4MVTA

Crystal structure of sumo e3 ligase pias3
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
283
structure length
255
Chain Sequence
DVTMKPLPFYEVYGELIRPTTLFEEAHFTFALTPQQVQQILTSRDYTIQVQLRFCLCETSCPQEDYFPPNLFVKVNGKLCPLPGYKRPSRPINITPLARLSATVPNTIVVNWSSRNYSLSVYLVRQLTAGTLLQKLRAKGIRNPDHSRALIKEKLTADPDSEVATTSLRVSLMCPLGKMRLTVPCRALTCAHLQSFDAALYLQMNEKKPTWTCPVCDKKAPYESLIIDGLFMEILSSCSDCDEIQFMEDGSWCPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of SUMO E3 Ligase PIAS3
rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords E3 SUMO-protein ligase PIAS3
total genus 63
structure length 255
sequence length 283
chains with identical sequence B, C, D
ec nomenclature ec 6.3.2.-:
pdb deposition date 2013-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02891 zf-MIZ MIZ/SP-RING zinc finger
A PF14324 PINIT PINIT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.780 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4mvtA01
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4mvtA02
2ECVA 4A4CA 5TRBA 2YSJA 3C6WA 1JM7A 4GNDA 2YUCA 4S3OC 2CKLB 2VPDA 1WEUA 2MUMA 2PNXA 4LADB 2M1RA 1ZBDB 5H9MA 2YURA 2UZGA 3ZPV1 5LCWB 2KREA 3N9QA 2VPBA 5D1KB 2QICA 2MD7B 1HYJA 5TDRA 3DPLR 3T6RA 4PTBA 4ZDTA 2RI7A 3O37A 3VK6A 2MNZA 1JM7B 2C2VS 4LK9A 2MD8C 1WGMA 2AN6A 1K2FA 5LKTA 3O36A 3FL2A 4FIPA 3KV6A 2EA6A 2EODA 4LLBA 4B7YC 2E6RA 4MVTA 5G04B 2YU4A 5B75A 5D1LB 4YBSA 5B78A 5EYAF 3O35A 2VJFA 2JMIA 4I7CA 2LRIC 2JMDA 1VYXA 4WZ2A 5KH9A 2M85A 5TABA 1IYMA 1LDJB 2QJ0A 2FUIA 5LKUA 3ZYQA 4X3GA 2K1JA 3EB6A 2ECTA 2M3HA 3HCSA 3O34A 1WESA 2ECJA 2KWNA 5AIUA 3DQVR 1X4IA 1WEOA 3LRQA 5B8DA 5C13A 1Z2QA 4FJCA 3PURA 2KGGA 1WFKA 2L80A 1FP0A 4F52B 2G6QA 2D8SA 5H1VA 5C11A 4YBTA 5B77A 3O7AA 2K4DA 3U5MA 4C9ZA 3M63A 4I7DA 1JOCA 5DKAA 4CA1A 1Z6UA 3QZVA 4GNGA 2Y43A 2YSMA 2XB1A 4AP4A 1X4JA 4YATA 3V43A 2LV9A 1BORA 3O33A 3GV4A 2KWJA 2KFTA 2MIQA 4GNEA 2ECIA 2MA5A 4L7XA 1VD4A 5J3XA 2F42A 5AITA 2QIZA 2F6JA 3RPGC 3L11A 4B86C 3U5OA 5JG6A 2H0DB 2FSAA 1WIMA 2VNFA 2JRJA 3MHHA 1MM3A 2OXQC 2ECGA 1N87A 2K17A 4R2YA 3NG2A 3LQJA 2YHNA 1Z60A 2L43A 2VP7A 2IDAA 4N3WA 3ZVZB 5LKXA 2H0DA 2KYUA 1WEQA 4YADA 4WZ0A 2ECWA 4R7EA 1WEEA 5G0FA 5DINA 3PUQA 2L5UA 3T7LA 2YT5A 4P5OB 2F6NA 4ZUXU 2C2LA 4YAXA 4WA6A 4UP5A 2LXHC 2CKLA 1HYIA 3RPGB 4O64A 3I2DA 2KE1A 2YYRA 1CHCA 1VFYA 2HYED 5FB0A 2PUYA 2YREA 2KU3A 4NN2A 3ZNIA 4PPEA 2LGKA 2VJFB 1E4UA 2DX8A 5TDWA 2KIZA 4GB0A 4BBQA 1X4UA 4AVXA 2CSYA 4Q6FA 3L1XA 3KNVA 2VJEB 3PHDA 2YQLA 2VJEA 4AYCA 5FERA 4UI9B 3ZPVE 3ZTGA 2JMJA 4QF2A 4XI1A 5B79A 2FUUA 1T1HA 3LQIA 5KH3A 3N9LA 3LQHA 1RMDA 3O70A 3ASLA 1WILA 1XWHA 2CT2A 1LDKC 1WEMA 4A0CD 1U6GB 3M62A 2L0BA 4TKPB 2G45A 4IC3A 5FEYA 1DVPA 4LJNA 4ZQLA 2M6MA 2LGLA 4V3LC 3N9PA 1WE9A 3GL6A 2KWOA 1WEVA 2LQ6A 1F62A 3RTRB 3KQIA 3MHSA 4R8PK 2LDRA 1MM2A 4QF3A 2ZETC 4UP0A 4A4BA 2LN0A 2YHOA 3N9MA 2E6SA 3KV5A 5TBNA 5LKZA 5D1MB 2VPGA 5H1TA 4CCGX 1WENA 2YQMA 3SOXA 1WEPA 2ECNA 5B76A 3SOWA 5G05B 4FO9A 3L1ZB 1FBVA 2MT5A 2LGGA 3M99A 2VPEA 4LKAA 3SOUA 2I50A 3IHPA 4WZ3B 3EB5A 2RSDA 2LGVA 2YW8A 4GNFA 4L58A 3C5KA 2XEUA 3ZVYA 2MNYA 3U5NA 4YC9A 3HCUA 4FK5A 3HCTA 2EGPA 4A49A 4W4UA 5I3LA 2HDPA 4YBMA 3SHBA 5KH7A 2CSZA 2Y1MA 2G43A 2BAYA 1G25A 5FB1A 2L75A 3N9OA 4I7BA 2KGIA 4YABA 4MSXA 3U5PA 4AUQB 4IC2A 2KWKA 2KR4A 4N4FA 3HTKC 4AYCB 1WEWA 4S3OB 5H1UA 2NAAA 2MA6A 2Y1NA 2K16A 2LXPC 4V3KC 4BHWA 3N9NA 1V87A
chains in the Genus database with same CATH superfamily
4LT5A 4CUGA 1R093 2ECVA 2KKXA 2HWB3 1COV1 2PQSA 3U1XA 3LQCA 4NRPA 1GUIA 4LULA 3C6WA 1JM7A 1W8TA 4YAXA 2NLRA 2PLV3 4CTEA 1UOJA 3BALA 1AX2A 5JAXA 2CKLB 3T0AA 5D8AB 4Z0RA 3OUIA 2W39A 1WBLA 4Q4V2 1FYUA 1CJDA 3K51A 4L9BA 2HWB2 5FXXA 3S0MA 2BERA 4LO7A 4F8AA 4FBFA 1XC6A 4RGKA 4LADB 1I5PA 5IWFA 3ZKYA 2XOCA 2BNOA 4QGLA 1MS5A 4DZGA 1C8NA 4K9SA 5FYCA 4N9IA 1EY2A 4J1XA 2YURA 2GH8A 4Y26A 2KREA 1QJY2 4S2DA 5A33B 5LATA 1HX6A 3GZEA 1H9PA 1O3RA 4PDWC 3PUAA 4R4XA 2JKXA 2HWC3 3MDPA 1QJEA 2ZHMA 5AVPA 5CEHA 1LEDA 2MPFA 1Y4WA 5H9QA 1Z0HA 4LE4A 3WF3A 2VTXA 2ZX2A 3DKWA 3TB0A 4G3YC 3R4SA 4BQ5A 3PLQA 5DUUA 1RTVA 3VDDB 4WV8A 4HKOA 2RI7A 1CAVB 2E32A 2VQ0A 5K7PA 3B02A 4LO5B 4IEYA 3UGHA 1HB4A 2V73A 5SVXA 4DFSA 4IE7A 2A6YA 1DGLA 1DZRA 2QZ2A 5FY0A 4OQ9A 4B1LA 2Z2SB 1QJU2 1UZVA 2GC3A 2Q1MA 2OUJA 3FUOA 3KCCA 3KV4A 3QLQA 2B7YA 2D93A 2A75A 4GWNA 4O65A 1T6GC 4YVSC 3T0BA 3UYJA 5C3PA 3O1OA 3BTXA 2A73B 2FZ2A 3LDYA 1K45A 4E9KA 1LGCA 5HPOA 3OF1A 2WFF1 4LLBA 5LRRA 2H0DB 1LTEA 1ENQA 1WGPA 2ZA9A 5CKMA 2BPA2 2AR6A 2E6RA 2HWE3 3AYCA 3SCGA 3AKQA 2YHJA 1HV1A 3J8F1 4NN0A 5D1IA 5FP7A 2RR4A 4AF9A 3RSJA 3AJZA 4FAHA 3S7EA 5M0TA 2F4PA 4ONUA 5FY4A 4AYUA 5B75A 2B45X 2RJ2A 1RUD2 4RSUA 2CV6A 3THTA 5B78A 1V9U3 4YVSA 2VCCA 1O4ZA 2Y6LA 3IIAA 1JTZX 1W8HA 2WN2A 1GSLA 1HB2A 4TWTA 1WZXA 4AW7A 3WF1A 1IPKA 4KWKA 2LRIC 2NN8A 4LBKA 1VYXA 2JMDA 4WZ2A 4JC1A 3O0XA 3H1YA 2QJ0A 1AR62 2B9UA 2JKBA 1QKQA 2EXHA 4YGBA 2CL2A 2FUIA 2KA3A 1FOD3 4MLOA 2ZPXA 2VUCA 4IGPA 1BXHA 5T5OA 1HN1A 5EHDA 4D7TA 1BEV1 3T08A 2RS32 4EV0A 2DYCA 2A6WA 3BTAA 5IAXA 1PO21 4QAWA 1NLRA 3BOWA 4QX2A 4XACA 4EZHA 3AKRA 5IHRA 3CNAA 4X3GA 3MIDA 3P5BA 2YC0A 4I3GA 2JENA 4ISQA 2VZOA 2O1QA 1RVF2 1SZBA 1W9SA 3N7LA 4LK7A 1LAJA 3EB6A 4V1PA 1I5ZA 3FL7A 4Y4RA 3J4UH 3W21A 1YEWA 3HCSA 5AIUA 4LBJA 5CFCA 5DN2A 1JYTA 1X4IA 1WEOA 2WNUC 4Q4Y2 3LRQA 4BISA 2JWPA 5EP9A 2GDFA 2D43A 4LO6B 1DQ6A 2G9GA 5HV0A 3AMMA 4Q4X2 3GGLA 2Q30A 5JOWA 1PO12 1WUVA 3B5LB 1ST8A 2YUEA 2VY0A 4GULA 4NHYA 5F8PA 4C90A 3NL1A 4LJHA 2L80A 1S0CA 5FY9A 4YG0A 1FP0A 4F52B 3OSDA 3CF6E 1TME3 1O4TA 2KD7A 5DDJ2 1RUH2 4CDXA 5B77A 2ZKNA 2LALA 2IXLA 1BLZA 3TBDA 1AR92 1MVEA 4L97A 5KC6A 4C9ZA 1OLQA 2BV4A 3VDDC 5J1XA 5KWRA 4FTEA 1U5XA 5A7WB 1R1A1 1ALYA 2WZR1 3HBKA 3VGIA 2MEV3 5LY1A 1ND3A 1X4JA 1JU3A 2ZTNA 1QOTA 1X9TA 2LV9A 5JXIA 1GQHA 1BORA 2RVAA 4MHRA 4CDUA 3WNLA 1IS6A 2MNGA 3THPA 4XF1A 4AHXA 5IVFA 3PIGA 3KS7A 4S2HA 3WEZA 1OQEA 2YZ4A 3VZLA 2ZEZA 3ZSLA 3NAPA 4ASLA 4L7XA 4LBQB 3WX5A 2QDRA 1GV9A 2XLGA 4Q0UA 5LB6A 4AVAA 3K3NA 1IS3A 5IK5A 1Q56A 1UO9A 5F6KA 1RJ8A 3BTZA 5AITA 1NCRC 3J7HA 2CYFA 1ND3B 1VMJA 1B35C 1C8M2 3ALQA 5FWEA 2PTMA 4ZHNA 4O9EA 3SITA 3MLKA 3PTYA 1UYYA 1SCRA 4FP2A 3WDTA 3UKVA 5KXDA 5JG6A 3HEIA 4GIQA 1V70A 4AVSA 3U10A 1FT9A 2VXRA 1N3OA 4QX7A 4B4PA 3Q8BA 4QX3A 5A3TA 2VNFA 4N9HA 3WQ7A 5J7MA 2H6CA 3A0KA 1YQ6A 1SEFA 4XIOA 1YQ5A 1QF3A 2WT1A 4JRLA 2O0OA 1UW8A 2IC1A 2Y60A 1N87A 2JICA 5LEJA 4J1WA 4DOUA 4CUCA 1XYOA 1AXYA 1H2MA 2LTNA 4XJAA 1RUF1 5JDBA 4R2YA 3E1F1 3MV01 2ZABA 4UF0B 4G4FA 1IG3A 1UX7A 4XDPA 3VZOA 1Z60A 2L43A 2KXLA 1U5IA 2QFEA 2WC2A 4UF0A 2IFWA 4YW2A 2UYBA 5KHJA 1K5JA 1SACA 2P4EA 3MZHA 2BYVE 4QXCA 1JI6A 4XUQA 3NJYA 4YYOA 3WLUA 4W8JA 3BU0A 1SHWB 2XJVA 2WDBA 1R083 2FBEA 4XFIA 4EE2A 3VZKA 3I49A 2GSYA 1UPSA 3VBSB 1R091 4Q4W2 4Q2FA 5A7PA 1GZWA 1WEQA 1W6PB 2IZWA 3OPZA 1N1VA 3RJ2X 2ECWA 2BGPA 1WEEA 2HWD3 1ZNPA 3T2OA 4BQXA 1G9AA 3W20A 4JHTA 2SBAA 3T7LA 3JQXA 2YMZA 4OHWA 2WA4A 3OJBA 5DAVA 2RM23 2ADDA 1MS3A 2VMEA 3AP6A 3C7OA 3I59A 3K77A 3WG1A 2P2KA 1OFNA 1CX4A 1Y9GA 3ZN5A 4ZUXU 1X9PA 1XNAA 2JG9A 2ZGMA 1GYKA 4XCBA 1EUTA 4TLGA 5GZDA 2WQ4A 4LKSA 3VD9A 1FNZA 3MF9A 4M3CE 2DURA 1GNZA 2KE1A 2YYRA 3VHNA 1US2A 3QOPA 3PL0A 5FB0A 5L9VA 2ZGTA 1I6XA 2WA3A 4BLIA 4QM9A 2YREA 2KKYA 2VQAA 3IM0A 5A7NA 4ISRA 1RUE1 1W04A 4OHXA 3ZXKA 5L9BA 4ASKA 1PGL1 4Y1UA 5A7QA 2DX8A 1FMD1 1AF9A 2BZDA 3ILFA 1UMIA 1AHSA 4UFIA 5HXMA 2XJUA 2K2SA 2XBO1 3WP5A 3UT0A 3TRSB 4FSJA 1RUC2 4JX0A 4BBQA 4Y22A 2EIGA 5F9TA 3AL6A 4FQZA 3LA7A 2DU0A 2Q8OA 5A3MA 1KDMA 3PHMA 5D2AA 2CSYA 4FOQA 4IV3A 3MI8A 1W0OA 5B2GB 5IVBA 3OGRA 4Q6FA 1ZZ8A 2LROA 1F9KA 2UURA 2Y6KA 3KGZA 4JAAA 4SLIA 1GQGA 2W46A 1WLWA 3I3DA 1AL23 1Q8QA 5A6QA 1NG0A 1RMU1 1EYBA 4EZ4A 1S0GA 2EALA 3PHDA 2B5HA 2FHRA 4IQPA 2JDKA 4QQLA 5SVIA 3OBAA 5A6XA 5FERA 3T2TA 2VNGA 3IB3A 2BDRA 1OPMA 1JZ7A 3LVQE 3VDBA 1KGYA 2XJSA 2BEOA 1FX5A 2QCSB 3SCHA 4CEWC 1G7YA 2XVKA 4YVSB 2E7AA 2GN3A 3PU8A 4FPFA 5GLZA 2X10A 1OVSA 4FPYA 3OCPA 1G9CA 4QF2A 1PMHX 2VNVA 3K46A 3H1WA 2ZACA 2XUMA 2FUUA 4DRVA 3CJIB 3ZFFA 3OY8B 2FCTA 5ACA3 4GKYA 4HOOA 4QGNA 2B42B 1T1HA 4P14A 4IEOA 5FYUA 1LCLA 1LENA 1BK0A 1HQLA 2VZ1A 3LOIA 3ENRA 5SV8A 3WDXA 4NMIA 1WLTA 1NCQC 2ORZA 1W9YA 1YFYA 2PQQA 2XLAA 4QPGB 2J1TA 3ZR6A 1D4VB 5C9AC 2AEZA 3TEXA 3RZMA 4QQ2A 2WNVB 4KGQA 5F7UA 1ZM1A 3I2IA 1T6BX 2AZ5A 4OZXA 3LPGA 1XWHA 2AGSA 1JYXA 2W68A 3JUUA 3B7MA 5DZGA 1CWPA 1RYYA 1QQP3 1DCQA 4A7YA 3LGRA 3T4HB 1TEIA 2OVUA 2V4VA 1ZRIA 2YC4A 3CJIA 3JB4C 4ZS3A 3RFRA 4IC3A 1NLSA 3LSDA 4NIAA 5FEYA 2J1SA 1EAH1 3O0WA 4QPGC 1YQ2A 3O47A 4N53B 1PK6B 3NQHA 1H2KA 5BYNA 4URTA 2DUPA 3QCWA 1QQP2 1QOSA 2IVIB 5I93A 3FLRA 3E2DA 1C8M1 2W47A 1UYPA 3NAPC 5FYHA 4M3CF 4COUA 1LULA 1UY1A 4XHXA 1HB1A 4V3LC 3VHOA 3VKOA 1SLTA 5FUIA 1ZRFA 2VMCA 1UU4A 2E9QA 1UOGA 1EV12 3HPNA 4Y5TA 1FATA 2E51A 4ASMB 4GD4A 4NPRA 4XQWA 2JG8C 2J7MA 4ZZ5A 5LW9A 4WBBA 1UY2A 4IE4A 1MR5A 5KC5A 5FZ8A 1VALA 1F35A 1W2OA 1BKZA 2Y6HA 3NKGA 3ROUA 5IK8A 5F37A 5C3OA 4UFLA 2D3PA 3VD5A 1Y7BA 4A41A 1H8TC 3LPFA 3PJQA 4FPCA 4QF3A 1MQTA 2W1UA 4XF0A 5FKBA 2HWC1 1NCQB 5BNOB 4UP0A 3MDBC 4IGOA 1XB9A 5FP4A 1XE7A 1RUG1 4QQPA 4QHOA 4AOCA 1H8VA 3B00A 1AR83 2LN0A 4M00A 1UL9A 1YJKA 4PQQA 2Q5TA 4I02A 4X6QB 3KV5A 2YHOA 3AB0A 4ES8A 5AFEA 2VPGA 2C0ZA 5LA2A 5A1AA 1OI6A 3DEMA 2ZOEB 2YQMA 2ECNA 3SQOA 4CE8A 5B76A 1VBC1 4K1YA 5FK8A 3ZFEC 1VBA1 4LHNA 4CCEA 1DYOA 1ZBE2 4OI4A 4Z8BA 3LEGA 2RS51 4Q4W3 3WF0A 4PJYA 4E4ZA 1W6OA 2E7TA 4XEZA 1W8OA 2E6VA 2JE7A 2VU9A 5EXOA 1J59A 1W9FA 2VECA 5GALA 4AFAA 2A5ZA 2DCZA 3SOUA 4E2SA 3BTYA 5BXXA 4XYXA 4WZ3B 2HWB1 4BDVB 2R16A 1H4GA 4EWEA 2RS31 2ENRA 1SQ4A 3K4AA 1JW6A 1ND2B 1R092 2JXAA 3AXEA 1UAIA 4Q4W1 4E2GA 2HWF2 4FOVA 3C5KA 2E61A 3AP5A 2ARCA 3I2FA 3LA2A 2ZX0A 1RUI1 4JQRA 4META 1JODA 4DUVA 1W6NA 3HCUA 5GKAC 4IERA 4FK5A 1K12A 1AJKA 1AR61 1RIRA 2ZMNA 3IKWA 4OMDA 1PMJX 4BCUA 1LOFA 2QE3A 4C1XA 1AR81 3T9KA 5FZAA 2K9ZA 2HDPA 3GZUC 2VGDA 2N7GA 2FDHA 2DTYA 4YBMA 4FPJA 3VBRA 4QQ4A 3IT8A 2CSZA 1TMF2 3VD3A 2Y1MA 1YWKA 2C26A 3GYDA 5SVIB 1VR3A 2PYTA 2V4AA 4AVCA 2BAYA 2YBSA 1X50A 4Q5OA 2OA2A 1JZ6A 4D94A 4AI8A 3CO2A 2YB7A 3WF4A 5L7OA 2XVGA 5FB1A 4PIZA 3INAA 1DP0A 2FDKA 2IXJA 3N9OA 1DU3D 3DKQA 4LHKA 1S0FA 2D6OX 3NWKA 1OQ1A 3T3YA 1PGL2 4H14A 1HRV3 1RMU3 2VNOA 3UJQA 2CRRA 1DYPA 5FZ3A 5G05L 1AL21 1RUJ2 1X7NA 3VD4A 4AUQB 1J83A 2KR4A 4YVWB 4AHWA 4N4FA 3AP9A 1CX1A 1C28A 4DY5A 3SXWA 4DO0A 4LIVA 1ZRCA 2VZUA 3H8XA 2WFF2 3HTKC 2XWJB 4AYCB 3M7KA 2AC1A 4IESA 5C9AB 5JWPA 1GP4A 4D69A 2MA6A 4Z82A 3ZMNA 4MHUA 3VL9A 3MPBA 2LXPC 2C6SA 4BHWA 5T5JA 4NIGA 3N9NA 4PLNA 1IS4A 4TN7A 4NPLA 3WP6A 2QJVA 3WW4A 4IEUA 5ACA1 5LA9A 4NIIA 1V87A 3FX3A 4A4CA 1VBE2 4QX1A 5TRBA 4OULA 2PHWA 2QQJA 2OW4A 5F5IA 4GNDA 4UP5A 2XR4A 3Q8EA 5A32B 4XDOA 1GP6A 3MHZA 2XQRA 1NXD1 5FXWA 4CU7A 2WKKA 2RDQA 3O14A 1JUHA 2ZGNA 4K3UA 2VPDA 4MGIE 4AFDA 4IV1A 4ARYA 2PNXA 3I2JA 1JYVA 4NPMA 2BW8A 1LESA 1LOEA 2X09A 2HEWF 4Y4YA 3G6JB 5DXDA 1UKGA 4YARA 3O1SA 2F6BA 3PVEA 3VN4A 5FKCA 3RZZA 4NHMA 1LNSA 5DUVA 3SMHA 1FXZA 1FPN1 4AXOA 1O4YA 5FZMA 4DMIA 1A78A 4LUKA 5IJRA 3RZJA 2UZGA 5LCWB 3ZPV1 5FZIA 2VPBA 5HCFA 3VB9A 5FYMA 4K8RB 2V5YA 2WIIB 1DFQA 3MF6A 4L11A 1OD3A 1MEC2 4I01A 2EIEA 3ZYIB 4OZOA 2TNFA 4BH9A 1QU0A 4MOAA 4YW1A 4M4RA 1FOD1 2EXJA 3U4XA 5TDRA 4S2FA 4AQ2A 2PHXA 5SV5A 1MS1A 2A6VA 2CDPA 2WLQA 2WNVC 5FPLA 5A3OA 5DAPA 5IK7A 1M06G 4ZDTA 3GJBA 4IEQA 2VBDA 3V0BB 4JDNA 2HWE2 1W6MA 1WCUA 4EN9B 3LOBA 3IMNA 2Q4SA 4Q4Y1 1ULGA 2RMU1 1N1SA 2WS91 4GMP0 3DPRA 2C2VS 4LK9A 3DV8A 4KBZA 3VD7A 1WGMA 2MD8C 1QH7A 3GM8A 2AN6A 4L2NA 3PVOA 1YNAA 5DZEA 1DYKA 1O59A 1V6LA 1XU2A 3W58A 4W6WA 5KXBA 1CAUB 1QJY3 3IPVB 4N53C 4A6SA 3UKNA 3FUQA 3T09A 1W3VA 4AQSA 2W9XA 2RS12 1MZEA 5FPBA 1JZ5A 2GP5A 1GP5A 4AEDC 5D21A 2VD7A 4AYCA 2EODA 4DY3A 3BIEA 2PA7A 3LF7A 1LHNA 2WLPA 3T4VA 3ZFFB 3VUOA 3OEBA 3MO4A 3PU3A 4ZU4A 3WW1A 4D7SA 5LBEA 2VW1A 1GMMA 1R1A2 3MLJA 4BE3A 4D3WA 1RINA 4CCCA 2BVVA 4G9SB 1GANA 1FMD2 1TME2 5DDJ3 5FP8A 5T5PA 2R1DA 4TZDA 5D1LB 4Q8KA 4E4SA 4YG6A 1CAUA 3IPVA 4XE9A 3WY6A 3ZN6B 4X6RB 1O8SA 3O35A 4OVEA 4RHV3 2G9FA 2BGOA 1XYNA 2WT2A 2C24A 4RR3C 4WM8A 2VJFA 2XMLA 4V2VA 5FMOS 2JMIA 2CWSA 2NYYA 2VL4A 5AC91 3OPWA 4L92A 1ZZ6A 2WN3A 5DMYA 1N1YA 4Y1ZA 4DPNA 1UXZA 2M85A 4OI0A 4YW4A 3RYRA 1ENRA 5IVYA 5CU1A 1IQDC 4KU8A 3VBHA 4HPKA 3TEZA 1VB2A 2FFWA 5FUNA 5F1RA 2HEYF 1VB4A 1YFUA 3N7MA 4Q8LA 3IDCB 3SH5A 1RUD3 1UZ0A 2ZS6B 3ZN6A 5LKUA 3LDKA 1OXCA 2PLV1 3FEHA 2IUWA 1QNYA 4OHZA 4COVA 1I1EA 3V0BA 4GMP1 1GOGA 1HQWA 4R9AA 1UYXA 1JHNA 2YFUA 1F2NA 1KJRA 1X8EA 4PBPA 3CZJA 1SMVA 4J25A 3VHPA 5ISLA 2CDOA 2RDSA 3NNLA 3WNPA 1DBNA 3H9AA 3S57A 1Z78A 1NE4A 2GP3A 4HONA 3VBHC 4B8EA 1WMFA 2R7EB 4KQ7A 1MZ5A 1S4CA 3D82A 4H2AA 4R9BA 4I3PA 5I8TA 4A44A 3O34A 3WZ1A 3H3ZA 4LMFA 1YHFA 3DQVR 1US3A 2XH6A 5KHHA 1Z2QA 4EWAA 1CESA 1KITA 1ZZ7A 1UU6A 2A3WA 3K3OA 1V6OA 2JDMA 4HANA 4FJCA 3CZUA 1VBC2 2BFUL 4UI9L 4Y33A 4XBLA 5FZFA 4YZ1A 4KWUA 3M3CA 3D0JA 4XHBA 1APNA 2PAKA 4E8DA 4OFGA 3VBRB 1LHUA 4JGYA 1LHVA 2G6QA 5H1VA 2RS11 1L3JA 5C11A 5DABA 3O7AA 4JGYB 3RRDA 4A45A 3U5MA 1FPN2 3ON7A 4M3CA 4I7DA 4CA1A 1Z6UA 1SG3A 4P9IA 4UFJA 2AEYA 3QZVA 4GNGA 2Y43A 2X5IA 1COV2 1YO8A 4UBGA 1YUDA 3KHBA 4AHYA 2XB1A 5H9RA 2ZX1A 3HN3A 4ARXA 4HZFA 4X8NA 3FAOA 4ITCA 5I0TA 3AVSA 5JMCA 4XCAA 2Z69A 4BOWA 4D6QA 3ECQA 2EIBA 4NAMA 2KFTA 2MIQA 2YROA 4GNEA 4Q0VA 2Z79A 2OYZA 3H50A 4NO4A 3KHCA 1DQ2A 1PM4A 1E5RA 5F5QA 5ANQA 1IS5A 1VD4A 4QU1A 3NJZA 2VOWA 1J3QA 3IAQA 5GLVA 2HBUA 3ZFFC 1CAWB 3DN7A 1RUH3 5C5UA 3A0NA 1Q8OA 1V6MA 1XBFA 4IV1C 4L0PA 1YJLA 2JDPA 2VBPA 3OTFA 5FIXA 2QIZA 1YXWA 2R073 1E5SA 2DCTA 3EB5A 4Q1PA 2ZGQA 2VZSA 4JVAA 4DEVA 3ZDSA 3ACFA 1UZYA 2O8OA 2VJXA 1I3HA 4HVRA 4BQ1A 2VULA 2VCBA 3HNMA 3JQWA 3W59A 1W3XA 2XVLA 2VE1A 2P6CA 5DPNA 2ADEA 2XP0A 2OXQC 3C2UA 1JU4A 1JS9A 3ETQA 2Q0AA 4LORA 4CSWA 5C3RA 2D5HA 1XNCA 5DZFA 4IDZA 4LO4B 1D4M3 1PGW2 3ZYHA 4MGTA 4RS5A 1HXS2 2MEV1 2OWAA 3IDAA 4UW4A 1RUG3 4C0HA 1YYNA 4KNCA 3LQJA 4GZ9A 1ND3C 3N7KA 5JR7B 2LRPA 4ZY9A 4CDUB 2VP7A 1RUI2 4YVWC 2IDAA 4N3WA 2M13A 1V6IA 3PUIA 3TEYA 5FMCA 3O1VA 1OH3A 4F1PA 2YPJA 2WO1A 2H0DA 4O61A 1VRH3 5CG9A 3P3NA 4Q4X1 1UZWA 3AK0A 4MADA 3T30A 1B35A 4XUTA 4Y22B 3S6PA 2HWF1 1NY71 2DBNA 4WZ0A 1ONAA 1QXPA 1D2QA 5J36A 4CPBD 2EAAA 2GMEA 1XNKA 3JUEA 5G0FA 1ENXA 3HT2A 2Y6GA 2L5UA 2A1XA 4P5OB 4LITA 2ZGKA 3NRUA 3VZJA 4JKLA 3ZVXA 5CAZA 3AZWA 1CPNA 2PAEA 1N1TA 1SDWA 3FBMA 3J7MA 4XUOA 1G9BA 2DBIA 2J1AA 3AYEA 2C2LA 1F4AA 1BJQA 4YBTA 5FO7B 5T55A 1F15A 1V9U1 5J3UA 1JYCA 2LXHC 1FMD3 1GZCA 1B35B 1PHMA 3I2DA 1QNWA 4QB2A 4IV1B 4W65A 1CHCA 1WLCA 3RZGA 2HYED 5CYYA 1XJAA 4BK4A 3WG2A 1LOBA 3THDA 2KR2A 4C8DA 2P3IA 4ATEA 1GOHA 3NNMA 4JGZA 5K4LA 2X05A 1VBB3 2IXKA 3J8F2 3LCPA 1ZBE1 3LEMA 1JOBA 2VW0A 3ZYJB 5BV6A 4NAOA 1NA1B 1AYN2 1PVC2 1QXJA 3D4KA 5L9RA 4R52A 1WA6X 2RJKA 4AEDA 4DEQA 4IW3A 3PTRB 2W1QA 4DIQA 3M3QA 2HYXA 1G9DA 4GB0A 5K3QA 1R64A 2WWUA 3DWDA 3RJRA 1PMIA 2CRWA 2ARBA 3CHXA 3C3VA 1VJ2A 5ABJC 3B94A 4MGKE 3T0DA 4Y1YA 1X4UA 4AVXA 4FFIA 2BOJA 5BUVA 3KVAA 4C91A 4EN7B 3AKSA 2BBVA 1NT0A 5GLTA 1RUI3 4NVPA 2E53A 3L1XA 2ARAA 2LW8A 5JI9A 2AENA 3NW4A 2VVEA 1S0JA 2E7QA 3OBZA 4EN8B 4QB1A 3WCRA 4XF3A 2XJRA 1IZ3A 2HWE1 2HLEA 3AYAA 1J1TA 5EWSA 1TVGA 2L9LA 3TOJA 2A6ZA 2ETEA 1BCXA 3LB9A 3LDBA 4QKBA 3ZYFA 5JPMB 2NQYA 3VBFA 4WVZA 4Z2AA 1KS4A 2EXKA 2GC1A 4OLLA 4ZPIA 1LOGA 5JIUA 1OBNA 3MV11 3M3IA 1VBE1 2IVJA 2WO2A 2VCAA 5G04L 3RMYA 3WF2A 4HMZA 4K21A 4XAAA 2JB8A 2VW2A 1O3SA 5FOBB 4OGCA 4IL7A 4LBNA 1X8MA 1VAKA 4GQ7A 2ZX3A 1VIWB 4XJZA 2A6XA 1MZFA 3D3AA 4AAXA 5KH3A 3TN93 4RFRB 1XE0A 2Q8CA 3K4ZA 1ASJ1 1RMDA 3WOGA 3LQHA 3O70A 1QHDA 1VMFA 5A3PA 1XXNA 1FI2A 2DCKA 2OXBA 1GFF2 2ZX4A 4P02B 2QUOA 2L7PA 4M4PA 4OUEA 5AC92 3OGJA 2CT2A 4XBNA 4I30A 5GLWA 4XURA 2XOZA 1EPWA 1WEMA 1MVQA 2X5IC 5JOXA 4A0CD 3EMRA 4YGDA 5DQ0A 2ZGRA 4Z2WA 1YQ8A 2FCVA 4LPLA 1DF0A 4RQPC 1DVPA 4BB3A 2Y0OA 1NKGA 4NE9A 2CNAA 2XHKA 4IEXA 1XQNA 1XSRA 4RL7A 1JOJA 2DU1A 2ZGSA 1QY4A 4QGMA 4AWDA 1ZRDA 1WW7A 5JSOA 2I07B 2R072 4GWJA 2ZGPA 2LGLA 1KQRA 2JDUA 3B01A 3E5XA 4Y24A 4RGAA 1AL0G 3WUCA 2X29A 4DNYA 3U37A 2XOYA 3MYXA 3WW2A 5FYVA 4Q0SA 5FO9B 4JV4A 3R4UA 4MX3A 4BLJA 5T3NA 4AAPA 4BJ0A 4COYA 4LKEA 3A21A 3HR9A 4MGSA 4YG3A 3UL2A 1OA2A 3ZXDA 4Y20A 4EN6B 5HCHA 2WZEA 4DXZA 1OC1A 4BIOA 5HCAA 1F62A 1HN0A 3JXSA 3VLBB 1UXXX 5CG8A 1BEV2 3RTRB 4OI1A 2PHTA 2WO3A 2JDZA 2QTWB 4H7LA 3BYWA 4CDXC 2VVFA 5FMDA 5BNNC 3O12A 3M4FA 2E26A 3ME2A 2YGLA 3N7JA 2RMU2 2WS92 2LDRA 3I2OA 1OLRA 3WG3A 1TME1 1V0AA 4TXWA 2P5BA 3JBG3 4BK5A 1VPHA 4ZZ8A 2W87A 1CVNA 1RUH1 4RR3B 3SCFA 2E6SA 3S30A 5LKZA 5D1MB 3ABZA 4N43C 5E6HA 4BQ2A 2JRJA 4C0BA 3GXUA 4TYSA 4YM0A 5CFDB 3ILRA 3I2HA 3T1MA 2V5DA 3CU7A 4KWJA 1OD5A 2RMU3 1OA4A 2WS93 1CZTA 4QKNA 1C8M3 1UZZA 1FBVA 3NJVA 5FREA 2A7AA 5A1LA 1O3TA 4YFZA 3M99A 1SBEA 1XPWA 2IXHA 1R082 1A8MA 1VBD2 2W95A 2W92A 4HETA 4A7ZA 1O7FA 3FZ3A 3I2GA 2QQPA 3L2HA 3NNJA 1DQ5A 2X5IB 3VL8A 3VKMA 2WT0A 4LHSA 4YRDA 3IHPA 1YIPA 4CDWA 5GZCA 2FD4A 2G19A 3FWEA 1POV1 2NMOA 2R30A 4CEYC 3EHKA 4XIKA 2LGVA 1OUXA 1PO22 2JG8A 4GNFA 3OUHA 2F17A 3BB6A 4IEZA 3ZXAC 3ZYRA 4P5YA 4Q4V3 3WW3A 4BHPA 1UKRA 3KT1A 3S5QA 1MS9A 2GNMA 5F6LB 3WVJA 3HCTA 2DFCA 2QQIA 1OOPC 3HOBA 3USUB 5BNOA 1XOYA 4BM8A 2FDGA 3DXTA 1C1LA 5I3LA 5DAWA 1W9TA 4UYBA 3WD5A 1SDDB 3ZXJA 3LKJA 1DQ1A 3B9CA 5KH7A 1XE8A 1HRV1 5HCBA 2XL9A 3MEPA 1GZTA 1J58A 1HB3A 4RHV1 4XVHA 5K0UA 2HH9A 5C6CA 4MUVA 3O1MA 2G43A 2JDHA 1ZX5A 2W08A 2BU9A 3BGAA 2D5FA 4LBQA 2YVRA 2Y26A 4Z07A 1QWRA 3WP3A 3VKLA 3TEWA 3HNYM 4BQWA 1SCSA 3QACA 5I91A 2CGNA 1LJ7A 1S2EA 3BPZA 4M0NA 2V09A 2G4IA 4XJUA 3T2PA 4AI0A 3GNEA 4E4DX 3GZAA 4MSXA 1JXNA 1DZQA 1S2BA 3CMGA 4BPZA 1BMV1 4FTBA 3HIFA 2W91A 4IC2A 2VOTA 2PHRA 4YLZA 4DINB 4O62A 2AH2A 1KFUL 3ZPOA 3FJSA 4JDOA 3KM5A 3Q1DA 2Z42A 1LU2A 2ZAAA 1NX9A 2D6MA 2WRAA 1GLHA 3I3BA 1QJY1 1EAH2 2DVBA 2NZ9A 4JCKA 4CCOA 1HDKA 2VNRA 4QPIC 3RMXA 4A42A 4CP1A 2BQPA 2Y1NA 1OA3A 1QH6A 1UCXA 4WM7B 5GM0A 3WQBA 4XETA 5T5LA 1CGPA 1RXFA 2K16A 4HL0A 3UK9A 5FR3A 4V3KC 2NM1A 1HV0A 1WWYA 5A6YA 4MGZE 1O3QA 2RDNA 2ZXQA 2ZBJA 4I09A 1R081 3Q8AA 4ZXEA 4PT6A 5JSRA 3ZIWA 2JG9B 2YUCA 3MLLA 4URAA 5I0SA 1H1AA 2D8UA 1OH4A 1A8DA 4ORFA 1JZ8A 2JD9A 2XLFA 1W39A 2EA7A 3AJYA 4FCAA 4Z92B 1NQJA 1W6NB 2MUMA 3U07A 4QDRA 3NV1A 4GJZA 3EXUA 5BY5A 1AL22 4WVMB 2M1RA 1IKPA 3PJYA 3VBUC 5IVVA 4D7YA 2ZEXA 1UOBA 3KQ4B 5CFCC 3QH6A 3U75A 2FQPA 2QBXA 4MYEA 3MPPG 5FZCA 1DIWA 3N9QA 2OT7A 4I2OA 5FLJA 3B93A 1RUE2 3SHRA 2ERFA 3NV4A 4CP9B 5FZOB 1PGSA 4DRRA 2MD7B 4ZKTB 4CCKA 3KQRA 3BIWE 1HYJA 2VTFA 1VRBA 1URXA 1RXGA 1YFXA 4EYUA 1HRV2 5AFBA 2R042 1AR71 1QJU3 2IWGB 3ACLA 3WHUA 1F5JA 1BEV3 3VDDA 3M3EA 2A70A 1NY72 3HNBM 4DXRA 4PTBA 1N3PA 1P8JA 3D6EA 3GBFA 2UWCA 3RPQA 4WM8B 3RS6A 3FHIB 2DVFA 3O7OA 4B7EA 3VK6A 4GJYA 4JGYC 5F5CA 1PNFA 2DWRA 4QU2A 1AUYA 4CUAA 1W8NA 5FUPA 1K2FA 3AXDA 4P9GA 3O36A 2ZHNA 1UMHA 5EZWA 1BVVA 3ETPA 1POQA 4W4ZA 4Q4Y3 1C1FA 1CN1A 1CD3G 2VTXJ 5ANNA 5DDJ1 3E6CC 1VBB1 3KV6A 5FBJA 3OY8A 2BFUS 3CLPA 2WNEA 1WW4A 4AEMA 5I0RA 2EA6A 2J1RA 2FZ1A 4CP2A 1V6KA 2VBBA 3CJIC 3FC0A 5FLHA 4MVTA 4OGEA 4U36A 1YC61 4Y1XA 4PBOA 4JHZA 4YW7A 3M2MA 3ACGA 5DUWA 5IAVA 4ATFA 4UOJA 5C8CC 5CKNA 1HJGA 2UWBA 3MW2A 4LBLA 2D3RA 1XNTA 1GOFA 2D6KA 3KMHA 3MIGA 3R4DB 5FFOC 1LKNA 4OCTA 3ZYBA 1HQNA 4JKMA 3HN1A 1KEXA 5EYAF 4JKKA 4HK8A 3IDEA 1IGOA 4CA9A 5JXGA 2CU5A 4AGGA 1FV2A 4GH4B 4P9YA 1HXS3 1DQ0A 1RL3A 5A80A 3HQUA 4I7CA 1H30A 4N53A 4QMAA 5FPAA 3NMBA 5H9PA 1YQCA 5IYYA 5FZ4A 1IYMA 1VAVA 2QDNA 2BJSA 3J7LA 3WDWA 1IHMA 3LVRE 3TAYA 1POV0 2WAOA 1UY4A 1EV13 2EAKA 3EO6A 5A3UA 1D2SA 1OOPB 4A3XA 4XJWA 1ZYBA 2FDFA 3FHQA 2RR12 3POBA 4IEVA 4AE2A 1PM7A 2H6BA 4CYDA 3RDIA 3H8OA 5FZKA 2GNTA 1WCSA 3ES4A 5CA6A 3U0ZA 3LJUX 2JIGA 2YU1A 2BBAA 1CIYA 2W0XA 1VAMA 4RHV2 3SC7X 1SFNA 3ZXLA 1FOD2 3AYDA 3J9SA 4RYDA 1CQ9A 3WDUA 1OLMA 5IUQA 3BUCA 4QXHA 5BNNB 1UIKA 2BUKA 3DUIA 3JD73 4GB33 1W05A 1HW5A 1GBGA 1PIV3 4XW3A 4CP0A 2DTWA 2EGMA 2K1JA 1RUG2 2M3HA 3PNAA 2JD4A 4QPYA 4LK6A 4D6SA 1W9WA 2HBTA 5B8DA 1BMV2 5C13A 2RJLA 4LHLA 1R1ZA 1BZWA 3H3UA 2WBKA 3C8XA 3ZXFA 5FYZA 3JCIA 2NMNA 4YM1A 4B3NA 2KGGA 4YM3A 1W6QB 1WFKA 2XXZA 3AX4A 3S7IA 4NWWA 2RR11 4JTNA 5CVRA 3MIFA 3J7NA 2YXSA 4OYUA 1PK6A 1VBB2 1Z7S2 3J8F3 3A7QA 3POIA 4FFGA 4YWAA 3SKJE 1EV11 1AYM2 4CU8A 3H7HA 3MBWA 2VM9A 2GN7A 4PI0A 1CR7A 2OQ6A 2OUHA 4QKFA 5DG1A 4BXSV 1JOCA 4OUMA 4PQ9A 3VBSC 1BBT1 3V64A 4YZ2A 3K4DA 5DKAA 3LIHA 3M1HA 2OZJA 2YSMA 1KS5A 3HQRA 5A7WA 4AP4A 3IWZA 2OKXA 4UW6A 1PO13 5BNPA 4YATA 1TE1B 1AYM3 1ZZ9A 3O0VA 2PAMA 4H55A 2R043 3CL1A 3KCYA 3O33A 2ORXA 2CAUA 2KWJA 3HD8B 2K0GA 2WYFA 4KU7A 5FY7A 1HRI2 4CDQB 5LA0A 1RGSA 4HT1T 4OI2A 2XHNA 1J84A 3OGSA 1VBE3 5IVEA 3DECA 2C5DA 2VMFA 3PMEA 4B4QA 1D0GA 4MXVA 2C4XA 2F42A 2H0BA 5ACA2 1RITA 2P6HA 4LKDA 5FZ1A 3F2ZA 2D40A 5BNPB 2RS33 3AP7A 3RPGC 2Z4FA 3BU7A 4INDA 2DF7A 4FI9A 5FY5A 4FQ4A 3TYJA 5C8CB 3HBZA 4JQTA 3OYWB 4Q0PA 2WINB 3TNPB 1VMHA 5FZDA 4ZU7A 4MXWB 3OYWA 5A1FA 1NA1A 3C7EA 2Y0IA 3IMMA 2VPVA 2Y38A 5F3EA 3GF6A 3OD0A 3MIEA 4XQDA 3A23A 5FAXA 1W03A 1WIMA 3ZSJA 4IETA 5FPXA 2RM21 3NAPB 1SLAA 3GDBA 4UXAA 5LEKA 3N36A 2D6NA 2ECGA 3F95A 3VHRA 1NZCA 1MEC1 2R49A 4AEJA 2K17A 1LHOA 4GWIA 1ODMA 4XXAA 4OMCA 3ZXEA 3NG2A 1UD1A 4AG4A 2NPIA 5B4NA 1S0BA 2P17A 2R041 4LOTA 4E4HA 2B4KA 5ABJB 3VZNA 2WQZC 3ZVZB 2CONA 5F3IA 2I74A 3E5QA 4AEDB 2VO5A 2YPDA 3LWCA 3MUY1 4LBQD 3ZN4A 1U12A 5JZGB 1AZDA 3L9JT 3PUHA 2W2IA 3ACHA 3WUDA 3VV1A 2X8KA 4FFFA 4WZFA 4R7EA 5L7OB 1VBA2 3BCWA 1VRH1 2Z5WA 1D4M2 4MG2A 1U5YA 1V6JA 3PUQA 2HYKA 4QHBA 3PUSA 1KXGA 4XAEA 3KF3A 1SLCA 2BRTA 3NV2A 1Q43A 2F6NA 1HRI3 2VOXA 4Q29A 2SLIA 5L36A 1DGWX 2GU9A 5J98B 5D8AC 3SEEA 1YLLA 1PGW1 3LE0A 5FPVA 5FZOA 3ZR5A 3I59B 3D0SA 3P3PA 5FZGA 3ST7A 2VMGA 2ZGUA 3LEKA 5FWJA 2CKLA 5F3GA 1CAWA 3VBUB 3SUBA 5LCWL 2W94A 1RHI2 4H3WA 3VBSA 1ZZBA 1VFYA 1XNBA 3WR0A 4XFBA 5FOJB 1QQP1 1H8TA 3PLWA 5A7SA 1OUSA 4NN2A 1HJFA 3ZNIA 1O91A 2X53S 4MV2A 2LGKA 2VJFB 1E4UA 3GHMA 4CCLA 5FYYA 4Q4X3 2RS52 4XZUG 3FANA 4YVWA 4AK3A 2UY8A 5C70A 2ET7A 2ZHLA 3RI9A 2C1FA 3BN6A 5CB7A 1EP0A 3JB8A 3W5NA 2KIZA 2ID4A 2XKPA 1QMJA 4HN1A 1IOAA 2E33A 1IPSA 3DF0A 5ERLA 5LK5A 2UWAA 1MS8A 1OSGA 2QKDA 4P5HA 4COZA 4CDUC 1REFA 3QD6A 3GZTB 2R1BA 4WM8C 1Q8PA 1XSQA 1C3HA 3AP4A 3TN92 3ORJA 1WCQA 1LOCA 1NUKA 3KSCA 4Y20B 1BBT3 1MZ6A 1UY3A 2FMDA 3MW4A 1CAVA 2YBPA 2VJEB 3NV3A 2QQMA 1V00A 4BWOA 4Y5SA 2VJEA 4UI9B 2R0FA 4FXKB 4FOWA 4QKDA 3ZPVE 3ZTGA 3ZPYA 3WCSA 4JZRA 2JEMA 1NE6A 1W8ZA 5IFTA 2YY1A 3AL5A 2GZWA 3CIHA 3ATGA 2XWBB 3SH4A 2ZHKA 5F32A 1W2AX 4DXSA 5SVYA 3NNFA 4IV3B 3TWIA 3VKFC 1SLIA 4B1MA 2PHDA 2VUAA 4QQHA 2ZZJA 3AMHA 2EVXA 4D6RA 3K75B 5JXHA 3KWVA 4FPGA 4QHZA 4AZZA 4DQAA 3OPTA 4Q4V1 3J26N 1LEMA 1ULDA 4AGRA 5C33A 4AI2A 1LECA 3U78A 4IGQA 5CBLA 3FN9A 1AR63 1KRIA 1BYHA 4BYYA 4M3CB 5FQ0B 3OGVA 4YPJA 1ZREA 1PVXA 3RYKA 4YZ4A 2WSUA 1RHI3 1AXKA 4LLFA 4NHXA 2ZMKA 4E2QA 3FLPA 5EQUA 1UX6A 1UOFA 1RVF1 1UU5A 5FDBA 1U6GB 4GAZA 5FMOL 3M62A 1KFXL 1YRZA 1RB8G 2L0BA 4YZ5A 2G45A 2Y34A 3HWJA 4GMP3 2YFZA 2AYHA 5K0UC 5JSPA 3RGBA 5T54A 4M0HA 2VZRA 3JBG2 4BIFA 2Y6JA 4ZQLA 1UWWA 5CFCB 2QVSB 4XFCA 1OPOA 4PHZA 3M7AA 2XUEA 4XILA 2PHLA 5C3QA 1GR3A 1S0EA 1PZ7A 2CSVA 4KMQA 3RWNA 4CU9A 5L73A 2KWOA 3GL6A 2VUDA 1WEVA 4BA6A 3RVHA 4A6OA 1LOFC 3ZSMA 2LQ6A 2VZ3A 4XDQA 5LBFA 4Q1RA 3POEA 5GZEA 3KQIA 1UQXA 2FCUA 3KZ4C 1GQPA 1BK1A 4XPVA 4FP3A 5JMOA 3MHSA 4R8PK 4I0AA 3ZMOA 1L7LA 3I3QA 1ZBA2 2BOIA 4UWDA 3VBHB 3AFKA 3H7JA 4LBOA 5EIYB 1ZBE3 3V56A 1COV3 4WZCA 2R0HA 1XRUA 2WL1A 2RS13 3KLSA 3W5MA 2ECIA 2B9VA 4RS5B 1WW6A 4RGGA 4XJ8A 4LQRA 4XZPA 4YGEA 2DDUA 3LFIA 2ARXA 5H1TA 5JVVA 1K5MB 1OKOA 5A3LA 1WENA 3UJOA 2PFWA 2J1VA 1VP6A 3CBNA 3RWKX 1IQAA 1WEPA 3SOXA 2VCMA 2CAVA 3X29B 4LKFA 3SOWA 5G05B 1FAYA 2HKXA 4FO9A 3UESA 1W6OB 2W52A 1ND2C 1RUF2 3L1ZB 4PI2A 2MT5A 3UETA 3VKNA 5I8YA 4XQ4A 1CAXA 3SLIA 1TNRA 3MFCA 4R9DA 1Z7S1 2VPEA 5CFDC 2CHHA 1YI9A 1LR5A 4DB5A 1Q8SA 1SPPB 2W1SA 1M4WA 2P37A 2ZJCA 1RJ7A 3AFGA 1X36A 4UFMA 4ZXKA 5C5TA 3UNPA 2I50A 3P1IA 5C7GA 3NVCA 1F31A 2D97A 4QXKA 4WM7C 4KG8A 2WWJA 5F3CA 2RG4A 3WNKA 5I0UA 3VZMA 1IG0A 2WZ8A 2DSMA 3I7DA 1Y43B 4HKLA 4L58A 2E31A 4UAPA 1ND2A 1VLNA 1Z7S3 4L8QA 4BMEA 2O14A 2YU2A 3L2YA 2PLV2 2C9AA 2R063 2VQTA 5E1RA 5A7OA 3ZVYA 1W6PA 2GH2A 1NCRB 2IFRA 1ULPA 3E5UA 3OBTA 1QDOA 3ILNA 3IIIA 1RC6A 4KBBA 1ULCA 4AEKA 2EGPA 4A49A 3M70A 3GALA 2QQNA 3ES1A 2JIJA 1E5HA 1WMXA 3OB8A 2R061 5BNOC 4L99A 4B29A 1GNHA 1NZIA 5C8CA 3SHBA 3ZKUA 2OQ7A 5FK7A 1RUJ3 4QPWA 4SBVA 1QJX3 1U5ZA 2GNDA 2JECA 3JD71 4GB31 4J6GA 4PIYA 4TSVA 4CCNA 1ACCA 2BTVC 4CP9A 4EROA 1EAH3 1K5MC 1Y9MA 2QQLA 4AVBA 1GZWB 1MQTC 2CY6A 4N90A 4XC9A 3AZYA 1QJFA 2XJTA 1FV3A 3GHNA 1NCRA 3PVNA 4WVMA 2L75A 1ASJ2 1ZVFA 2OZ6A 2YG0A 4LLOA 4X8PA 4XUNA 1Y3TA 4M01A 4I7BA 2YBKA 3WQ1A 4YABA 1AYN1 1PVC1 3HT1A 5E89A 5I8SA 2R6QA 3WG4A 1E57A 3WDYA 3Q9OA 3O1PA 4N7IA 1WMDA 2F4LA 3I2KA 2FD8A 1RHI1 4CXYA 1VBC3 1ZRRA 2EICA 4KWLA 3U11A 3DPRC 1D4M1 3KF5A 5LWBA 3WV6A 4HG6B 4S3OB 1QXRA 2R32A 2BWCA 1ENSA 1OT5A 1C5IA 2CWMA 3AM2A 3BOPA 4MO3M 4PLOA 5FYTA 3PVBB 3USUA 3VBFB 3WNOA 1K42A 4GH4C 4LOSA 1SFYA 2LUWA 3U14A 2PXJA 3NSTA 3FBYA 1NXMA 5LBBA 3OBRA 1RUC1 4EJRA 1F4HA 1JZ4A 5LRSA 2JDYA 4HLTA 1MS4A 1WD3A 1VRH2 3RI8A 3THCA 5JUVA 1H2NA 3CJXA 1RUE3 2YSJA 5HV4A 1NOVA 5FJHA 5K0UB 1JBCA 4S3OC 3I4IA 4S2GA 3BKZA 1VE0A 2B46X 5HI0A 3O1RA 4AFMA 1WEUA 1ZZCA 4CXXA 1JOPA 3NKTA 1WBFA 1CPMA 4B4RA 2JDNA 4YZ3A 2G9ZA 3UKTA 1IPJA 4NOTA 5A3WA 4FOYA 3RNSA 5J09A 3AMNA 1ZBDB 4F7ZA 3DL3A 3RYPA 5H9MA 1HXS1 2XBO2 1NYWA 4K6BA 1PIV1 4MXWA 1OFSA 3ZIXA 2GALA 1BBT2 1AX1A 3GBWA 4NWVA 2A3YA 4XTMA 3FM8C 4YNIA 4A3ZA 4DS0A 5D1KB 1XYPA 4QT6A 3I8TA 5FYBA 5EV7A 5KR7A 2QICA 2JE9A 2WYSA 1YCIA 3G7DA 3ZFGC 2B8MA 2PMWB 1DZTA 1G8WA 2JX9A 2EIDA 2VZVA 4RN5A 2WQ8A 3DPLR 1YI7A 3T6RA 4Y5Z0 3AC0A 1NAEA 5K8SA 1DGWA 3U4SA 1RUC3 3O37A 1W06A 3IZOA 3KV9A 4E8CA 1C57A 3QBQA 5KBFA 5JCTA 2MNZA 1JM7B 3Q8FA 5KHIA 5EJ3A 1OMIA 4XMIA 4MH0E 3ASIA 1GWKA 1G86A 1LU1A 5FQ0A 3FL2A 5LKTA 2QQWA 4AVTA 1AX0A 4QWNA 4LXLA 1S0DA 2Y6FA 1TG7A 1SBFA 1ULOA 3AMQA 3POSA 4LBMA 4RQPB 1PNGA 3AZVA 4AQTA 4EWDA 4BQ4A 2BVBA 4YW5A 2I45A 2EXIA 4YW6A 4B7YC 4TLFA 2JUNA 2WO7A 3MUZ1 2ZGLA 4F83A 4QM8A 4D0QA 5I0DA 5FRAA 2YV8A 5IVCA 2WZR2 2XGXA 4QXBA 4RD7A 5TSWA 5CFDA 4Q0QA 4Y3OA 5BNNA 5L7OC 4OQ8A 5G04B 2MEV2 4A4AA 2YU4A 4P9JA 4H7MA 4P08A 5EPAA 3ZX7A 4CEYB 4AFBA 4LIUA 1UPIA 4YBSA 3FMGA 1TZOA 4XFHA 4KGGA 5LZ6A 1UF2C 1ZA4A 1H6YA 1NCQA 4CU6A 1NLQA 1DHKB 5J48A 1JZ3A 4YSFA 3B69A 2CSGA 2XL7A 3LD8A 3ZM8A 5E16A 2MA5A 4N43A 4QDQA 4OHYA 4DUXA 1J1LA 2WNUA 1DGRA 4RS5C 4W6XA 2QNKA 2P3YA 4HFSA 4LO8A 1NQDA 2HWC2 4V2WA 5KH9A 5TABA 1CJPA 1LHWA 2NP0A 1LDJB 2P3JA 3B3QE 5E88A 4KH9A 1LGBA 3APBA 4HK9A 1LOAA 3BODA 3E97A 1UNBA 2VMDA 1XU1A 3DCQA 4JDMA 3M3OA 4XXPA 2HEVF 3KB5A 3WNXA 2WWSA 2B39A 3DDTA 5FJKA 2XJQA 4QDSA 3WT3A 2IXIA 1GICA 3ZO0B 4Z1VA 5GJ6A 4XMAA 4A7KA 4FTSA 1W0PA 2DVGA 4UW3A 3VBOA 1OF4A 1K5MA 1V9U2 3KD4A 3ZYQA 2WFPA 4HKWA 5EJZB 3OUJA 5F2WA 5LBCA 3ZSKA 5JPNB 3POFA 1G6NA 5C4WA 3LFMA 4AI3A 3V0AA 4IE5A 4XF9A 1V6NA 1ZA7A 2Y8KA 5FTTC 2DVAA 4PDWA 4AR2A 4NUBA 1JH5A 5C4WB 3V0AB 3RG0A 3M8LA 2XPJA 2ECTA 1WESA 4P9LA 4YFWA 4PDWB 2B0OE 2TEPA 5JIAA 1FPN3 2ECJA 2KWNA 2JDAA 2Y33A 1CIWA 4ZS2A 1OQDA 4FVVA 5FXZA 1DQ4A 2VOKA 2D6PA 3N3HA 4BXFA 3PURA 5DAQA 4HSJA 5LASA 2V72A 3KVBA 1Q5OA 1CZVA 2QQUA 1LRHA 2PELA 3OG2A 4NHLA 3RZHA 1R1A3 1YFWA 2D8SA 1ODNA 1VBD1 2QZ3A 1W8UA 3CDZB 4QPGA 2D98A 2CGPA 1JMUB 1AR82 4D8MA 2K4DA 3CEWA 1G9FA 2WNVA 1JHJA 2ET1A 5FBZA 4FAGA 3M63A 2AREA 3H42B 3SH3A 1X82A 5EJ1B 1UN1A 1PZ9A 2RM22 1F5FA 4QB6A 3WSOA 1U0AA 4I0BA 3WDVA 4GH4A 3V43A 1BQPA 2VR4A 4XJ9A 5ABJA 3GV4A 1WA4A 2GC0A 5CIRA 2JG8B 1QOOA 3SNMA 3D8CA 3ZFEA 3N35A 3ELNA 1B09A 2CTVA 2D44A 3A22A 3LZZA 5KHKA 3R05A 2GNBA 3S5AA 2GAUA 3UGGA 5KXCA 1OOPA 1QJX2 2JJ6A 3MIBA 4BZ4A 3E6BA 3VDAA 5JZGA 1F8VA 5C8WA 2UU8A 2RE9A 5FPUA 2TUNA 3ZFGB 1J3RA 4ZU5A 5J3XA 2GMPA 3ZYGA 1QGLA 4E27A 3EYPA 3IAPA 3JBG1 3OOXA 2F6JA 2HWF3 2DUOA 4PIXA 1PK6C 1POV3 2Q1ZB 2XONA 2RR13 5FLIA 3VBFC 3L11A 4B86C 3KCXA 1JN2P 3U5OA 3RQ0A 5K9YA 1RVF3 4KL1A 4C1WA 3AZXA 1UMZA 2VZTA 2DJAA 3T1LA 2FSAA 2WZPP 4CDQC 1I9RA 4NRMA 5FMBA 3HVDA 4EQVA 1X33A 1VBA3 2KM2A 3H7YA 4YGCA 4BQ3A 1WCDJ 2VMHA 1D7PM 2UY9A 2VZPA 3AZZA 1DDLA 1MM3A 4H9DA 3DYOA 4QD2A 5T52A 3VBUA 3MHHA 4UFHA 2YDEA 3JD72 4GB32 4MGQA 3GCWA 3LIGA 4QPIA 4QQOA 2VH9A 1GWLA 3I3EA 4LA3A 3NJXA 3WXPA 3KDEC 3WP4A 1A6CA 3FLTA 4YM2A 1A3KA 5BNPC 2YHNA 1UYZA 4CZSA 4Y1VA 1EPZA 3AVRA 2W3JA 4CDQA 5BNQA 5LKXA 4XF4A 4Q26A 2HWD1 3T2QA 2GC2A 4AQ6A 2KYUA 1N47A 2VXJA 3EJKA 4OUSA 4K8FA 3AKTA 1UIJA 4AI9A 1GZ9A 1OF3A 3FHAA 4IE6A 1CAXB 5IK4A 1WCKA 2P57A 5CADA 2JE8A 4YADA 4K40A 2DVDA 2QQVA 3POWA 4I0WB 1DLLA 1W8FA 5EFUA 5A70A 5C3SA 4BU2A 5JI7A 1XNDA 2RHPA 2XJPA 3P6BA 5FO8B 4IEPA 1PZ8A 5L19A 1SPPA 5DINA 2ZCWA 2WFF3 2ZZQA 3KT7A 2E63A 1WW5A 2YT5A 1ZBA1 3H8UA 3ZDVA 1W8WA 4PF1A 2Q8DA 1JYIA 1ASJ3 2WSVA 2D7FA 1REDA 3MIHA 4NJ4A 1REEA 2OS2A 4UBHA 3TN91 5FZ9A 5GZGA 1W2UA 4WA6A 2FMYA 1CONA 3EQEA 1HYIA 3RPGB 4BMBA 4O64A 2VG9A 1O5UA 3DYMA 4PCRA 4RQPA 4LNVA 3FFQA 1QJZA 2PHUA 2PUYA 2HWD2 5IW0A 4QX8A 2KU3A 4FPKA 4CEWA 4FPEA 1W2NA 4XABA 3CQOA 4PPEA 1H6XA 4GKXA 5KXEA 1GWMA 2H0VA 1KJLA 4XUPA 4CUBA 4KG0A 1BHGA 1H0BA 4LUMA 3ZXGA 2IQJA 2BNMA 4LA2A 5TDWA 4CCMA 2J1EA 1CZSA 1O8PA 2YYOA 3O1TA 2MKEA 5CISA 2AUYA 3VDCA 5JOYA 2FDJA 1H1IA 4RFT0 5JXJA 2C9KA 4RA0A 3POYA 1W99A 5BPXA 2RDRA 1RUF3 1MEC3 2ILMA 3H1MA 1AXZA 5IT6A 1WKYA 2Q8EA 3B9IA 4FPLA 2WNUB 4FPHA 4O9GA 1KD7A 1ZBA3 5FXVA 4LE3A 3POGA 4MGYE 2ZEYA 1JYWA 3KNVA 4GXLA 5APAA 3GBGA 5A33A 4XTPA 2YQLA 2WAAA 2Q1FA 4P9XA 4HPKB 3KGLA 2OPKA 2VAUA 4IUGA 4CVUA 4CEYA 2DV9A 3ACIA 4MSVA 2JMJA 1S2KA 4R9CA 3C7GA 1PIV2 4P9WA 3CKHA 2XG3A 3EBRA 4K7JA 1BVP1 3H0OA 4JTOA 4AFCA 5HBAA 1QJX1 2MHFA 1GU3A 4ES9A 3MGUA 4XI1A 4BQYA 5B79A 1H8TB 3PMSA 4UW5A 3ITQA 1TMF1 4QX5A 4COWA 1WLDA 5DUXA 1S0IA 3HQXA 5FZBA 4B7KA 1UY0A 2QQOA 3A4UA 3V65A 5FYSA 4CCDA 1TQ5A 3LQIA 1YIFA 1N3QA 3LDRA 4AHZA 4HXCA 4XOGA 2IXCA 1TNFA 1C5HA 3IN9A 3I97A 3N9LA 3PDQA 1JZ2A 1MPXA 2PHFA 3LAGA 1QEXA 1LODA 2LS6A 3VBOC 3IDBB 5LY2A 5KHGA 3R0RA 3EB7A 2VOVA 1MBMA 3ASLA 2ES3A 5FP3A 1AYM1 1Y9QA 4LR4A 1MQTB 1AJOA 4FT8A 4W50A 5CNAA 5FY1A 5C4WC 2WNOA 2WZR3 5B4XA 1WILA 2VC9A 2VQUA 3LA3A 1LDKC 4JGZC 2XB6C 4PLMA 1Q3EA 1RUD1 2DCYA 2XKOA 3LSEA 2ZEWA 4W6YA 4TKPB 2DFBA 5IVJA 4IXLA 4CDWC 5LA1A 1W28A 4HSLA 1EUUA 2G1MA 3WNMA 2JB4A 1W90A 4LJNA 4R8HA 2LM3A 3K48A 3H8RA 4XFAA 2M6MA 4K1ZA 3I3MA 2J42A 2RS53 1AVBA 1OVPA 3FFZA 5AC93 3HMYA 5J96B 2TBVA 3E6DA 2BWAA 4KI5M 3SISA 3N9PA 1HLCA 2A3XA 1WE9A 4XFGA 5H9SA 4CXWA 1MS0A 5TBNA 4XBQA 4Z0OA 3RZKA 2O8QA 3I54A 5FY8A 3LEIA 5JOZA 1W6MB 2QQKA 4A2UA 2HJIA 1ULFA 3MICA 4HBNA 2WABA 4AGVA 5DG2A 3DPRB 5HXVA 3ZFEB 2DUQA 1PX4A 5LK7B 2J1UA 2YC2A 5JLVA 1RUNA 3WQ0A 1K3IA 2RV9A 2BP6A 3KT4A 5FZ6A 1STMA 1S1AA 3DGTA 1JUIA 4UFKA 3GJAA 2UYAA 2ZGOA 3DXUA 3UGFA 3ZFGA 1LB2A 2W1WA 3OGGA 1MM2A 2FDIA 2ZETC 4QX0A 5FZ7A 1Q8VA 2JG9C 1VBD3 4IEWA 1W0NA 2K46A 4F3JA 5JZGC 3RZLA 3Q8CA 4A4BA 1FNYA 1W6QA 1AR93 3HAGA 3N9MA 3VBRC 2OIIA 2GMMA 2EXUA 1OLME 2XDVA 4Q27A 3O5SA 3URFA 4RR3A 3WHTA 2ZAHA 3BI3A 4CCGX 4CDXB 4NHKA 1L7QA 4WVVA 4JRAA 5F2SA 5DAXA 5E8AA 4TTGA 2WR9A 2OX0A 3AMPA 1MACA 2P34A 1PO11 4DUWA 4NROA 2DCJA 3USSA 2R062 4MZUA 3N4MA 3ZOIA 3OD4A 1QDCA 4ET7A 2LAUA 2ATFA 1SBDA 3C7HA 3QH7A 4CRQA 2LGGA 3ZLIA 3MFAA 1OKQA 4U2AA 4XFFA 5FZEA 5GLUA 1PO23 1GKBA 3D5OA 1S55A 1J3PA 4O7XA 3OEAA 4LKAA 2XOMA 2CGOA 3K2OA 4N43B 1O5LA 1HKDA 3IBMA 5CKQA 3WINE 2Y64A 4CPBA 4NIHA 2AACA 3BVCA 1DG6A 1DLCA 1JYNA 1DCSA 2VZQA 1H9WA 1L7RA 2RSDA 2YW8A 4OHVA 3W9AA 4CDWB 1O6UA 1QJU1 5T50A 4AL9A 5A6ZA 4N8MA 1WD4A 4GWMA 1OHFA 1D0HA 2ZMLA 4K20A 4HN0A 2XEUA 5FZ0A 1SLLA 1RUJ1 1H4HA 2EF6A 1OURA 2VUJA 1HIXA 4P00B 1H2LA 1RMU2 5C9AA 1A34A 2MNYA 4YC9A 3U5NA 4NR1A 4WVWA 4ZONA 4IE0A 2XQXA 1PX3A 4IV3C 5FV3A 4DXTA 2P1BA 2PN5A 4GALA 4W4UA 5FCCA 1AR91 1NA1C 1GNYA 3MW3A 3VBOB 4FIPA 2A71A 4CCJA 1KDKA 4UT5A 2JM3A 2WUHA 5EYXA 1QIQA 1AYN3 1PVC3 3HJRA 5F5AA 3PIJA 1AR72 3SEPA 3WNNA 5F39A 4LTAA 4HVQA 5A32A 3O1UA 4EN0A 4N7UA 1W2TA 1C4RA 1H1MA 3FE5A 4FXGB 5AVAA 3TNQA 3FJUB 1G25A 5IATA 3UV9A 3AKPA 2W5FA 1T2XA 2YGMA 4WM7A 3NO8A 1AR73 3JZVA 2D6LX 1IKQA 2I2SA 5FYIA 4QPIB 4LEJA 4YW3A 4NIDA 2BNNA 2VMIA 1RUOA 2KGIA 4CEWB 5A3NA 4R4ZA 5C71A 2WJSA 3ZSEA 1SFPA 2P3KA 3U5PA 1SLBA 1WMEA 5FZLA 2KWKA 1DGRN 5FP9A 3ZYPA 2J22A 4AI1A 5FPZA 5J37A 3SKVA 3DYPA 5D8AA 2D3SA 2ZKLA 1E5IA 1HRI1 2VVDA 3BPSA 3R6SA 3JU9A 1WEWA 4GA9A 2BGCA 5EYYA 5H1UA 3NNGA 2XBO3 2NAAA 3C7FA 1TMF3 3H3LA 5JR2A 4AVVA 3GCXA 4NRQA 4PF5A 4FPOB 5GZFA 5FZHA 3POJA 1LGNA 2R071 4FFHA 5IFPA 4HVOA 4JGZB 1ULEA 2OPWA 5CZKA
chains in the Genus database with same CATH topology
4LT5A 1R093 2ECVA 2HWB3 1COV1 4LULA 3C6WA 1JM7A 2NLRA 2PLV3 4CTEA 3BALA 1AX2A 5JAXA 2CKLB 5D8AB 2W39A 1WBLA 4Q4V2 1FYUA 1CJDA 3K51A 4L9BA 2HWB2 3S0MA 4LO7A 4F8AA 4FBFA 4LADB 2BNOA 4QGLA 1MS5A 4DZGA 1C8NA 4K9SA 4N9IA 1EY2A 4J1XA 2YURA 2GH8A 4Y26A 2KREA 1QJY2 4S2DA 5A33B 1HX6A 1H9PA 1O3RA 4PDWC 4R4XA 2HWC3 3MDPA 2ZHMA 5AVPA 1LEDA 2MPFA 5H9QA 1Z0HA 4LE4A 2ZX2A 3DKWA 3TB0A 4G3YC 3R4SA 3PLQA 5DUUA 1RTVA 3VDDB 4WV8A 4HKOA 2RI7A 1CAVB 2VQ0A 5K7PA 3B02A 4LO5B 4IEYA 2V73A 4DFSA 2A6YA 1DGLA 1DZRA 2QZ2A 4FIPA 2Z2SB 1QJU2 2GC3A 3FUOA 2Q1MA 2OUJA 3KCCA 4GWNA 3QLQA 2B7YA 2D93A 2A75A 4YVSC 1T6GC 2FZ2A 2A73B 4E9KA 1LGCA 3OF1A 2WFF1 4LLBA 5LRRA 1LTEA 1ENQA 1WGPA 2ZA9A 2BPA2 2AR6A 2E6RA 2HWE3 3AYCA 3SCGA 3AKQA 2YHJA 1HV1A 3J8F1 4NN0A 5D1IA 3RSJA 3AJZA 4FAHA 3S7EA 2F4PA 4ONUA 4AYUA 5B75A 2B45X 1RUD2 4RSUA 2CV6A 3THTA 5B78A 1V9U3 4YVSA 1O4ZA 3IIAA 1JTZX 1GSLA 4TWTA 4AW7A 1IPKA 4KWKA 2LRIC 2NN8A 4LBKA 1VYXA 2JMDA 4WZ2A 4JC1A 3O0XA 3H1YA 2QJ0A 1AR62 2B9UA 2JKBA 1QKQA 2EXHA 4YGBA 2CL2A 2FUIA 2KA3A 1FOD3 4MLOA 2ZPXA 1BXHA 5T5OA 1BEV1 2RS32 4EV0A 2DYCA 2A6WA 3BTAA 1PO21 1NLRA 3BOWA 3AKRA 3CNAA 4X3GA 3MIDA 2YC0A 4I3GA 2JENA 4ISQA 2O1QA 1RVF2 3N7LA 3EB6A 4V1PA 1I5ZA 3J4UH 3HCSA 5AIUA 4LBJA 5CFCA 1X4IA 1WEOA 2WNUC 4Q4Y2 3LRQA 2GDFA 2D43A 4LO6B 1DQ6A 2G9GA 3AMMA 4Q4X2 2Q30A 5JOWA 1PO12 1WUVA 3B5LB 2YUEA 2VY0A 4GULA 4C90A 3NL1A 2L80A 1S0CA 4YG0A 1FP0A 4F52B 3CF6E 1TME3 1O4TA 5DDJ2 4CDXA 1RUH2 5B77A 2ZKNA 2LALA 2IXLA 3TBDA 1AR92 1MVEA 4L97A 5KC6A 4C9ZA 1OLQA 3VDDC 5KWRA 4FTEA 1U5XA 1R1A1 1ALYA 2WZR1 3VGIA 2MEV3 1ND3A 1X4JA 2ZTNA 1QOTA 2LV9A 1GQHA 1BORA 4CDUA 1IS6A 2MNGA 3THPA 4XF1A 4AHXA 3KS7A 4S2HA 1OQEA 2YZ4A 3VZLA 3ZSLA 4ASLA 3NAPA 4L7XA 4LBQB 3WX5A 2QDRA 1GV9A 2XLGA 4Q0UA 4AVAA 1IS3A 5IK5A 1Q56A 5F6KA 1RJ8A 5AITA 1NCRC 2CYFA 1ND3B 3ALQA 1B35C 1C8M2 2PTMA 4O9EA 3SITA 3MLKA 3PTYA 4FP2A 1SCRA 5KXDA 3WDTA 3UKVA 5JG6A 4GIQA 1V70A 4AVSA 3U10A 1FT9A 2VXRA 1N3OA 2VNFA 4N9HA 3WQ7A 5J7MA 2H6CA 3A0KA 1SEFA 4XIOA 2WT1A 1QF3A 4JRLA 2O0OA 1UW8A 2IC1A 1N87A 2JICA 5LEJA 4J1WA 4DOUA 4R2YA 1XYOA 1AXYA 1H2MA 2LTNA 4XJAA 1RUF1 5JDBA 2ZABA 4G4FA 3VZOA 1Z60A 2L43A 2KXLA 1U5IA 2QFEA 2WC2A 2IFWA 4YW2A 2UYBA 5KHJA 3MZHA 1SACA 2BYVE 4YYOA 3WLUA 2XJVA 4XFIA 1R083 2FBEA 3VZKA 2GSYA 1UPSA 3VBSB 1R091 4Q4W2 4Q2FA 1WEQA 1GZWA 1W6PB 2IZWA 3OPZA 1N1VA 3RJ2X 2ECWA 1WEEA 2HWD3 1ZNPA 1G9AA 2SBAA 3T7LA 3JQXA 2YMZA 4OHWA 2WA4A 3OJBA 2RM23 3AP6A 1MS3A 3I59A 3ZN5A 3WG1A 4ZUXU 2P2KA 1OFNA 1CX4A 2JG9A 2ZGMA 1GYKA 5GZDA 2WQ4A 1FNZA 3MF9A 4M3CE 2DURA 1GNZA 2KE1A 2YYRA 3VHNA 3QOPA 5FB0A 2ZGTA 1I6XA 2WA3A 4BLIA 4QM9A 2YREA 2VQAA 3IM0A 4ISRA 1RUE1 4OHXA 3ZXKA 1PGL1 4Y1UA 2DX8A 1FMD1 1AF9A 3ILFA 1AHSA 2XJUA 2K2SA 2XBO1 3WP5A 3TRSB 4FSJA 1RUC2 4BBQA 4Y22A 2EIGA 5F9TA 4FQZA 5A3MA 3LA7A 2DU0A 2Q8OA 1KDMA 3PHMA 2CSYA 4FOQA 4IV3A 3MI8A 1W0OA 5B2GB 4Q6FA 1ZZ8A 4JAAA 1F9KA 2UURA 4BPZA 3KGZA 4SLIA 1GQGA 1WLWA 1AL23 1Q8QA 1NG0A 1RMU1 1EYBA 1S0GA 2EALA 3PHDA 2B5HA 2FHRA 4IQPA 4QQLA 5FERA 3T2TA 2VNGA 1OPMA 2XJSA 2BEOA 1FX5A 2QCSB 3SCHA 4CEWC 1G7YA 2XVKA 4YVSB 2E7AA 2GN3A 4FPFA 5GLZA 4B4PA 4FPYA 3OCPA 1G9CA 4QF2A 3H1WA 2ZACA 2XUMA 2FUUA 4DRVA 3CJIB 3ZFFA 3OY8B 5ACA3 4GKYA 4QGNA 2B42B 1T1HA 4P14A 4IEOA 1LCLA 1LENA 1HQLA 3LOIA 3WDXA 3ENRA 5SV8A 1WLTA 1NCQC 1YFYA 2PQQA 2XLAA 4D7TA 4QPGB 5C9AC 1D4VB 4QQ2A 2WNVB 4KGQA 1ZM1A 2AZ5A 4OZXA 1XWHA 2AGSA 2W68A 3JUUA 3B7MA 5DZGA 1QQP3 4A7YA 3LGRA 1TEIA 2OVUA 3JB4C 3CJIA 4IC3A 1NLSA 3LSDA 5FEYA 1EAH1 3O0WA 4QPGC 4N53B 1PK6B 1H2KA 5BYNA 4URTA 2DUPA 3QCWA 1QQP2 1QOSA 5I93A 3FLRA 1C8M1 3NAPC 4M3CF 4COUA 1LULA 4XHXA 4V3LC 3VHOA 3VKOA 1SLTA 1ZRFA 1UU4A 2E9QA 1EV12 1FATA 2E51A 4ASMB 4NPRA 4XQWA 2JG8C 4WBBA 1MR5A 5KC5A 1VALA 3NKGA 1BKZA 3ROUA 5IK8A 2D3PA 1Y7BA 1H8TC 3PJQA 4FPCA 4QF3A 1MQTA 4XF0A 4UP0A 2HWC1 1NCQB 5BNOB 1XE7A 1RUG1 4QQPA 1H8VA 3B00A 1AR83 2LN0A 4M00A 1UL9A 1YJKA 2YHOA 2Q5TA 4I02A 4X6QB 3KV5A 3AB0A 4ES8A 5AFEA 2VPGA 2C0ZA 1OI6A 2ZOEB 2YQMA 2ECNA 5B76A 1VBC1 4K1YA 3ZFEC 1VBA1 4LHNA 1ZBE2 4OI4A 4Z8BA 2RS51 4Q4W3 4PJYA 4E4ZA 1W6OA 2E7TA 4XEZA 2E6VA 2VU9A 2JE7A 5EXOA 1J59A 2VECA 5GALA 4AFAA 2A5ZA 2DCZA 3SOUA 4E2SA 5BXXA 4XYXA 4WZ3B 2HWB1 2R16A 1H4GA 4EWEA 2RS31 2ENRA 1SQ4A 1JW6A 1ND2B 1R092 2JXAA 3AXEA 1UAIA 4Q4W1 4E2GA 2HWF2 4FOVA 3C5KA 3AP5A 3LA2A 2ZX0A 1RUI1 4JQRA 4META 1W6NA 3HCUA 5GKAC 4IERA 4FK5A 1AJKA 1AR61 1RIRA 2ZMNA 3IKWA 4BCUA 1LOFA 2QE3A 4C1XA 1AR81 2K9ZA 2HDPA 3GZUC 2VGDA 2N7GA 2DTYA 4YBMA 4FPJA 3VBRA 3IT8A 2CSZA 1TMF2 2Y1MA 1YWKA 3GYDA 1VR3A 2PYTA 4AVCA 2BAYA 1X50A 2OA2A 4D94A 4AI8A 3CO2A 5L7OA 2XVGA 5FB1A 4PIZA 3INAA 2IXJA 3N9OA 1DU3D 4LHKA 1S0FA 2D6OX 3NWKA 1OQ1A 1PGL2 4H14A 2VNOA 1HRV3 1RMU3 3UJQA 1DYPA 1AL21 1RUJ2 1X7NA 4AUQB 2KR4A 4YVWB 4AHWA 4N4FA 3AP9A 1C28A 4DY5A 3SXWA 1ZRCA 3HTKC 4AYCB 2WFF2 2XWJB 4IESA 5C9AB 5JWPA 4D69A 2MA6A 4Z82A 3ZMNA 3VL9A 2LXPC 3MPBA 4BHWA 5T5JA 5ACA1 4PLNA 1IS4A 3WP6A 3WW4A 1V87A 2QJVA 3N9NA 4IEUA 4A4CA 3FX3A 1VBE2 5TRBA 4OULA 2PHWA 2OW4A 4GNDA 5A32B 1NXD1 2WKKA 3O14A 1JUHA 2ZGNA 4K3UA 2VPDA 4MGIE 4AFDA 4IV1A 2PNXA 2BW8A 1LESA 1LOEA 4Y4YA 2HEWF 5DXDA 3G6JB 1UKGA 4YARA 2F6BA 3PVEA 3VN4A 3RZZA 4NHMA 5DUVA 3SMHA 1FXZA 1FPN1 4AXOA 1O4YA 4DMIA 2UZGA 1A78A 4LUKA 5LCWB 3ZPV1 2VPBA 5HCFA 2V5YA 2WIIB 1DFQA 3MF6A 4L11A 1MEC2 4I01A 3ZYIB 2TNFA 4BH9A 1QU0A 4YW1A 3U4XA 1FOD1 2EXJA 5TDRA 4S2FA 4AQ2A 2PHXA 5SV5A 1MS1A 2A6VA 2WLQA 2WNVC 5IK7A 1M06G 4ZDTA 4IEQA 3V0BB 4JDNA 2HWE2 1W6MA 4EN9B 3LOBA 3IMNA 2Q4SA 4Q4Y1 1ULGA 2RMU1 1N1SA 2WS91 4GMP0 3DPRA 2C2VS 4LK9A 3DV8A 1WGMA 2MD8C 1QH7A 2AN6A 4L2NA 3PVOA 1YNAA 5DZEA 1DYKA 1XU2A 1V6LA 3W58A 4W6WA 5KXBA 1CAUB 1QJY3 3IPVB 4N53C 3UKNA 3FUQA 4AQSA 2RS12 1MZEA 4AEDC 4AYCA 2EODA 4DY3A 2PA7A 1LHNA 2WLPA 3ZFFB 3VUOA 4ZU4A 3WW1A 4D7SA 2VW1A 1R1A2 3MLJA 4BE3A 4D3WA 1RINA 2BVVA 4G9SB 1GANA 1FMD2 1TME2 5DDJ3 5T5PA 4TZDA 2R1DA 5D1LB 4Q8KA 4E4SA 4YG6A 1CAUA 3IPVA 4XE9A 3WY6A 3ZN6B 4X6RB 3O35A 4OVEA 4RHV3 2G9FA 1XYNA 2WT2A 4RR3C 4WM8A 2VJFA 5FMOS 2JMIA 2CWSA 2NYYA 5AC91 4L92A 1ZZ6A 1N1YA 4Y1ZA 4DPNA 2M85A 4OI0A 4YW4A 3RYRA 1ENRA 3VBHA 5CU1A 4KU8A 4HPKA 1VB2A 5F1RA 2HEYF 1VB4A 1YFUA 3N7MA 4Q8LA 3IDCB 3SH5A 1RUD3 2ZS6B 3ZN6A 5LKUA 2PLV1 1QNYA 4OHZA 4COVA 1I1EA 4GMP1 4R9AA 1HQWA 1JHNA 3VHPA 1F2NA 1KJRA 1X8EA 4PBPA 1SMVA 1DBNA 3H9AA 1Z78A 1NE4A 3VBHC 4B8EA 1WMFA 4KQ7A 1MZ5A 3D82A 4R9BA 4I3PA 5I8TA 3O34A 3WZ1A 3H3ZA 1YHFA 3DQVR 5KHHA 2XH6A 1Z2QA 4EWAA 1CESA 1KITA 1ZZ7A 1UU6A 2A3WA 1V6OA 4HANA 4FJCA 1VBC2 2BFUL 4YZ1A 4XBLA 3M3CA 3D0JA 4XHBA 1APNA 2PAKA 4OFGA 3VBRB 1LHUA 4JGYA 1LHVA 2G6QA 5H1VA 2RS11 1L3JA 5C11A 3O7AA 4JGYB 3RRDA 3U5MA 1FPN2 4M3CA 4I7DA 4CA1A 1Z6UA 4P9IA 3QZVA 4GNGA 2Y43A 2X5IA 1COV2 1YO8A 4UBGA 1YUDA 4AHYA 2XB1A 5H9RA 2ZX1A 4HZFA 4X8NA 4ITCA 5I0TA 5JMCA 2Z69A 4BOWA 3ECQA 2KFTA 2MIQA 2YROA 4GNEA 4Q0VA 2Z79A 2OYZA 3H50A 4NO4A 1DQ2A 5F5QA 1IS5A 1VD4A 3NJZA 2VOWA 1J3QA 5GLVA 3ZFFC 1CAWB 3DN7A 1RUH3 3A0NA 1Q8OA 1V6MA 4IV1C 1YJLA 2QIZA 3OTFA 1YXWA 2R073 2DCTA 4Q1PA 2ZGQA 4JVAA 3ZDSA 1UZYA 2O8OA 1I3HA 4HVRA 4BQ1A 2VULA 3JQWA 3W59A 2XVLA 2OXQC 3C2UA 3ETQA 2Q0AA 2D5HA 1XNCA 5DZFA 4LO4B 1D4M3 1PGW2 4RS5A 1HXS2 2MEV1 4UW4A 1RUG3 4C0HA 1YYNA 4KNCA 3LQJA 1ND3C 3N7KA 5JR7B 2VP7A 4CDUB 1RUI2 4YVWC 2IDAA 4N3WA 1V6IA 2YPJA 2H0DA 1VRH3 5CG9A 3P3NA 4Q4X1 3AK0A 1B35A 4Y22B 3S6PA 2HWF1 1NY71 4WZ0A 1ONAA 1QXPA 1D2QA 5J36A 2EAAA 2GMEA 1XNKA 5G0FA 1ENXA 3HT2A 2L5UA 4P5OB 2ZGKA 3VZJA 3ZVXA 5CAZA 3AZWA 1CPNA 2PAEA 1N1TA 1SDWA 3FBMA 1G9BA 3AYEA 2C2LA 4YAXA 4UP5A 1BJQA 5FO7B 5T55A 1V9U1 5J3UA 2LXHC 1JYCA 1FMD3 1GZCA 1B35B 1PHMA 3I2DA 1QNWA 4IV1B 4W65A 1CHCA 1WLCA 2HYED 3WG2A 1LOBA 2P3IA 4ATEA 4JGZA 3ZYJB 1VBB3 2IXKA 3J8F2 3LCPA 1ZBE1 5BV6A 2VW0A 5I91A 1NA1B 1AYN2 1PVC2 1QXJA 3D4KA 4R52A 2RJKA 4AEDA 3M3QA 1G9DA 4GB0A 3RJRA 1PMIA 2ARBA 3C3VA 1VJ2A 5ABJC 3B94A 4MGKE 1X4UA 4Y1YA 4AVXA 5BUVA 4C91A 3AKSA 2BBVA 5GLTA 1RUI3 4NVPA 2E53A 3L1XA 5JI9A 2AENA 3NW4A 2VVEA 1S0JA 2E7QA 4EN8B 3WCRA 4XF3A 2XJRA 1IZ3A 2HWE1 3AYAA 5EWSA 1J1TA 3TOJA 3VBSA 2A6ZA 2ETEA 1BCXA 3LB9A 5JPMB 2NQYA 3VBFA 4WVZA 1KS4A 2EXKA 2GC1A 4OLLA 5JIUA 1LOGA 3M3IA 1VBE1 3RMYA 4HMZA 4K21A 2VW2A 1O3SA 5FOBB 4IL7A 4LBNA 1X8MA 1VAKA 4GQ7A 2ZX3A 1VIWB 4XJZA 2A6XA 1MZFA 5KH3A 3TN93 3LQHA 1ASJ1 1RMDA 3WOGA 3O70A 1QHDA 1XXNA 1FI2A 2DCKA 2ZX4A 1GFF2 2QUOA 5AC92 3OGJA 2CT2A 4XBNA 4I30A 5GLWA 1EPWA 1WEMA 1MVQA 2X5IC 5JOXA 4A0CD 4YGDA 2ZGRA 4Z2WA 1DF0A 4RQPC 1DVPA 2Y0OA 2CNAA 2XHKA 4IEXA 1XQNA 4RL7A 1JOJA 2DU1A 2ZGSA 1QY4A 4QGMA 4AWDA 1ZRDA 1WW7A 5JSOA 2I07B 2R072 2ZGPA 2LGLA 1KQRA 3B01A 4Y24A 3E5XA 4RGAA 1AL0G 3WUCA 2X29A 4DNYA 3MYXA 3WW2A 4Q0SA 5FO9B 4JV4A 3R4UA 4MX3A 4BLJA 5T3NA 4COYA 3UL2A 3HR9A 4YG3A 1OA2A 3ZXDA 4Y20A 4EN6B 4DXZA 4BIOA 5HCAA 1F62A 3VLBB 5CG8A 1BEV2 3RTRB 4OI1A 2PHTA 2JDZA 4H7LA 4CDXC 2VVFA 5BNNC 3O12A