRA 1G25A 2PFWA 1J59A 4KBZA 3S57A 1VR3A 5F3IA 1D4M1 1JW6A 4H55A 3P6BA 4QKBA 1MZFA 1SLLA 1VRH3 4W65A 1RUG1 4XJ9A 2P2KA 3TNQA 3ZR5A 4AUQB 1H1AA 3ZXAC 3FHQA 1GQPA 1VALA 1AL23 2OZ6A 2ZJCA 3BB6A 4P02B 1ZX5A 4QKFA 2K0GA 1PO22 1K42A 1OD3A 2WNUC 3BKZA 2M3HA 3RWNA 4AEDA 3GZUC 1GFF2 3R4SA 4Z82A 1NCQA 3TBDA 1JM7A 3ZYFA 5LB6A 4YADA 1HDKA 4FPEA 4AAPA 4YSFA 2L43A 4W8JA 1A8MA 4CCOA 5ABJB 2MD7B 2DCTA 3BTAA 3ZN6B 4YVSA 4CEYA 4FFIA 2YURA 1VMHA 4AP4A 3ZFGB 1WMFA 5A3PA 1XSQA 2FDJA 3AFKA 1EPWA 4A3ZA 4UXAA 3OEBA 4BHWA 2Q4SA 3Q9OA 1XNDA 1BK0A 4FXGB 1K5MB 1RUC3 4RQPC 4FCAA 4A49A 3B00A 2R0FA 5F6KA 3S6PA 5FCCA 3U37A 2VBBA 5KHJA 1VBD2 4WM8A 1XYPA 1W99A 1W6MA 5A7SA 2RM21 2VULA 2RMU3 5LKUA 3AYEA 3J8F2 2RG4A 1X8EA 2P37A 2Y6FA 3R4UA 1BEV3 1FYUA 2A3XA 2DBIA 5FYHA 2E9QA 5KHGA 1NA1B 3MIDA 3O33A 2ECGA 4I09A 5GZDA 5A70A 1JXNA 4AHWA 2CTVA 3K4AA 2PAMA 4I30A 4NHYA 3UETA 4Z07A 2R1DA 5FZ9A 3CJIA 3I54A 3PTRB 3NNMA 2EAKA 4CCDA 1TE1B 1H8TB 3H1YA 1WD4A 4DUXA 2ZOEB 1KGYA 1PO12 2LW8A 2CHHA 3OCPA 3KT1A 4R8HA 5BUVA 5J09A 2DUPA 3KS7A 4Q1PA 1AR82 2XWJB 2EXHA 4CEWC 1J83A 1RUE1 3NJYA 2HWE3 1XYNA 3V43A 2D6PA 3IZOA 2XBO1 4P9LA 2FD4A 2NZ9A 2JDYA 2BUKA 1GZWA 4B29A 4ZDTA 4Y20B 4FK5A 2ZGPA 3POSA 4XFAA 2P17A 1CAXA 1RUD2 4XEZA 4MADA 2GU9A 3LQIA 3RQ0A 1GP4A 1Q8VA 4Y5SA 1UKRA 3WNOA 3HQXA 4CU8A 3TAYA 1MVQA 4PLOA 3I2GA 5FZDA 2WNOA 2CYFA 1W28A 5F5QA 2PTMA 3VK6A 1UZWA 3K3NA 3NQHA 1NZIA 2AEYA 1DG6A 3MICA 4UW5A 3ROUA 3OUJA 3ZYBA 5FOBB 3AKQA 3R05A 2WSVA 2Y64A 2W9XA 5L7OA 3ZN5A 2EIEA 5TABA 5FYVA 3GDBA 1CD3G 4Y1UA 5CISA 5E8AA 5D21A 2MEV3 4D0QA 2ZGLA 2PQQA 1Y4WA 5B4NA 4U2AA 3RMYA 3O1UA 3AVRA 1W6OA 5KBFA 4A4CA 2XJPA 3IIAA 4YBMA 3MF9A 3J7LA 3LIGA 1CAUB 3MBWA 1RUF3 3LFIA 3LEMA 2LAUA 3VZNA 5B2GB 5FERA 2VCAA 5FP7A 1LTEA 3VZMA 4R9AA 1W3VA 3FJSA 5IVEA 1XC6A 3IDBB 1N3OA 4META 4JQTA 3LSEA 4LO7A 1COV2 2VZVA 3L9JT 3DV8A 4QXHA 1VD4A 1ZBE1 2ADEA 2NN8A 5EJ3A 1D7PM 4YYOA 2ECNA 2DWRA 3UK9A 1G9FA 3VBRB 3DYOA 1RHI1 5JOZA 4L99A 1NCRA 1ZRRA 5H9QA 5EQUA 1LGNA 1HW5A 3CIHA 4CXWA 4AI2A 2WT2A 4HETA 3MV11 5ABJC 4IV3A 3AC0A 4J1WA 1XB9A 3CO2A 3VD3A 3VD4A 3HCTA 3WQBA 2OX0A 2ORZA 4I0WB 1FMD3 3OOXA 2PA7A 3HVDA 3JD71 1RJ7A 4JTNA 2YU1A 4LA2A 4Q4X1 2K1JA 4CCGX 1O4TA 2C26A 4W6WA 3SLIA 5JSPA 1S0IA 2R071 1V6NA 2A75A 2XLFA 1G8WA 4UOJA 4I7BA 4CVUA 4RGAA 3B7MA 3OY8B 2WKKA 5E16A 1NCQC 3O1SA 2F6NA 3M7AA 1WCKA 4QPIC 3D8CA 5FZOA 5IFTA 3WT3A 3U5PA 4JZRA 4WM7A 3ITQA 4K9SA 2NAAA 2YG0A 3VBSA 4EJRA 3I2OA 3N9MA 3FBMA 4YVSC 4CEYC 1GOGA 5C4WA 1GZ9A 1W0OA 2ZPXA 2CWSA 3ZYIB 3RTRB 1GQGA 4Q1RA 4OI2A 4XVHA 4ARXA 2D3PA 5LCWB 3PHMA 1XWHA 3FL2A 3ASLA 5CIRA 3MPBA 3E6BA 4GB32 4I3GA 4X8NA 5FP9A 5I3LA 1GSLA 4GKYA 1PNFA 2ZMKA 2FDKA 1W8NA 3R6SA 2YPJA 3EB7A 3HTKC 3FHAA 1VAMA 3BTXA 1GR3A 4NR1A 4WM8C 5CVRA 3WINE 4AEMA 3ZXJA 3T0DA 3SOXA 1Z0HA 3RWKX 5GLUA 1F35A 1WCQA 4PF5A 4C1XA 4NN2A 2Y1MA 4CDUA 1G9DA 2QNKA 2Z4FA 3KQRA 3GNEA 2D3RA 1EY2A 4RA0A 4QHBA 3THCA 3OBAA 4CUGA 2P3YA 4Y4YA 5CKQA 4N9IA 5B75A 4YFZA 5C11A 2VE1A 4B7YC 3DCQA 4HVRA 4LITA 4Y22B 3O1PA 4N3WA 4F52B 1ZRIA 1WCSA 1OA3A 4LA3A 4KWUA 3NW4A 4XURA 5A7WA 4NIAA 4BQ1A 1V9U3 5BNNA 4H2AA 2Z2SB 3GBWA 1J1LA 4M01A 4DO0A 4DFSA 2W91A 4ZHNA 2WJSA 2JMDA 1BVP1 1OSGA 3BYWA 3PTYA 5F9TA 4WZ0A 1Z6UA 2IVIB 2GMEA 3KV4A 4YM3A 1JZ5A 2W47A 1H2NA 3HMYA 4FAHA 3E5XA 2YBKA 4QM9A 5JZGA 4X6RB 5IVYA 3LKJA 4AXOA 1JU3A 3KB5A 4M0HA 2Y33A 5C3RA 1FP0A 2E33A 1DBNA 2D6KA 2R062 2WUHA 5DZEA 1GP6A 5A7OA 3OG2A 3MW2A 4K7JA 4ONUA 1N3PA 2DBNA 1MZ6A 2JENA 3DKQA 3MYXA 3OUHA 4FP2A 4I0AA 4JRAA 4N90A 5L9RA 1KQRA 3SMHA 3WZ1A 3ZOIA 1WW6A 5L7OC 1EV12 2BW8A 3CDZB 2W39A 2XWBB 1OD5A 3CJXA 1L3JA 2RR12 4ISRA 3AMQA 1VLNA 3N9QA 4BJ0A 1JYXA 2GNMA 5FY1A 4BQXA 2ID4A 3G7DA 4RGKA 3PVOA 1DZRA 5FYIA 2XOZA 1ZNPA 2WZPP 3NNJA 3SNMA 1UU4A 5LRSA 1IKQA 5ACA3 5EV7A 3B3QE 1KD7A 4XJ8A 1LOBA 1PIV2 4EV0A 2W1UA 2XMLA 5T5JA 1ZREA 3FUOA 3FFQA 3LVQE 4HK9A 4Z1VA 2XHNA 5FZFA 2N7GA 2ZGKA 1S2BA 5CBLA 1DGRA 1R083 4EWAA 4MHRA 3JQXA 2VZ3A 3GZAA 3PJQA 1MEC1 3WOGA 1JYWA 2ECTA 2VPGA 3VD5A 1PVC3 2ZACA 1UOBA 4WVZA 2H0DB 3W58A 2PHLA 5DAXA 4CDQB 3B9CA 5CFCB 2IDAA 1CJDA 5BPXA 4HKWA 3KF3A 2ZMLA 2A73B 1ND3A 2PHWA 4LBMA 2VMIA 4QGLA 4UFJA 5A7PA 1ZBA1 4GNFA 2W52A 1HN0A 2VOWA 4IEWA 5FZLA 4NIHA 3RJ2X 4KQ7A 1OH3A 1OVPA 3NAPA 2IQJA 5EYAF 4CUBA 2QTWB 3ZIWA 4NHLA 2WFF1 3JXSA 1ZA4A 4YW2A 4URAA 1CR7A 1QJU3 2D98A 4GA9A 4NHKA 1PK6A 5L9VA 3WP5A 4GIQA 3OJBA 1GWKA 4LKEA 2EGMA 4YG0A 1JTZX 4NAMA 2JG8C 4LORA 1W04A 1RXFA 4BQ5A 2VMFA 3LDBA 4QQPA 4COWA 1S0GA 1LR5A 4JX0A 3TN93 5KC5A 1BJQA 2QVSB 2WAOA 3THTA 4DMIA 2LDRA 1RUH3 1SZBA 3VBSC 1RJ8A 2OQ7A 5FY8A 1VBA2 2OPWA 1QQP2 4GJZA 1W6PA 4V1PA 4BYYA 4N4FA 4QDSA 2OIIA 4QQOA 4GH4B 4CPBA 4DINB 3TEWA 2KWJA 3T2QA 5LASA 4LLFA 5GZCA 2B42B 5HCBA 3ELNA 4GMP1 4DXRA 1X82A 4QHZA 3SHBA 4EWDA 4N8MA 4AE2A 1Z7S1 3ACHA 2GMPA 4AYCA 2A6XA 4PBPA 3RYRA 1IYMA 1W90A 4CCLA 2F6JA 3E97A 1W8FA 4IE7A 3WSOA 2GZWA 2E26A 3ZVXA 4QX5A 4GB0A 1VMJA 4C8DA 2BVVA 2V4VA 1XBFA 2ZGSA 5BXXA 3HN3A 1CONA 1RC6A 1AJKA 2HBTA 3AZYA 1X7NA 1LGBA 2YDEA 5DABA 2XB1A 1G6NA 1HJGA 4JGZB 1C57A 1YEWA 3USUB 3IBMA 1V6JA 1NXMA 3AKPA 3HT1A 5T54A 2CSVA 2OUHA 1MS0A 5FV3A 4MX3A 2ZEZA 1E5SA 1BBT2 1I5PA 1F31A 4CXXA 5KXDA 4IUGA 3T4VA 1HRV1 1MACA 2JDHA 1AL21 3MIHA 4XIKA 3OGVA 1B35B 2QQIA 4P9YA 3AYAA 5D8AA 3FC0A 4N43A 2V5DA 3OTFA 5F5IA 4R52A 1H8VA 4LUKA 2NP0A 1AYM2 3ZN4A 2FQPA 2ZGOA 1GWLA 4B1MA 2E61A 5SVYA 3LWCA 4CP9A 1F15A 1PGL2 1VBD3 3VZJA 3WV6A 1W9WA 2WQ8A 5A6ZA 4YVWA 1ENQA 4GXLA 5FZAA 3POFA 2PNXA 2QQKA 2UWCA 3VBHA 2WAAA 3AZWA 2TBVA 4HN0A 5DAPA 2D44A 1Q8OA 2X53S 1OF4A 4Q4V1 4W6YA 2XOCA 3B9IA 4MGQA 3WNKA 2BBAA 4QM8A 1AVBA 3BPSA 3L2YA 1AR62 2LRIC 1WEVA 4R4XA 3LQCA 2VM9A 4MGZE 5FUIA 4KBBA 4XOGA 1UX7A 3CL1A 2E6RA 4Q8LA 4HANA 4Q5OA 1E5RA 4CDQC 4OI4A 2H6BA 4I2OA 5EYYA 5FYSA 5FYYA 1C8M1 1AR83 2I2SA 2WO3A 4Y5TA 3U11A 5SVXA 2ZGNA 1DYPA 2AZ5A 2DF7A 3L2HA 3O7AA 1XJAA 1I1EA 1J84A 1KDKA 4AVBA 2WS92 4QPYA 4BIOA 3JUEA 1GOHA 1OF3A 3LQHA 2Z42A 1GU3A 5FWEA 2F6BA 4FBFA 4URTA 3VBFB 4BXSV 2KKXA 2W95A 2WNVA 3IIIA 3ABZA 1RUD3 1RVF2 5T5PA 2KXLA 2EGPA 3OGJA 4CU7A 2XQXA 1AF9A 5FUPA 4OI1A 2P6CA 2EA7A 2HWE1 5JVVA 1OXCA 4P5OB 3ZYHA 3KGLA 3RZZA 1IS6A 2V09A 3FN9A 2YGMA 4HSLA 3ES1A 3V0BA 3QBQA 1JN2P 2EODA 1S0EA 3ZYQA 1UXXX 4L9BA 2AH2A 1SBEA 4UWDA 4MHUA 1AXZA 2C9AA 2RJ2A 5D1IA 2QQMA 4IEUA 3AYDA 1URXA 4IE5A 2DCKA 2QCSB 2Q5TA 3O0XA 1WLTA 1JZ6A 4RR3A 2BJSA 4ET7A 3HPNA 4IE6A 2XP0A 4ZU5A 4IEOA 1TME2 1FV2A 4A6OA 4GWIA 5LCWL 4XE9A 2ZKNA 1JYIA 4HPKB 5SVIB 1STMA 1W39A 4F83A 1CZSA 1O5UA 1UQXA 1O4YA 1VBC3 2VQTA 5J37A 1QMJA 4NIGA 1CHCA 1LDJB 2DX8A 1G9CA 1UF2C 3RFRA 5SV8A 4K40A 4D7TA 3T1MA 4YARA 5JI9A 1CN1A 1YI7A 4O9GA 1COV3 2ZX4A 1W06A 4GKXA 5JCTA 1M4WA 3UKTA 4TSVA 4Y26A 1RUF1 4XUOA 2ZGTA 4E4ZA 2LS6A 3W59A 3WCRA 2VJEB 2A3WA 4OUSA 5FYZA 3O37A 2HYKA 1ONAA 3W9AA 5LK7B 2FCVA 4QPGB 1MS9A 4CRQA 3P3PA 4DY5A 1Y9MA 4F3JA 2ENRA 2O8OA 2ZAHA 1NT0A 1NYWA 1V6OA 3NL1A 4FT8A 5A3LA 2VW0A 1B35C 3T1LA 4YZ1A 3ATGA 4Q8KA 3RVHA 5F5AA 5IK7A 2YSMA 1KFUL 2W1QA 2FHRA 4L8QA 3VUOA 2P57A 1TMF2 3WNNA 4PTBA 5KH7A 4IESA 5HV0A 5DMYA 3FWEA 3HEIA 2KWKA 1MS4A 1GKBA 1OA4A 4C1WA 1V6IA 4UFMA 3WW1A 1L7QA 1QY4A 4EZHA 2DVAA 1MZ5A 4BMBA 4ZU7A 2L80A 2ZS6B 3TEXA 3OYWB 5KHIA 5LBFA 3ES4A 4IGQA 5D8AC 1SMVA 4N43C 1W0NA 2WIIB 5FY5A 5CAZA 2XGXA 1HJFA 3SHRA 1S1AA 2X5IB 1V6KA 4OUEA 4XUTA 2A7AA 1IPSA 4IV1B 5A7NA 3WW3A 4GB33 5AIUA 1ENSA 2BQPA 4R7EA 3ME2A 1DP0A 4D8MA 5C8CA 4CP0A 2A71A 1VAKA 3I3DA 1MZEA 1O91A 1VBB2 3A0KA 5M0TA 4IEVA 3M63A 3ENRA 3PHDA 5ANNA 4LO4B 1GQHA 3BVCA 4HLTA 4S2GA 3RZJA 5G0FA 3GJBA 4YVWC 1LRHA 4XDQA 3OSDA 5FLHA 4AGGA 4FOWA 1MBMA 2KWOA 1RUJ2 1TNRA 4IL7A 3B02A 3DKWA 2CU5A 1O3SA 2XLAA 1OI6A 4XJUA 1S0JA 2R0HA 5CU1A 4B7EA 3BGAA 3PIJA 1WUVA 3U78A 2X10A 4PLMA 2LUWA 5FOJB 4Q4W2 3NV2A 3MW4A 3ZPYA 5D2AA 1S0BA 3DXUA 3L1ZB 3POJA 2MKEA 2Q1ZB 1NXD1 3MW3A 4N53B 3W5MA 4UBHA 1DVPA 3MHZA 4EYUA 2F42A 4Q0VA 4RQPA 1WLWA 3ZXLA 4D6RA 4YABA 4C0BA 1VE0A 2MUMA 3U5OA 1AR72 1UZYA 3C8XA 1S4CA 5F3GA 2JG9C 5F3EA 5JXHA 2FDGA 2YQMA 5KH9A 4INDA 2WNVC 3RDIA 1W05A 4P14A 5B79A 1V9U1 1FV3A 2XXZA 1BQPA 4AOCA 2CONA 1BLZA 4B86C 4XFIA 4OQ8A 4FIPA 5FY4A 4DZGA 4L11A 2DTYA 2WLQA 3GBFA 5FZGA 4BQ4A 1LULA 2X8KA 3M2MA 4XFHA 4AK3A 2JKBA 4ZXKA 2K17A 2KA3A 4YW1A 2A1XA 5JMCA 3WF0A 3PUSA 4EN8B 1Z60A 3C7HA 1YWKA 2VXRA 4FP3A 3KV6A 2VNRA 1ENXA 5CKMA 1EV13 1ODMA 1EYBA 4UYBA 1LESA 2RR13 4QWNA 5I0DA 3LOIA 4ZZ8A 4TLFA 1SCRA 1WW4A 2J22A 3B69A 3JUUA 4XF4A 2JIJA 5FPAA 2PLV3 3I8TA 3RZLA 3UESA 1VYXA 1PIV3 2BERA 1PMIA 2J1SA 1AR91 3HNMA 5T55A 5JOWA 2HWD2 3AVSA 4QF2A 3KF5A 1QJX1 1CESA 4CDWB 3D0SA 4BXFA 1PMHX 5TDRA 3TRSB 5FJKA 2HYXA 3MGUA 2HWF2 1H6YA 3EYPA 4M3CA 1ZZ7A 3S5QA 1EAH2 5HXVA 1FPN2 2AENA 2C24A 3UGHA 2VQ0A 4JKLA 2XKPA 3ZXFA 4QX2A 3FAOA 2HWB2 4TLGA 2WO2A 2B7YA 3NNGA 2PELA 1POQA 3AP7A 4CUAA 1X9PA 2BEOA 3WNPA 5BV6A 1N1TA 1SFYA 2NQYA 5FWJA 1ASJ2 1J58A 1K3IA 5FPUA 1HB1A 4GALA 1J1TA 3W20A 2C2LA 4UP5A 1UN1A 1PVC1 3PUAA 1DQ0A 1HRI1 2DVGA 4AAXA 4AZZA 5E89A 1XNAA 4Q4Y2 3T30A 1ULCA 3C7FA 2L9LA 4OHVA 4UW3A 3C6WA 1DLCA 1XOYA 4M00A 5TBNA 4JDOA 1O59A 4OVEA 2D97A 3DGTA 3IM0A 2J1AA 3JBG2 4AL9A 1R1A3 5BNNB 4CDXB 1UKGA 3WG4A 5JLVA 3O0VA 1LEMA 4P9JA 2WWSA 3IB3A 1U5IA 4B3NA 1DIWA 5I93A 3VDBA 1AXYA 3WNLA 1GP5A 5IK5A 1VBA3 4TZDA 1QQP3 4J25A 1ZRFA 5A1FA 3KQIA 3OPZA 2KE1A 3T2PA 2G9ZA 5D1LB 3C3VA 3OF1A 1UW8A 5AC91 3IDEA 1XYOA 5ABJA 1T2XA 4BM8A 4BDVB 1D4M2 3MUY1 2VUDA 3ZMOA 2BRTA 1RUG2 4ZPIA 5C8CC 3ZFGA 1RUH1 2GN7A 5EPAA 3UL2A 5IK8A 5FZHA 5CFDB 2W2IA 1OQEA 3O12A 4D69A 3Q8AA 4XXPA 3FZ3A 4NIIA 1K5MA 4FPLA 5BNOC 5TDWA 3VBOB 1FOD2 3HT2A 3SH4A 4QPIA 2WFPA 5A3OA 4Q0SA 4CP2A 2EALA 3KHCA 4XAAA 1UOFA 4K3UA 3UJQA 2ZGRA 1C1FA 3CQOA 2QIZA 1Q8QA 4X3GA 2JJ6A 2BGOA 1ULPA 2XOMA 3I2JA 1ZYBA 2XUMA 4BU2A 1SLCA 4COZA 5JXJA 3ETPA 2YPDA 1VBE3 1JI6A 4MOAA 4W50A 2D6OX 2B9VA 1BMV1 1BBT3 4LO6B 1HKDA 1EUTA 1H8TA 1QJEA 4BIFA 2R1BA 1R091 4CCCA 5FO9B 2RM22 2ZHNA 4PQQA 1E57A 3KD4A 2WA4A 3N9LA 4AFDA 1NE6A 3LDKA 4EN7B 1C4RA 3DYMA 2J1TA 2RV9A 3QACA 3VDDB 3J26N 4AVTA 4Z2AA 2JDZA 1UY3A 1OLRA 3N9NA 4L58A 2E31A 3QOPA 4Y20A 1LOCA 1I3HA 1UD1A 3P3NA 4Y24A 1F62A 1H9WA 3AZVA 4XMIA 1IS5A 1NKGA 1W8TA 2LXHC 4KL1A 4XBQA 4XF1A 2LV9A 2JD9A 2OPKA 4LBLA 1WESA 4XJZA 3D0JA 2VVFA 4AEDB 5I0SA 1RUE2 1I6XA 1ST8A 3BOWA 4P5YA 3K4ZA 4OULA 1YIFA 3NVCA 1AX0A 3MLLA 1AL0G 5FBJA 2PHUA 1IS4A 1SFPA 2E51A 4LIUA 2XBO2 1DLLA 5FPVA 5FMOS 2KGGA 2MNGA 1TG7A 3WG3A 4EN6B 4ZS3A 3MO4A 1Q56A 4OYUA 4UFIA 5I0UA 5J3UA 4QT6A 3ZXGA 3RPGB 1PM7A 2ZGQA 1PZ8A 4E4SA 1X8MA 2O14A 1Q3EA 3MDPA 4KMQA 5F2SA 2EIGA 3H9AA 2CRRA 1RTVA 2VMHA 3AKSA 3ZKUA 4XBNA 4ZU4A 4BWOA 3FLRA 1OC1A 4IGPA 2B8MA 3DPRB 1YI9A 4G9SB 4XQDA 1LKNA 1O4ZA 5DG1A 2VQAA 2CGNA 5CNAA 2G9FA 3OGSA 1MS1A 3E5UA 5IAXA 2KR4A 1LOEA 2JXAA 3T0AA 1WBFA 3HCUA 5FKCA 2QQUA 5DINA 4XCBA 5K0UA 3RS6A 4UI9B 4OGEA 4LHKA 2B46X 4C91A 2A3YA 2P5BA 2CT2A 3ZSLA 5LA9A 5KC6A 5LEKA 2NMOA 4M4PA 2VNFA 5HI0A 3O36A 3ZVYA 3MFAA 3K75B 5IATA 5JPNB 3IT8A 4XHBA 2C9KA 3CJIB 5FPBA 2ZXQA 3O7OA 4IERA 4LK7A 4RFT0 5GLWA 2XJUA 2P6HA 4FFGA 3VBUC 1FNYA 4LQRA 2BV4A 2YC4A 1VPHA 1C8NA 2Y38A 4WBBA 2DTWA 4A42A 1ODNA 2GN3A 3HNBM 5DAWA 5C71A 2DYCA 1GOFA 2ZCWA 1SPPB 4PBOA 1NY71 5EWSA 1HXS3 4E8DA 3ZPOA 3BU0A 2ET1A 2K9ZA 2XB6C 1UMZA 2WABA 1TME3 2F4PA 2HBUA 2RS33 5AVPA 1ZBE2 2CNAA 2GAUA 2SLIA 2BTVC 4YZ4A 5E1RA 5GLZA 3WUCA 1CAXB 4AI0A 1LB2A 1E5HA 2D3SA 2UU8A 3NG2A 3AJYA 1RHI2 4XABA 3N35A 1DGLA 4UAPA 4FTBA 5SV5A 5K7PA 4F8AA 3BUCA 4UBGA 1YHFA 4K21A 1PHMA 2YV8A 2ZHMA 4OHYA 2C5DA 1BORA 2P3IA 3C2UA 1ZRDA 3FLTA 3JD72 4HKLA 2PXJA 1PNGA 4Q4X2 1VBC1 2CAVA 2R041 4FVVA 1C1LA 3ZFGC 3SOWA 2HWC3 4NHXA 2W68A 1F9KA 2R072 3AP4A 4XDOA 2VD7A 5JOXA 5FO8B 5DUWA 1POV3 3I97A 3D6EA 1WEUA 1D2SA 4JGYB 4COVA 4XZUG 5A3UA 4H9DA 5IFPA 5DDJ3 1K5MC 4AEKA 5L19A 2XVGA 2JG8A 1A6CA 5FMCA 2YUCA 4CP1A 3TEYA 1UZZA 2D5HA 2VW1A 3O0WA 4D6QA 4HOOA 4CCJA 1QJY3 2W3JA 3KMHA 2WT0A 3CBNA 1UPIA 5FYTA 2WN2A 4H7LA 5FYUA 3HBZA 3WNMA 2VJFA 1CZVA 5T3NA 3ZR6A 2JKXA 3SH5A 1NA1C 1TMF3 2QFEA 2RHPA 3T08A 1WGMA 1EPZA 1UYYA 5CKNA 1UPSA 2K4DA 5FP4A 5J98B 3KT4A 4XFCA 4GJYA 5K9YA 2RDNA 3AK0A 2GC1A 2QUOA 1FT9A 2WO7A 1V6MA 4FPHA 4JKKA 3AYCA 1H8TC 3ZYRA 5ISLA 1JBCA 4ISQA 2DFCA 1DGWX 1WE9A 3K48A 3EBRA 1W2OA 2M6MA 2BU9A 1NCRB 4L7XA 1NAEA 3IAPA 1F5FA 1XE7A 2ZEWA 3UGFA 1AYN1 2WNEA 5GLVA 1BHGA 1O3RA 4LHNA 4AG4A 2UYBA 4TYSA 2H0VA 5EZWA 3UJOA 4XI1A 3IHPA 1QEXA 4S2FA 3ZXDA 1OPMA 5IVCA 3E6CC 1VIWB 2YHJA 4XC9A 1WW7A 3WDWA 1WKYA 2VVDA 4P08A 3FHIB 5EJZB 4AI8A 1ULGA 1UY0A 5JAXA 4Q0PA 4JTOA 4P9XA 5K3QA 2XJSA 3IPVB 1QH7A 1TEIA 4LXLA 3AZZA 5FK7A 2CSZA 2OZJA 4LBKA 2BOJA 1RB8G 1RUJ3 4BLJA 2P3JA 1OMIA 4YW3A 2ERFA 5IW0A 4CCNA 5KHKA 1NE4A 3WDUA 2OS2A 2LGGA 3VKOA 2QQVA 2ZKLA 5FZOB 3VL9A 3VD7A 4WM7B 3T09A 2VY0A 3A7QA 2NMNA 1F8VA 1XPWA 4FPJA 4Q4W3 2G19A 5BNQA 5I8YA 4M3CF 2B0OE 3NNFA 4HVOA 4A4BA 2PYTA 3GJAA 3AP5A 4NRQA 2NM1A 3H8OA 3R0RA 2F17A 4CXYA 1OA2A 4PT6A 5CYYA 4XILA 3OBTA 4O61A 4MV2A 2ADDA 1AR73 4A3XA 5AVAA 3J4UH 3LVRE 1OKOA 4Y1VA 3GF6A 4W4ZA 3ZFEB 4YLZA 1NX9A 3GZTB 4XF0A 4X6QB 3BIWE 4BHPA 1WEMA 3AP9A 1SACA 4OHXA 1QOTA 4KU8A 3ZMNA 4CDUB 1UMIA 2L7PA 1K2FA 2RDRA 2ETEA 1MS8A 2WYSA 5JSRA 1V87A 3ZM8A 4MGSA 4PF1A 5LRRA 2E7QA 1IKPA 1A78A 2RS13 4DEQA 2ZBJA 1WMDA 3VBRC 3GHNA 4CDQA 1LEDA 2IC1A 2KD7A 5GLTA 5A7WB 1G7YA 2VMEA 3CNAA 5EJ1B 2JICA 2RS53 4LUMA 3H0OA 3OD4A 1RUI1 2C4XA 4A41A 5E6HA 4JAAA 3GCXA 2EICA 3CU7A 5FFOC 3KQ4B 1TZOA 3NJVA 4XIOA 3THDA 3V64A 3RYKA 2DDUA 4NPRA 4YG6A 2J7MA 4GNEA 3OPWA 1CAWA 4WA6A 1MEC2 2VZOA 5C3PA 3WQ0A 3ZSKA 2VL4A 4PDWB 3WP3A 1JZ8A 5G05B 1WGPA 1OLQA 2W1SA 4JGYC 1UY2A 2W87A 5G04B 4BA6A 2HWD3 4YWAA 2VZPA 2ZX3A 4A7YA 1XU2A 5C13A 1PGW1 5KHHA 4CUCA 1Q8PA 2OXQC 4XAEA 1LCLA 1ZBA2 2HWF3 5A3MA 1SLAA 3PMSA 4LPLA 3RRDA 4KNCA 1EAH3 2BNOA 2PLV1 3ACGA 1FPN3 4PI0A 4CCKA 5F1RA 4K20A 3NKTA 4NAOA 3U1XA 4BQ2A 3L11A 1LOGA 1HLCA 2EVXA 4LNVA 5GZGA 1W2UA 2WFF2 3T3YA 3W21A 3ZPV1 2LRPA 1ZZ9A 1JZ2A 4YGEA 2PHDA 3A22A 3LIHA 3WG1A 1OLMA 3N9PA 1Z2QA 1DCQA 4HXCA 1VB2A 2YYOA 1UY1A 2VQUA 1ASJ3 3ZXKA 2XR4A 4KWKA 2QZ3A 1POV0 4PQ9A 1RMU1 2P4EA 2VZTA 5FZ7A 5FZBA 2E63A 4XQWA 3ZPVE 2TUNA 5LY1A 3FFZA 2XHKA 5J36A 3IWZA 3JCIA 4Q4Y3 1BXHA 1XNCA 2UYAA 4Q27A 4RHV1 2UY8A 4MGYE 3IN9A 4IETA 4FO9A 4DXSA 3JB4C 3PNAA 3C7GA 4P00B 1AJOA 3JBG3 3PUQA 3ZFFB 2WZR1 2X09A 5J48A 5I91A 2QDNA 4OZOA 1Z7S2 3K46A 4BH9A 3TWIA 3VGIA 4ES9A 1VFYA 3C7OA 1PM4A 3HOBA 4AEJA 3CLPA 3LA7A 4N9HA 5LBBA 1YUDA 2PHRA 3RGBA 1ND3B 5A1AA 1D4M3 1P8JA 2HLEA 1R1A1 3M3CA 4GULA 2JDUA 3NSTA 1B35A 1RUG3 1GZCA 2R7EB 3WF4A 3M4FA 3NAPB 3I3MA 4DXZA 1DDLA 1GLHA 4YW7A 2QQNA 3RYPA 4ES8A 2D8SA 5DXDA 2OA2A 3JU9A 2KGIA 2QKDA 4KWLA 1PO23 2YHNA 2VZQA 1X4JA 1PK6B 2XPJA 1U0AA 4JKMA 4EN9B 1W9TA 3OGGA 2RSDA 3AXDA 1FOD3 3POGA 1LHVA 3JZVA 3WDYA 1WILA 2GALA 3QH6A 4YM1A 1H9PA 1HRV2 1VRH1 1AL22 4QAWA 5BNPB 5KH3A 4U36A 3MHSA 4GNGA 1DCSA 5CB7A 2NPIA 1JUHA 2OVUA 5C6CA 3MUZ1 3H50A 2JDMA 2Y6KA 1CAVB 4R4ZA 4F1PA 4AFMA 1QDOA 3DN7A 1WD3A 2XDVA 4FQZA 4DUVA 3I59A 2V73A 1HIXA 2FD8A 4AVAA 3M62A 4UI9L 1W0PA 3KCCA 4EE2A 1HN1A 5JI7A 5F37A 5F32A 2VMCA 4FPCA 5EHDA 5H9PA 4MG2A 3U5NA 2BGCA 4GQ7A 4WV8A 3J8F3 4XUQA 3UGGA 5A6QA 1LDKC 1W03A 4Q4V2 1VBE1 2LGVA 1QNYA 2IXHA 1BK1A 2HEWF 4XZPA 1HX6A 1Z78A 2YROA 4YG3A 1MS5A 2YFZA 4HSJA 2VBPA 1RUC1 1OT5A 3M1HA 5L36A 3AKTA 2VPDA 1GYKA 2VNVA 3VBFA 4AQTA 3E2DA 2CGOA 5KR7A 4XTMA 3LE0A 4PDWC 5JG6A 1UOJA 1R64A 2RMU1 1WZXA 5C7GA 1DZQA 2KR2A 1BEV1 1C8M2 1PO13 1ZM1A 3LAGA 2MA6A 1BYHA 4K1YA 5CFCC 2K16A 2YQLA 5H1VA 4QX7A 1C3HA 1NQDA 1SLBA 4QU1A 2E7AA 5FLIA 3H7HA 3HQRA 2XBO3 2ZAAA 3DF0A 1ZZCA 5A6XA 2JG9A 3MV01 3N7MA 2PUYA 2YFUA 4ZQLA 1AZDA 3WUDA 3AXEA 2YREA 5FIXA 1WLCA 2VOKA 1W6NB 4LBNA 3QD6A 1KEXA 4LLBA 4FSJA 2HWE2 2J1UA 3DUIA 2XL9A 1UYPA 3ZXEA 3T9KA 2EIBA 3KCXA 2YW8A 4LBQB 4OHZA 3VKNA 3HQUA 5A32A 4UFKA 4IQPA 4BB3A 2FMDA 5SVIA 3FX3A 3DPLR 2AGSA 1WW5A 3G6JB 2PHFA 1W9FA 5EYXA 2FCUA 1V0AA 3VBHB 2GH2A 2WQZC 4QQHA 2F4LA 2R16A 4Z8BA 3MPPG 2HEVF 1QOSA 4FQ4A 1AX2A 4UFHA 5IVBA 3O35A 3B5LB 3SISA 4RFRB 2RDQA 4UW6A 2CRWA 5FZIA 4NROA 3ZFFC 4GH4C 3N36A 4MH0E 2ZHKA 4AVCA 2PAKA 1RYYA 2I07B 2XJRA 3AMMA 5A33B 4AFAA 5JXGA 2IUWA 4Q2FA 3UKVA 2W94A 4DQAA 4DPNA 4LO5B 2WZEA 4LMFA 5FREA 3VHNA 1ZRCA 5H1UA 5LKZA 2EXKA 2OXBA 3J9SA 5LK5A 1OUSA 5K0UC 2BPA2 1FX5A 3ON7A 2MEV1 4XXAA 2X29A 3V0AA 5CG9A 1HV0A 3O14A 2FFWA 4AI9A 1MVEA 3KSCA 4Q6FA 2Y60A 4AYUA 1H0BA 2MNZA 2DU0A 3GV4A 1UU6A 4NPLA 5FQ0A 2RR4A 1RUF2 5C9AB 4P9GA 3WW4A 4AI3A 1JOJA 4YC9A 4MXWB 5IJRA 2ZZQA 4N7IA 1WBLA 2P34A 2YXSA 2ZGUA 4JGZC 3LA2A 1UIJA 1HXS1 3GHMA 4KWJA 2G9GA 5AFBA 1CJPA 4TN7A 3AL5A 5FDBA 4YPJA 1JMUB 4YRDA 4I7DA 1LNSA 1XE0A 2MHFA 1F4HA 1ND2B 2ARAA 2RS31 5BNPC 5C3QA 1O3QA 3ECQA 4XF9A 4GAZA 1C5HA 3OYWA 3AFGA 1CIYA 4JC1A 1WMEA 3IMNA 2DVDA 4Q4X3 3OB8A 4B8EA 2R6QA 2PQSA 3N9OA 2UWAA 3VLBB 4ITCA 4LK9A 1ACCA 3SCHA 2ZMNA 2K2SA 3KV9A 3KZ4C 1RGSA 3H1MA 1UZVA 2VPEA 4R9DA 2G6QA 5K8SA 1LGCA 1CZTA 1VAVA 2JWPA 2O0OA 2ORXA 3WVJA 1CGPA 4YNIA 1FMD1 2V5YA 4X8PA 4F7ZA 2HWC1 3LDYA 2YB7A 1S55A 2VUCA 2DVFA 2XJVA 4I3PA 1H2MA 4RS5B 4PI2A 2D6MA 4CPBD 3CZJA 3MZHA 1LAJA 3AMHA 4PHZA 5DDJ1 2LN0A 4QHOA 3W5NA 3HBKA 3NV4A 2JX9A 4LKFA 3WDVA 3VDAA 4FTEA 1LOFC 4ZS2A 1RUNA 4A7KA 1QJY1 3SEPA 2VU9A 1W8UA 1JYVA 4LOSA 4YGCA 5I8SA 3O1VA 3OBRA 3DQVR 5GALA 3QLQA 3BTZA 3OBZA 4IC3A 3SOUA 2BFUL 2I50A 3BI3A 4A6SA 2JD4A 4ASKA 4OGCA 3VZKA 2EXIA 3LEGA 4HG6B 3I49A 4HKOA 5BNOA 3EB5A 2ZEXA 2OUJA 3HAGA 3ZYGA 1MQTB 4MGKE 1OUXA 5FMOL 4WVWA 2WR9A 4I02A 5GZEA 4A7ZA 3VBFC 3QZVA 1UIKA 4IEZA 2A6VA 4RN5A 2Y43A 1HYJA 1ZA7A 3HIFA 3M3EA 1AX1A 5FXVA 4YM0A 4OQ9A 2J1EA 4EQVA 1S0FA 1O7FA 2BNMA 1H1IA 3EJKA 2C1FA 4QU2A 3RI8A 1WFKA 4V3KC 5G05L 2AUYA 1C28A 4HL0A 2G4IA 4H14A 2BVBA 4V2WA 1HB3A 3WDTA 5H1TA 3I4IA 2B45X 4M4RA 3VKLA 4UF0B 3ZIXA 2DCYA 5KXCA 3WNXA 3H8UA 4QQ2A 1LECA 4BE3A 2NLRA 1V9U2 3ZX7A 3HN1A 1QNWA 5JPMB 1OFNA 4BMEA 1FBVA 4QPWA 4JHTA 4RL7A 5FY0A 3WP4A 4R2YA 5T52A 1FATA 1SDDB 1Y7BA 1YXWA 4PIZA 2VMGA 3U4SA 2XEUA 4MVTA 3WG2A 2AN6A 3ZLIA 4ZKTB 2D5FA 5ANQA 4BLIA 1CX4A 1LHOA 2CDPA 2R063 3RMXA 3KV5A 2ZX0A 2IZWA 2YYRA 4MO3M 3LOBA 1L7LA 5F2WA 2AYHA 2WNUB 1NLQA 3H3UA 5CZKA 2J1RA 4GWMA 4A44A 4B4QA 4CDWA 1XNTA 1PX4A 3O47A 5KWRA 4YATA 1NOVA 4YAXA 1K5JA 2YZ4A 4JV4A 3ZNIA 3HR9A 5FXWA 2DV9A 4ZONA 2B5HA 5A6YA 3PDQA 5FLJA 1MR5A 4K8FA 4CCMA 1AR92 1W8ZA 3D4KA 4IE0A 2FMYA 4IDZA 1QJX2 5FZEA 3POYA 4QPGC 4RQPB 2IXIA 1GNYA 2CDOA 1NLSA 3O70A 1OOPB 4L0PA 3EMRA 1VMFA 4CE8A 2Y26A 2RS11 4TWTA 2ZTNA 2WL1A 5AITA 2WQ4A 3PVEA 5FJHA 4IW3A 4WVMB 4BZ4A 5ACA1 2QQPA 3WXPA 3PLWA 3PURA 5C5UA 4HMZA 1UY4A 3MIEA 2RS51 2ATFA 1Y9QA 2VGDA 2GSYA 2VR4A 3N4MA 3T6RA 1DU3D 2XG3A 2OYZA 1SBFA 4OCTA 2QBXA 3K77A 3I2DA 1ENRA 1W6QA 1R081 1ZBA3 4CDXA 5CADA 3WEZA 1JOPA 4HN1A 1HV1A 1PVC2 2XJTA 5CG8A 4LKAA 4CA1A 1QKQA 3D3AA 4SBVA 5FZMA 4XTPA 3PJYA 4RS5C 1HRI2 5T5OA 3VBUA 2WFF3 4KGGA 4EN0A 3ZTGA 1XSRA 2DU1A 1QJFA 2Q1FA 4YW6A 1HYIA 1KDMA 4CEWB 2CKLA 5J1XA 2KREA 2X5IC 4BQYA 4MSXA 3THPA 4IV1C 1YQ5A 1IZ3A 3M3IA 1WEEA 4XJAA 4AFCA 1WLDA 3EHKA 5IVFA 2X05A 2ET7A 3E6DA 2C0ZA 1OFSA 4FJCA 2VZ1A 4Y1ZA 3WQ7A 3JQWA 2VTFA 4GWNA 4LO8A 1QJU1 4PIXA 4E4HA 3X29B 5AC92 1OURA 3LB9A 1US3A 4AVSA 2RI7A 4A4AA 3BN6A 3RZGA 1VJ2A 5FY9A 1XU1A 3PVBB 1RUH2 3ZN6A 1DYOA 3TN91 2E6SA 1Z7S3 3WDXA 3AZXA 4Z2WA 1RIRA 5APAA 2ARXA 2WT1A 1JHNA 4FI9A 2VAUA 2QDRA 4N53C 1JZ7A 2GC0A 3CHXA 3U0ZA 2AC1A 4ZZ5A 4GD4A 2G43A 1GZTA 1G86A 1TVGA 2KFTA 5T50A 3MHHA 2QJVA 3H7YA 3WY6A 5B76A 3VHOA 1W2TA 1YQ6A 5HBAA 1UOGA 4NOTA 1BKZA 4BPZA 1WEQA 1QDCA 4KH9A 1OPOA 3KNVA 4XCAA 5FEYA 4TKPB 1DYKA 1H30A 2D43A 2J42A 2HEYF 1DF0A 4IGOA 1NA1A 5LW9A 3MFCA 2VTXJ 1HB4A 4YW5A 3HD8B 4XFGA 3VL8A 1BMV2 4NVPA 1SFNA 2H6CA 3AM2A 4H3WA 1ULEA 2WWJA 5DZGA 1HRV3 1KJLA 3B94A 1N1VA 1R092 3FLPA 5FB0A 1GNZA 3M7KA 1UU5A 3KWVA 4W4UA 1SQ4A 4QB2A 4QX8A 4AI1A 3WF2A 3Q1DA 3NRUA 1PO21 2W1WA 1ZZ8A 1KS5A 1YRZA 5J7MA 1GNHA 4FFFA 1I5ZA 4FOYA 2PHTA 1CIWA 3VN4A 1FOD1 5FY7A 2BOIA 2ZA9A 4AF9A 1AYM3 4A45A 3VZOA 3OGRA 2W08A 2JEMA 3WW2A 3M3OA 2JDAA 3NV3A 3EO6A 1N47A 4R9CA 1UL9A 2VG9A 3BCWA 3CKHA 4S2DA 5A7QA 1D0GA 1SCSA 4Q4V3 2CSGA 3L1XA 2ARCA 2BFUS 2XL7A 3DPRA 4KU7A 1OOPC 4CDWC 1S2EA 2ZHLA 4YGBA 1J3PA 2Q8EA 4UP0A 1NCQB 3DEMA 1JM7B 3UT0A 1UZ0A 4QPIB 3U4XA 2QICA 4P5HA 1V6LA 2VBDA 4AHZA 1VBD1 3WD5A 1X4UA 5IVJA 4PCRA 1AR63 2QQWA 1VB4A 4D6SA 1NG0A 3J8F1 3MLJA 4YVSB 4CEYB 5DUXA 2GC3A 5FPXA 1YFXA 1DQ1A 1C8M3 4QB1A 3SXWA 1T6BX 4LT5A 4BK4A 4S2HA 3FANA 4QGMA 1T6GC 5EP9A 5JR7B 3S7IA 2WS93 2CAUA 1KXGA 2V4AA 4WM8B 4ARYA 5C33A 1U5ZA 2D40A 1CAUA 1W6MB 4LHSA 4NWVA 5HCHA 1RVF3 1PO11 1QIQA 1SPPA 3B93A 2RJLA 1AR81 3FL7A 2GNBA 4E4DX 1CWPA 1N1YA 1MS3A 2VNOA 2IXLA 3NJZA 4IEPA 3FE5A 2W0XA 3SCGA 2YU4A 5ERLA 3I2HA 4RGGA 2VH9A 2MPFA 3MIGA 4CDXC 3WQ1A 1RUD1 5DAQA 3VBRA 5LBEA 5C3SA 4RYDA 1LHWA 1W2AX 3Q8BA 3VB9A 1NY72 5IAVA 4E27A 1KFXL 3LEKA 1RXGA 3E5QA 5C5TA 3R4DB 1OBNA 2XVKA 2VO5A 2GH8A 3N7LA 5FPLA 2FZ2A 1RL3A 2VW2A 3PMEA 1WCDJ 3PIGA 2Y34A 1GZWB 1O8PA 1H2LA 5CFDC 4NO4A 4FOVA 1PZ7A 5FKBA 4DEVA 4DRRA 2MT5A 1REDA 4JGYA 3VDCA 2CGPA 2YT5A 3NWKA 1LOAA 1GUIA 3OY8A 3IDCB 3VBOC 3ZDSA 4MGTA 2MNYA 3J7NA 5HCFA 1UYZA 2YMZA 3POWA 5C8WA 1QH6A 3M70A 5A3TA 1VBC2 2R042 3AL6A 3K51A 3LPGA 5K0UB 4R9BA 1ALYA 5L7OB 3O1RA 4QDQA 3S0MA 3BTYA 3I2KA 5B77A 4HT1T 4GMP0 3C5KA 2DUOA 4V3LC 2VJXA 2A6ZA 2OW4A 5GKAC 5A1LA 5JOYA 5B78A 3AX4A 5EXOA 1COV1 2A70A 2P3KA 5LKTA 2VZSA 2D6NA 3T7LA 1W6OB 3ST7A 2HYED 4Y1YA 4LBJA 1Q43A 4AHXA 1JOCA 2KU3A 5JWPA 3OD0A 1E4UA 2EF6A 4I01A 1GWMA 1LENA 1XXNA 2BWAA 4CSWA 3IMMA 5KXEA 2YGLA 2Y1NA 3HJRA 3BALA 3VDDC 1FI2A 4FPKA 4MSVA 2FCTA 2WC2A 1SLIA 3URFA 5FXXA 3CF6E 3QH7A 3LRQA 3RG0A 1YJLA 3MF6A 2XUEA 3I7DA 2OWAA 1AHSA 2PHXA 3IPVA 4Y22A 3NKGA 5GZFA 1NLRA 1DGWA 4OUMA 1M06G 1IG3A 2E6VA 2E32A 2OT7A 5FMDA 4AEDC 3MIFA 3RJRA 1AYN2 5BY5A 4Z0OA 4LULA 5FYBA 2ECWA 2WWUA 3POBA 1W8WA 4AGRA 2C2VS 2B39A 2VC9A 4IV3B 2UURA 3RPGC 5IYYA 3KM5A 1SHWB 3LEIA 1IQDC 1BCXA 2UY9A 1VBB3 2JRJA 4O64A 5JDBA 4MYEA 2E53A 2H0BA 1J3QA 5DAVA 1N1SA 1TNFA 5LZ6A 1WEPA 1WEWA 1JH5A 4S3OB 4L97A 4Q29A 4Q26A 3DPRC 4OZXA 1RMDA 4GB31 1XQNA 2JG8B 5FPZA 4G4FA 2P1BA 2GNDA 3O1MA 1RITA 1W8OA 1S0CA 4RD7A 3ZFEA 3DWDA 2KWNA 1BZWA 4HVQA 4KI5M 5FYCA 5F6LB 3VBSB 1TQ5A 1SBDA 1FXZA 1U5XA 4L2NA 5FYMA 5I8TA 4QX1A 2JMIA 2VJFB 5TRBA 5C4WB 5DZFA 4WZCA 1X36A 4NE9A 3FBYA 1V00A 3LF7A 2BWCA 2EXUA 2WZ8A 5EIYB 2IXJA 3GZEA 1XRUA 1X9TA 5LA1A 4XDPA 4Z92B 2VPBA 1IHMA 3CJIC 3QCWA 2R49A 2W46A 3J7HA 4Y33A 1HB2A 3IAQA 5DKAA 2YUEA 3A4UA 2XLGA 5HCAA 3S7EA 2Q1MA 1OVSA 3AP6A 4UT5A 3GCWA 2BGPA 3P1IA 2OQ6A 5H9SA 1QWRA 5DPNA 5T5LA 1KJRA 2AREA 4NUBA 5FZ8A 4WVVA 1MPXA 2LM3A 1OH4A 2VXJA 1ZZBA 2VCMA 3ZVZB 4PIYA 5FMBA 4PDWA 2FUIA 2Q8DA 4QD2A 3M3QA 2R32A 3H42B 3AMNA 5IUQA 3S30A 4AQ6A 4FOQA 1QF3A 4GZ9A 4LEJA 5FR3A 2H0DA 4LOTA 5CFCA 5HV4A 1DQ5A 1RUI2 4XUNA 2FBEA 3OPTA 2WYFA 4B1LA 2LTNA 5H9RA 5F8PA 1ULOA 1US2A 4EWEA 1UO9A 2HH9A 2Q30A 1SDWA 4E8CA 2R061 2IXCA 4PLNA 5FAXA 4CU9A 3B01A 1ULDA 1CPNA 4LKDA 3ZSMA 3LCPA 2HDPA 1UCXA 1W9YA 4B4PA 2B4KA 1AR93 1LODA 2EXJA 5IT6A 5JZGB 1EV11 2J1VA 1QJX3 2A6WA 4UW4A 5C70A 2BDRA 1PGW2 4CYDA 2RR11 2VTXA 4QF3A 1DQ2A 1JU4A 1DHKB 2IXKA 3PUIA 5JIAA 2JB8A 2PLV2 1XE8A 3WHUA 4CZSA 4D3WA 2VUJA 4LK6A 3AMPA 3ZSEA 4YM2A 1UYXA 2DFBA 3KVBA 1PIV1 4C90A 4FPFA 1IS3A 2ECVA 1D4VB 4G3YC 3PLQA 4YW4A 2HWB3 1EUUA 3SITA 3BODA 3U75A 4AR2A 5B4XA 4HZFA 1NQJA 4LJHA 3ZFFA 4GH4A 4DXTA 1GMMA 1OQDA 2Y6JA 4LLOA 4P9IA 2YC0A 3O34A 3ILFA 2Y6GA 3K4DA 1RMU2 3AKRA 4AVVA 4M3CE 2XKOA 1DQ6A 1HRI3 1WA6X 3DECA 5L9BA 5LA2A 4CU6A 1KRIA 3H3ZA 1JUIA 1NCRC 2DCZA 4ASMB 2VZRA 2CSYA 5LKXA 4RHV2 3LSDA 3NO8A 5K4LA 3FMGA 2XOYA 4D94A 4QQ4A 4IV3C 1PZ9A 2AACA 2WN3A 3IKWA 2G1MA 2WO1A 3KLSA 2VVEA 4QKDA 3U14A 4COUA 2G45A 4I7CA 1CAWB 1YFYA 2WZR2 4A2UA 1A3KA 4XW3A 3ZSJA 2Q0AA 4HK8A 4IEYA 4JGZA 3K3OA 2Q8CA 3USUA 2JM3A 3SUBA 3LFMA 3ASIA 2YSJA 1Q5OA 4S3OC 2VOXA 5FP3A 2UWBA 5AC93 5FZ4A 4AQ2A 3KGZA 3WR0A 3GYDA 3DDTA 5BNPA 1R1A2 4BQWA 2AR6A 3N7KA 4D7SA 3WHTA 1E5IA 1LJ7A 2WA3A 3WX5A 1QOOA 3PUHA 3KCYA 1H1MA 4WM7C 4ORFA 1H6XA 4RSUA 4GWJA 1HQNA 4DUWA 1O3TA 5C4WC 1O5LA 4AGVA 1LU1A 1CAVA 1VBA1 2TNFA 1QQP1 4Q0QA 5GM0A 4AWDA 4LE3A 1R1ZA 2LALA 4NIDA 5I0RA 3ORJA 3RZHA 2EIDA 2Y0IA 2D7FA 2NYYA 4FPOB 1GBGA 1GV9A 4ZUXU 1WMXA 5TSWA 1VRH2 1N87A 3OUIA 4Z0RA 4BCUA 2ZX1A 5LATA 2A6YA 4ATEA 1YFWA 4XPVA 3ZFEC 4A0CD 3ACFA 2RVAA 1V70A 3LZZA 3INAA 4O7XA 4XFFA 1F5JA 1UX6A 2GDFA 3GXUA 1D2QA 3UYJA 4CDUC 1W6PB 2I74A 1U6GB 3ZYJB 3O1OA 2ZGMA 5JXIA 4H7MA 1WCUA 2JUNA 3FJUB 2M1RA 3SQOA 2WRAA 1LOFA 3BPZA 1R093 2MIQA 1W3XA 4Q0UA 1DQ4A 1H4GA 5EFUA 3WLUA 4J6GA 5LBCA 2JB4A 3WF3A 2KKYA 2RM23 2SBAA 1IG0A 4PPEA 3VD9A 3VZLA 4AYCB 3H3LA 1ZBDB 1VBE2 3HWJA 2JMJA 2QE3A 5BNNC 1APNA 1O8SA 2DCJA 2I45A 3I3QA 3MEPA 5FP8A 2TEPA 4LE4A 1RUC2 1JHJA 4TTGA 3H8XA 1KITA 4QGNA 1BBT1 4IC2A 4FFHA 1XNKA 1YQ2A 2W92A 3RPQA 2MA5A 1GICA 1A8DA 2RMU2 2C6SA 3EB6A 4OI0A 1W6NA 3NMBA 5JZGC 1J3RA 1BEV2 2QQJA 4EROA 2W5FA 2YC2A 1YO8A 4JRLA 3SEEA 4LBQA 1AYM1 3PU3A 4K1ZA 3MLKA 1RUE3 1S2KA 4NRMA 2JE9A 4AFBA 5D1KB 2WLPA 3U5MA 1PGL1 1ZVFA 2Y8KA 2VNGA 1REFA 1YYNA 3ZDVA 3LGRA 3VHPA 3LDRA 1NZCA 2XVLA 4Y4RA 5D8AB 4N43B 5JR2A 3VKMA 1QU0A 4QB6A 5F7UA 4UFLA 2ZABA 3H8RA 2BBVA 2LXPC 4NRPA 5F5CA 4TXWA 5A33A 1KS4A 3I59B 4NPMA 1DZTA 5A3WA 1T1HA 3A0NA 3M99A 5KXBA 2JIGA 1OHFA 1AR61 1WA4A 3P5BA 5B8DA 4CP9B 2ES3A 2ARBA 3SC7X 2LGKA 3TB0A 4HPKA 2KIZA 3FUQA 1F2NA 1YCIA 1XNBA 3AB0A 3PL0A 2GNTA 3Q8FA 4YVWB 4E2SA 1JYNA 4C9ZA 2Y6LA 1OQ1A 2WINB 3LA3A 2GC2A 4ZXEA 1PGSA 3VV1A 2YU2A 2EAAA 2VMDA 2WS91 5FB1A 4AHYA 2QJ0A 5C9AA 3PU8A 4IEQA 4XJWA 4MXWA 4MUVA 5FO7B 3WCSA 1WEOA 1RVF1 4DB5A 2PN5A 1PX3A 2DURA 2VJEA 3I2FA 4E9KA 1IQAA 4Y5Z0 2DUQA 2HKXA 3E1F1 5DQ0A 3A21A 1HQLA 3KVAA 5FK8A 3N7JA 2MEV2 4DIQA 1N3QA 1WIMA 1ND2A 3ACLA 4QPGA 3GL6A 1ND3C 1RUOA 2O1QA 2CV6A 4JCKA 2WSUA 3H1WA 2JG9B 5FZ6A 3T2TA 4COYA 4KG0A 1YJKA 4O62A 3M8LA 1L7RA 2D93A 3NAPC 4JDNA 1ZBE3 4AQSA 5IK4A 2WNVB 3JB8A 2WDBA 2QQOA 2KYUA 1YQCA 3A23A 4ATFA 1F4AA 4LTAA 1RHI3 3CZUA 1HXS2 1YQ8A 3UV9A 3RZMA 1H4HA 1PK6C 1YC61 2VECA 3VKFC 1G9BA 4XFBA 4YBTA 5J3XA 2RS32 5A32B 3TEZA 4E2QA 4CTEA 4NMIA 1TME1 1UXZA 4EZ4A 2WBKA 4DY3A 3V0BB 4O65A 4YZ3A 2L75A 3D5OA 1W8HA 2GP5A 4YGDA 2R043 4XACA 3V56A 5C3OA 4O9EA 1JZ4A 4MGIE 4RS5A 3JD73 3VHRA 3POIA 4WZFA 4JVAA 4N7UA 4NN0A 3ACIA 3Q8CA 5FZ3A 3ZO0B 1LU2A 3O1TA 1QXRA 2R073 5FUNA 1ZZ6A 1GANA 1WWYA 2X5IA 2VCCA 2L0BA 2QZ2A 5I0TA 4IV1A 2JDPA 2JE8A 2YHOA 4RR3B 4XHXA 1UAIA 4FTSA 1FMD2 1JODA 1X33A 2HWC2 1IPJA 2BAYA 3USSA 3DL3A 2ZETC 2ECJA 3S5AA 2Z5WA 3ZKYA 5FXZA 3H7JA 1POV1 2LROA 5DDJ2 5IHRA 1O6UA 5A80A 3V0AB 2ZX2A 1AXKA 4J1XA 1MQTA 2Z79A 1D0HA 4B4RA 2PAEA 5LY2A 1H2KA 4BK5A 4R8PK 1QJY2 2BZDA 5FQ0B 1B09A 2VP7A 3RI9A 1FNZA 3FM8C 3GM8A 4XETA 4FAGA 2AEZA 1K45A 3WF1A 2KM2A 2XQRA 1Q8SA 4IXLA 4N53A 1TMF1 1AYN3 3MI8A 3LQJA 1DGRN 1UWWA 4BQ3A 4FPGA 3GGLA 1QJZA 4DOUA 4YBSA 4FPYA 3TNPB 3APBA 2BP6A 3KT7A 3OEAA 4UF0A 4LIVA 1UNBA 3K2OA 4SLIA 1K12A 1HQWA 3Q8EA 4P9WA 1OKQA 5LEJA 2DSMA 4AVXA 1YNAA 2FUUA 5E88A 1W9SA 1ULFA 1BVVA 4Y1XA 5FRAA 4BOWA 4DRVA 5BYNA 2FDHA 2XJQA 1QXJA 4PJYA 1NUKA 1JS9A 3FEHA 1Y9GA 4QDRA 3SH3A 2ECIA 3TYJA 5IWFA 1VBB1 3DXTA 5G04L 3LPFA 1SLTA 2JECA 3MDBC 3I2IA 3D82A 3MIBA 4YFWA 2WNUA 4IE4A 2CY6A 2Y6HA 4YZ2A 5JIUA 2IWGB 3F2ZA 2B9UA 3RSJA 3VBHC 3GBGA 1JYTA 4HBNA 1UMHA 4NHMA 1MM3A 3AJZA 2VUAA 2XONA 5FZ1A 5CA6A 1RUJ1 4L92A 2OKXA 2VOTA 3WP6A 2JE7A 4QQLA 3CEWA 4W6XA 4NJ4A 5FZCA 3NV1A 5L73A 3SKJE 4DNYA 5JSOA 3LJUX 2R30A 2A5ZA 4WZ2A 3T4HB 5C8CB 1LHUA 1SEFA 5A3NA 4CCEA 2M13A 1QHDA 4QX0A 1VRBA 1CQ9A 2RE9A 1DFQA 4Q4W1 4B7KA 5FZKA 5CEHA 2FDFA 2FSAA 4C0HA 1Y3TA 3N3HA 2D6LX 3U10A 2PMWB 1SG3A 1AUYA 1IPKA 2DVBA 1OOPA 4OMDA 4DS0A 5BNOB 2XH6A 2O8QA 4E2GA 1FAYA 4BBQA 2FDIA 3POEA 4BISA 2BNNA 1AR71 4JHZA 3KDEC 4WVMA 5DG2A 4LBQD 5C9AC 3C7EA 2V72A 3PVNA 4CA9A 5LA0A 1QGLA 1VP6A 3J7MA 4LR4A 4XMAA 2EA6A 5HXMA 5DUVA 1CVNA 2VZUA 1WENA 4LBOA 2YY1A 2YVRA 1QXPA 1RUI3 5DN2A 1ND2C 2D8UA 2ILMA 2RS12 4LHLA 4QKNA 4OHWA 5HPOA 5FZ0A 4XUPA 3LD8A 5ACA2 4XF3A 1MEC3 2HJIA 4QXCA 4Y3OA 2IVJA 3HNYM 3I3BA 4NWWA 4KGQA 4CEWA 2RJKA 2RS52 2Y0OA 3EXUA 3ETQA 3NJXA 5FTTC 1JZ3A 1CPMA 1PVXA 5D1MB 5FBZA 4ASLA 4FXKB 1A34A 3KHBA 4IEXA 3IDAA 4XYXA 2K46A 4RR3C 1Y43B 1IOAA 2YBPA 5AFEA 1R082 2E7TA 2JDNA 4JDMA 1JYCA 2YBSA 3CMGA 2CWMA 2ZEYA 4MXVA 4QMAA 5F39A 4WZ3B 2MD8C 4MZUA 4QXBA 5H9MA 1IGOA 3NNLA 4K6BA 1X4IA 4LADB 2ZZJA 5JMOA 1CX1A 4K8RB 3GALA 2HWD1 1REEA 4OLLA 3V65A 4AW7A 2IFRA 4KG8A 2DJAA 3T2OA 3ALQA 2HWF1 4XBLA 1LHNA 5F3CA 3RZKA 1EAH1 2VCBA 4MLOA 2UZGA 1FPN1 1RMU3 3HCSA 2L5UA 1MM2A 2VOVA 3T0BA 2LGLA 1I9RA 5CFDA 4M0NA 2IFWA 2VPVA 2GP3A 2GMMA 3ILNA 2HWB1 1QJU2 4RHV3 1X50A
chains in the Genus database with same CATH topology
4I0BA 2LQ6A 5GJ6A 3VBOA 1MQTC 1ASJ1 1RINA 4YZ5A 1YLLA 2WZR3 4XQ4A 1G9AA 4OFGA 2M85A 4M3CB 2Q8OA 3TN92 4JQRA 4GMP3 4QXKA 3SCFA 5DUUA 3RNSA 1S0DA 2BYVE 4HFSA 3TOJA 4Q4Y1 4GNDA 3BOPA 4D7YA 1EP0A 1W6QB 2Z69A 1U12A 5J96B 3JBG1 2FZ1A 1YIPA 2CL2A 3BU7A 3EQEA 1YFUA 3VBUB 4LJNA 3UKNA 3O5SA 1U5YA 1C5IA 3ZYPA 2CKLB 3U07A 3VDDA 3ILRA 1G25A 2PFWA 1J59A 1VR3A 1D4M1 1JW6A 4H55A 4XJ9A 4W65A 1MZFA 1SLLA 1VRH3 1RUG1 3TNQA 2P2KA 4AUQB 1H1AA 3ZXAC 1VALA 2OZ6A 1AL23 2ZJCA 3BB6A 1ZX5A 2K0GA 1PO22 2WNUC 2M3HA 3RWNA 4AEDA 3GZUC 1GFF2 3R4SA 4Z82A 1NCQA 3TBDA 1JM7A 4YADA 1HDKA 4FPEA 4YSFA 2L43A 1A8MA 5ABJB 2MD7B 2DCTA 3BTAA 3ZN6B 4YVSA 4CEYA 2YURA 4AP4A 3ZFGB 1WMFA 3AFKA 1EPWA 4UXAA 4BHWA 2Q4SA 3Q9OA 1XNDA 4FXGB 1IYMA 1K5MB 1RUC3 4RQPC 4FCAA 4A49A 3B00A 2R0FA 5F6KA 3S6PA 5FCCA 5KHJA 1VBD2 4WM8A 1XYPA 1W6MA 2RM21 2VULA 2RMU3 5LKUA 3AYEA 3J8F2 1X8EA 2P37A 5KHGA 3R4UA 1BEV3 1FYUA 2A3XA 2E9QA 1NA1B 3MIDA 3O33A 2ECGA 4I09A 5GZDA 1JXNA 4AHWA 2CTVA 2PAMA 4I30A 4Z07A 2R1DA 3CJIA 3I54A 2EAKA 1TE1B 1H8TB 3H1YA 1WD4A 2ZOEB 5BUVA 1PO12 3OCPA 4R8HA 5J09A 3KT1A 2DUPA 3KS7A 4Q1PA 1AR82 2XWJB 2EXHA 4CEWC 1RUE1 2HWE3 1XYNA 3V43A 2D6PA 2XBO1 4P9LA 4ZDTA 2NZ9A 2BUKA 1GZWA 4B29A 4Y20B 4FK5A 2ZGPA 3POSA 4XFAA 2P17A 1CAXA 1RUD2 4XEZA 2GU9A 3LQIA 3RQ0A 1Q8VA 1UKRA 3HQXA 3TAYA 1MVQA 4PLOA 2CYFA 5F5QA 2PTMA 3VK6A 3MICA 1DG6A 4UW5A 3ROUA 5FOBB 3AKQA 3R05A 2WSVA 5L7OA 3ZN5A 5TABA 1CD3G 4Y1UA 5E8AA 2MEV3 2ZGLA 2PQQA 4U2AA 3RMYA 1W6OA 5KBFA 4A4CA 2XJPA 3IIAA 4YBMA 3MF9A 1CAUB 1RUF3 3VZNA 5B2GB 5FERA 3VZMA 1LTEA 4R9AA 3FJSA 3IDBB 4META 1N3OA 3LSEA 4LO7A 1COV2 3L9JT 3DV8A 1VD4A 1ZBE1 2NN8A 5EJ3A 4YYOA 2ECNA 2DWRA 3UK9A 1G9FA 3VBRB 1RHI1 5JOZA 4L99A 1NCRA 1ZRRA 5H9QA 1LGNA 1HW5A 4AI2A 2WT2A 4HETA 5ABJC 4IV3A 4J1WA 3CO2A 3HCTA 4I0WB 1FMD3 2PA7A 3JD71 1RJ7A 4JTNA 2K1JA 4LA2A 4Q4X1 4CCGX 1O4TA 4W6WA 3SLIA 5JSPA 1S0IA 2R071 1V6NA 2A75A 2XLFA 1G8WA 4I7BA 4RGAA 3B7MA 3OY8B 2WKKA 5E16A 1NCQC 2F6NA 3M7AA 1WCKA 4QPIC 3D8CA 3U5PA 3WT3A 4WM7A 4K9SA 2NAAA 3VBSA 4EJRA 3N9MA 3FBMA 4YVSC 4CEYC 5C4WA 3ZYIB 1GZ9A 1W0OA 2ZPXA 2CWSA 3RTRB 1GQGA 4Q1RA 4OI2A 2D3PA 5LCWB 3PHMA 1XWHA 3FL2A 3ASLA 5CIRA 3MPBA 3E6BA 4GB32 4I3GA 4X8NA 5I3LA 1GSLA 4GKYA 1PNFA 2ZMKA 3R6SA 2YPJA 3HTKC 1VAMA 1GR3A 4NR1A 4WM8C 5CVRA 3WINE 4AEMA 3ZXJA 3SOXA 1Z0HA 5GLUA 4PF5A 4C1XA 4NN2A 2Y1MA 4CDUA 1G9DA 2QNKA 3KQRA 3GNEA 2D3RA 1EY2A 4RA0A 4QHBA 4Y4YA 4N9IA 5B75A 4YFZA 5C11A 4B7YC 4F52B 4HVRA 4Y22B 4N3WA 1WCSA 1OA3A 4LA3A 3NW4A 4BQ1A 5BNNA 1V9U3 2Z2SB 3GBWA 1J1LA 4M01A 4DFSA 2WJSA 2JMDA 1BVP1 1OSGA 3PTYA 5F9TA 4WZ0A 1Z6UA 2GMEA 4YM3A 1H2NA 3HMYA 4FAHA 3E5XA 4QM9A 5JZGA 4X6RB 3LKJA 4AXOA 3KB5A 4M0HA 1FP0A 1DBNA 2D6KA 2R062 5DZEA 4K7JA 3MW2A 4ONUA 1N3PA 4I0AA 1MZ6A 2JENA 3MYXA 4FP2A 4JRAA 4N90A 5K0UC 3SMHA 5L7OC 1KQRA 5CG9A 3WZ1A 1WW6A 1EV12 2BW8A 2W39A 2XWBB 1OD5A 3CJXA 1L3JA 2RR12 4ISRA 3AMQA 1VLNA 3N9QA 2GNMA 3G7DA 3PVOA 1DZRA 1ZNPA 2WZPP 3SNMA 1UU4A 5LRSA 1IKQA 5ACA3 5EV7A 3B3QE 1KD7A 4XJ8A 1LOBA 1PIV2 4EV0A 5T5JA 1ZREA 3FUOA 3FFQA 4HK9A 4Z1VA 2N7GA 2ZGKA 1S2BA 5CBLA 1DGRA 1R083 4EWAA 3JQXA 3GZAA 3PJQA 1MEC1 3WOGA 2ECTA 2VPGA 1PVC3 2ZACA 4WVZA 2H0DB 3W58A 2PHLA 4CDQB 3B9CA 5CFCB 2IDAA 1CJDA 5BPXA 4HKWA 2ZMLA 2A73B 1ND3A 2PHWA 4LBMA 2VMIA 4QGLA 4GNFA 1ZBA1 2W52A 2VOWA 4IEWA 3RJ2X 4KQ7A 3NAPA 5EYAF 3ZIWA 4NHLA 2WFF1 1ZA4A 4YW2A 1CR7A 1QJU3 2D98A 4GA9A 4NHKA 1PK6A 3WP5A 4GIQA 3OJBA 4YG0A 1JTZX 2JG8C 4QQPA 4COWA 1S0GA 1LR5A 5KC5A 3TN93 1BJQA 2QVSB 3THTA 2LDRA 4DMIA 1RUH3 3VBSC 1RJ8A 1VBA2 1QQP2 1W6PA 4V1PA 4BYYA 4N4FA 2OIIA 4QQOA 4GH4B 4DINB 2KWJA 5GZCA 4LLFA 2B42B 5HCBA 3ELNA 4GMP1 1X82A 3SHBA 4EWDA 4AE2A 1Z7S1 2GMPA 4AYCA 2A6XA 4PBPA 3RYRA 2F6JA 3E97A 2GZWA 3ZVXA 4QX5A 4GB0A 2BVVA 2ZGSA 5BXXA 1CONA 1RC6A 1AJKA 3AZYA 1X7NA 1LGBA 2YDEA 2XB1A 1G6NA 4JGZB 1C57A 3USUB 3IBMA 1V6JA 1NXMA 3AKPA 3HT1A 5T54A 2OUHA 1MS0A 4MX3A 1BBT2 1F31A 5KXDA 1HRV1 1MACA 3MIHA 1AL21 4XIKA 1B35B 4P9YA 3AYAA 5D8AA 3FC0A 4N43A 3OTFA 4R52A 1H8VA 4LUKA 2NP0A 1AYM2 3ZN4A 2FQPA 2ZGOA 3LWCA 1PGL2 1VBD3 3VZJA 3WV6A 4YVWA 1ENQA 4GXLA 2PNXA 2UWCA 3VBHA 3AZWA 2TBVA 4HN0A 2D44A 1Q8OA 2X53S 4W6YA 4Q4V1 3B9IA 4QM8A 1AVBA 3L2YA 1AR62 2LRIC 1WEVA 4R4XA 4MGZE 4KBBA 4XOGA 2E6RA 3CL1A 4Q8LA 4HANA 4CDQC 4OI4A 2H6BA 4I2OA 5EYYA 1C8M1 1AR83 2I2SA 3U11A 2ZGNA 1DYPA 2AZ5A 2DF7A 3L2HA 3O7AA 1I1EA 1KDKA 4BIOA 4AVBA 2WS92 4QPYA 3LQHA 2Z42A 2F6BA 4FBFA 4URTA 3VBFB 2WNVA 1RUD3 1RVF2 5T5PA 2KXLA 2EGPA 3OGJA 1AF9A 4OI1A 2EA7A 2HWE1 5JVVA 4P5OB 3KGLA 3RZZA 1IS6A 2V09A 4HSLA 2YGMA 3ES1A 3V0BA 3QBQA 1JN2P 2EODA 1S0EA 3ZYQA 4L9BA 2AH2A 1SBEA 1AXZA 2C9AA 5D1IA 4IEUA 3AYDA 1URXA 2DCKA 2QCSB 2Q5TA 3O0XA 1WLTA 4RR3A 4ZU5A 4IEOA 1TME2 1FV2A 4XE9A 2ZKNA 1JYIA 4HPKB 1W39A 4F83A 1O5UA 1VBC3 1O4YA 5J37A 1CHCA 1LDJB 1QMJA 2DX8A 1G9CA 1UF2C 5SV8A 4K40A 4D7TA 3T1MA 4YARA 5JI9A 1CN1A 1YI7A 4O9GA 1COV3 2ZX4A 4GKXA 5JCTA 1M4WA 3UKTA 4TSVA 4Y26A 1RUF1 2ZGTA 4E4ZA 3W59A 3WCRA 2VJEB 2A3WA 4OUSA 2HYKA 1ONAA 3W9AA 5LK7B 4QPGB 1MS9A 4CRQA 3P3PA 4DY5A 4F3JA 2ENRA 2O8OA 2ZAHA 1NYWA 1V6OA 3NL1A 4FT8A 5A3LA 2VW0A 1B35C 3T1LA 4YZ1A 3ATGA 4Q8KA 5IK7A 2YSMA 1KFUL 2FHRA 4L8QA 3VUOA 1TMF2 5KH7A 4PTBA 4IESA 3FWEA 2KWKA 1MS4A 1GKBA 1OA4A 4C1WA 1V6IA 3WW1A 1QY4A 2DVAA 1MZ5A 4BMBA 4ZU7A 2L80A 2ZS6B 3OYWB 5KHIA 3ES4A 5D8AC 1SMVA 4N43C 2WIIB 5CAZA 2XGXA 3SHRA 1S1AA 2X5IB 1V6KA 2A7AA 3WW3A 4IV1B 4GB33 5AIUA 1ENSA 2BQPA 4R7EA 3ME2A 5C8CA 4CP0A 2A71A 1VAKA 3M63A 1MZEA 1O91A 1VBB2 3A0KA 3PHDA 4IEVA 3ENRA 4LO4B 1GQHA 4HLTA 4S2GA 5G0FA 4YVWC 1LRHA 4XDQA 5FLHA 4AGGA 4FOWA 2KWOA 1RUJ2 1TNRA 4IL7A 3B02A 3DKWA 1O3SA 2XLAA 1OI6A 4XJUA 1S0JA 2R0HA 5CU1A 4B7EA 1WUVA 4PLMA 2LUWA 5FOJB 4Q4W2 3NV2A 3MW4A 3ZPYA 1S0BA 3L1ZB 2Q1ZB 1NXD1 3MW3A 4N53B 4UBHA 1DVPA 2F42A 4Q0VA 4RQPA 1WLWA 3ZXLA 4YABA 4C0BA 2MUMA 3U5OA 1AR72 1UZYA 2JG9C 2YQMA 5KH9A 4INDA 2WNVC 3RDIA 4P14A 5B79A 1V9U1 1FV3A 1BQPA 4B86C 4XFIA 4FIPA 4DZGA 4L11A 2DTYA 2WLQA 3GBFA 1LULA 2X8KA 3M2MA 4XFHA 4AK3A 2JKBA 4ZXKA 2K17A 2KA3A 4YW1A 5JMCA 4EN8B 1Z60A 1YWKA 2VXRA 4FP3A 3KV6A 2VNRA 1ENXA 1EV13 1EYBA 1LESA 2RR13 3LOIA 4TLFA 1SCRA 1WW4A 3JUUA 3B69A 4XF4A 2PLV3 3I8TA 1VYXA 1PIV3 1PMIA 1AR91 5JOWA 5T55A 4QF2A 2HWD2 1QJX1 1CESA 4CDWB 3D0SA 5TDRA 3TRSB 3MGUA 2HWF2 4M3CA 1ZZ7A 1EAH2 5HXVA 1FPN2 2AENA 2VQ0A 2XKPA 3ZXFA 2HWB2 2B7YA 2PELA 3AP7A 2BEOA 5BV6A 1N1TA 1SFYA 2NQYA 1ASJ2 1J58A 4UP5A 4GALA 1J1TA 2C2LA 1UN1A 1PVC1 1DQ0A 1HRI1 2DVGA 5E89A 4Q4Y2 1ULCA 4OHVA 4UW3A 3C6WA 4M00A 5TBNA 4JDOA 4OVEA 2D97A 3DGTA 3IM0A 3JBG2 1R1A3 4CDXB 1UKGA 3WG4A 5JLVA 3O0VA 1LEMA 4P9JA 2WWSA 1U5IA 4B3NA 1DIWA 5I93A 5IK5A 1AXYA 3O37A 4TZDA 1VBA3 1QQP3 3KQIA 1ZRFA 3OPZA 2KE1A 5D1LB 3C3VA 3OF1A 1UW8A 5AC91 3IDEA 1XYOA 5ABJA 4BM8A 1D4M2 3ZMOA 1RUG2 5C8CC 3ZFGA 1RUH1 2GN7A 3UL2A 5IK8A 5CFDB 1OQEA 3O12A 4D69A 4XXPA 3FZ3A 1K5MA 4FPLA 5BNOC 5TDWA 3VBOB 1FOD2 3HT2A 3SH4A 4QPIA 2WFPA 4Q0SA 4CP2A 2EALA 3UJQA 4K3UA 2ZGRA 1C1FA 2QIZA 1Q8QA 4X3GA 2JJ6A 1ZYBA 2XUMA 1SLCA 4COZA 1VBE3 2D6OX 1BMV1 1BBT3 4LO6B 1HKDA 1H8TA 4BIFA 2R1BA 1R091 5FO9B 2RM22 2ZHNA 1E57A 3KD4A 2WA4A 3N9LA 4AFDA 1NE6A 4EN7B 1C4RA 3QACA 3VDDB 3J26N 4AVTA 2JDZA 1OLRA 3N9NA 4L58A 3QOPA 4Y20A 1LOCA 1I3HA 1UD1A 3P3NA 4Y24A 1F62A 1H9WA 3AZVA 4XMIA 1IS5A 2LXHC 4KL1A 4XBQA 4XF1A 2LV9A 2OPKA 4LBLA 1WESA 4XJZA 3D0JA 2VVFA 4AEDB 5I0SA 1RUE2 1I6XA 3BOWA 4OULA 1YIFA 3NVCA 1AX0A 3MLLA 1AL0G 2PHUA 1IS4A 2E51A 2XBO2 1DLLA 2KGGA 5FMOS 2MNGA 3WG3A 5J3UA 4EN6B 3RPGB 1Q56A 5I0UA 4QT6A 3ZXGA 1PM7A 2ZGQA 1PZ8A 4E4SA 1X8MA 1Q3EA 3MDPA 2EIGA 3H9AA 1RTVA 2VMHA 3AKSA 4XBNA 4ZU4A 4BWOA 3FLRA 2B8MA 3DPRB 1YI9A 4G9SB 4XQDA 1LKNA 1O4ZA 5DG1A 2VQAA 2CGNA 5CNAA 2G9FA 2KR4A 1MS1A 3E5UA 1LOEA 2JXAA 1WBFA 3HCUA 5DINA 5K0UA 3RS6A 4UI9B 4LHKA 2B46X 4C91A 2A3YA 2CT2A 3ZSLA 5KC6A 5LEKA 2NMOA 2VNFA 5HI0A 3O36A 3ZVYA 3MFAA 5JPNB 3IT8A 4XHBA 3CJIB 3O7OA 4IERA 4RFT0 5GLWA 2XJUA 3VBUC 1FNYA 2Y38A 1C8NA 4WBBA 2DTWA 2GN3A 2DYCA 2ZCWA 4PBOA 1NY71 5EWSA 1HXS3 2ET1A 2K9ZA 2XB6C 1UMZA 1TME3 2F4PA 2RS33 5AVPA 1ZBE2 2CNAA 2SLIA 2GAUA 2BTVC 4YZ4A 5E1RA 5GLZA 3WUCA 1CAXB 4AI0A 2D3SA 2UU8A 3NG2A 3AJYA 1RHI2 3N35A 1DGLA 4FTBA 5SV5A 5K7PA 4F8AA 4UBGA 1YHFA 4K21A 1PHMA 2YV8A 2ZHMA 4OHYA 2C5DA 1BORA 2P3IA 3C2UA 1ZRDA 3FLTA 3JD72 4HKLA 3SOWA 1PNGA 4Q4X2 1VBC1 2CAVA 2R041 4FVVA 1C1LA 3ZFGC 2HWC3 2W68A 1F9KA 2R072 3AP4A 5JOXA 5FO8B 5DUWA 1POV3 1WEUA 3D6EA 1D2SA 4JGYB 4COVA 5DDJ3 1K5MC 4AEKA 5L19A 2XVGA 2JG8A 1A6CA 2YUCA 4CP1A 1UZZA 2D5HA 2VW1A 3O0WA 1QJY3 3KMHA 2WT0A 1UPIA 4H7LA 3HBZA 2VJFA 5T3NA 3SH5A 1NA1C 1TMF3 2QFEA 2RHPA 1WGMA 1EPZA 1UPSA 2K4DA 5J98B 3KT4A 4XFCA 5K9YA 3AK0A 2GC1A 2QUOA 1FT9A 1V6MA 4FPHA 3AYCA 1H8TC 3ZYRA 1JBCA 4ISQA 2DFCA 1DGWX 1WE9A 3K48A 3EBRA 4L7XA 2M6MA 1NCRB 1F5FA 1XE7A 1AYN1 2WNEA 5GLVA 1O3RA 4LHNA 4AG4A 2UYBA 4TYSA 2H0VA 5EZWA </