4MVTA

Crystal structure of sumo e3 ligase pias3
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
283
structure length
255
Chain Sequence
DVTMKPLPFYEVYGELIRPTTLFEEAHFTFALTPQQVQQILTSRDYTIQVQLRFCLCETSCPQEDYFPPNLFVKVNGKLCPLPGYKRPSRPINITPLARLSATVPNTIVVNWSSRNYSLSVYLVRQLTAGTLLQKLRAKGIRNPDHSRALIKEKLTADPDSEVATTSLRVSLMCPLGKMRLTVPCRALTCAHLQSFDAALYLQMNEKKPTWTCPVCDKKAPYESLIIDGLFMEILSSCSDCDEIQFMEDGSWCPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of SUMO E3 Ligase PIAS3
rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords E3 SUMO-protein ligase PIAS3
total genus 63
structure length 255
sequence length 283
chains with identical sequence B, C, D
ec nomenclature ec 6.3.2.-:
pdb deposition date 2013-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02891 zf-MIZ MIZ/SP-RING zinc finger
A PF14324 PINIT PINIT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.780 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4mvtA01
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4mvtA02
2XB1A 4UP0A 2L0BA 4AYCA 5J3XA 4I7BA 2KWKA 3L1XA 2LV9A 2MA6A 5FEYA 5B75A 5TABA 4PTBA 4LLBA 2FUUA 3FL2A 1ZBDB 3RTRB 2MIQA 4ZUXU 3I2DA 1WEEA 2HYED 4R2YA 2MD7B 2RI7A 2G43A 4UI9B 1BORA 2C2VS 2ECJA 2K1JA 4MVTA 3N9LA 3EB5A 4LADB 2ZETC 2MA5A 4YBMA 2YHOA 1LDJB 5C11A 2LGGA 2JRJA 1WEWA 4YATA 4B7YC 4YABA 2VPEA 2Y43A 1Z60A 4PPEA 1JOCA 4YBSA 3KV5A 1HYIA 2VJEB 2F42A 5H9MA 3LQJA 3HCSA 5G0FA 3M63A 3T6RA 2MNYA 2K4DA 3DQVR 1WEQA 2FUIA 2LGKA 2YQLA 1WEOA 2LN0A 3SHBA 1X4UA 2Y1MA 4GNFA 4CA1A 2KIZA 3PUQA 2KGIA 1Z6UA 2VPBA 5DKAA 4WZ3B 2MD8C 1Z2QA 2ECWA 1WEPA 4FJCA 5KH3A 2MUMA 4QF3A 5G05B 4UP5A 2Y1NA 4YC9A 2E6RA 3MHHA 3O36A 4TKPB 3ZNIA 4GNDA 3U5MA 2VJFA 2ECGA 4AYCB 2YURA 3ZTGA 2C2LA 3N9OA 4LJNA 3SOUA 5LKZA 2LXHC 2IDAA 2L80A 1RMDA 3PURA 5D1LB 1DVPA 2BAYA 4W4UA 1WEVA 2F6NA 1MM3A 1WEUA 4MSXA 2AN6A 2KU3A 3ZVYA 4B86C 2ECVA 2F6JA 2KREA 4YAXA 2CT2A 3KQIA 4GNGA 3ZYQA 5B77A 5D1MB 2LRIC 3MHSA 2CSYA 5JG6A 4Q6FA 2JMDA 3M62A 5G04B 3KV6A 4I7DA 2YT5A 1WFKA 1CHCA 4WA6A 1WGMA 3ZPVE 2RSDA 5H1VA 2E6SA 1VYXA 4AVXA 2YU4A 1LDKC 2QICA 5H1TA 2YUCA 2CKLB 2L75A 3M99A 4AUQB 4CCGX 5LKUA 1VD4A 4YBTA 2KWNA 3O33A 3ZVZB 3DPLR 2ECIA 4WZ2A 2PUYA 4N3WA 5AIUA 2LDRA 3HCUA 3L1ZB 5FB1A 1G25A 4FO9A 4FK5A 4I7CA 1IYMA 2YREA 3LRQA 3GL6A 2EGPA 1FBVA 2YSJA 5TBNA 2KWJA 2VJFB 5DINA 2YSMA 2YQMA 2G45A 2LXPC 4NN2A 5FB0A 5LKTA 3ZPV1 2VNFA 3O35A 4P5OB 3RPGC 3VK6A 4R7EA 5I3LA 4C9ZA 2G6QA 3PHDA 3LQIA 4S3OB 1FP0A 3SOWA 4BHWA 2K16A 1VFYA 4S3OC 4IC2A 2CKLA 2L5UA 3RPGB 1N87A 2H0DB 4V3LC 4V3KC 3QZVA 2OXQC 3HCTA 1T1HA 4LK9A 3V43A 5TDWA 5TRBA 2DX8A 4BBQA 2JMIA 3C6WA 4YADA 1WEMA 2D8SA 2KE1A 5AITA 2KGGA 5TDRA 5C13A 2CSZA 3N9MA 2M1RA 4IC3A 2M85A 3L11A 2YHNA 4GNEA 3N9PA 2QJ0A 4N4FA 5B76A 4O64A 5LKXA 1X4JA 3ASLA 3SOXA 4AP4A 2I50A 3O34A 5H1UA 2LGVA 1U6GB 5D1KB 2UZGA 2QIZA 3GV4A 2VJEA 1JM7B 2KR4A 2ECNA 3KNVA 3N9NA 2YW8A 1HYJA 1X4IA 2KYUA 2YYRA 4A4BA 3NG2A 2MT5A 1K2FA 2EODA 2VPDA 1E4UA 3U5OA 3U5PA 2PNXA 4L7XA 2XEUA 2FSAA 4ZQLA 2LQ6A 1WENA 1WESA 1WE9A 5B8DA 4ZDTA 2JMJA 2K17A 4GB0A 4WZ0A 3O7AA 3IHPA 3LQHA 1MM2A 2VP7A 5KH9A 4L58A 2ECTA 2NAAA 4FIPA 4A49A 3HTKC 3T7LA 4F52B 1XWHA 4A0CD 4LKAA 2H0DA 2KWOA 1JM7A 4A4CA 4QF2A 5EYAF 3N9QA 4X3GA 2M3HA 2EA6A 3U5NA 3O37A 3EB6A 1V87A 2LGLA 5FERA 2HDPA 2MNZA 1WILA 4R8PK 5B79A 1WIMA 5KH7A 1F62A 4XI1A 2VPGA 5B78A 3O70A 3C5KA 2KFTA 2L43A 2M6MA 5LCWB
chains in the Genus database with same CATH superfamily
4DUWA 4RGAA 3H3UA 1G6NA 5FPAA 1DGWA 4QKBA 2DVAA 3H1YA 1YJKA 4AYCA 1LOAA 4GB32 2DVDA 3IKWA 2YPJA 4AI0A 4I7BA 1OOPC 3T1LA 1DLLA 2LV9A 3THDA 2PHFA 1MVQA 4RA0A 3B00A 5DABA 3RQ0A 4H7LA 3D4KA 2ZPXA 1A8DA 2XG3A 4A3XA 1W8OA 1KJLA 4Q0VA 4KWLA 1XXNA 3WDWA 3KDEC 1M4WA 2FMYA 2J22A 4RL7A 5BNPB 3MF9A 1NOVA 4PIXA 4Q4X2 2Z69A 5LA9A 4PTBA 3BCWA 3U10A 2FUUA 2WC2A 2QQIA 2XBO1 3J4UH 4Z1VA 5HBAA 1ZBDB 3MV01 3ZYFA 5T55A 2YZ4A 5JOZA 4DZGA 3WEZA 1Q43A 1S0EA 1V6LA 2YFUA 4ZU4A 3T08A 4AI2A 2G4IA 1WEEA 1WLDA 1B35B 3AZVA 4LK6A 3AL5A 1W6QB 4L0PA 2MD7B 2JDHA 4ZONA 3AYEA 5IVCA 1CWPA 2J1SA 1XNDA 3HNYM 1AX1A 3L2YA 3AKPA 1W8FA 1W99A 3MO4A 3TWIA 2XL7A 2C2VS 2D7FA 4MVTA 1PX4A 2BW8A 2G19A 3VKOA 3WNMA 2OQ6A 2WJSA 3IWZA 3EB5A 2ZETC 1BK0A 4X6RB 4Y3OA 2JKXA 1UKRA 1UYZA 2CHHA 3ZXGA 4BCUA 1ZRDA 2DBNA 1DF0A 1NZIA 5CFCB 2JRJA 5E1RA 5E89A 5KHIA 1RUJ1 3ETQA 1UCXA 3BOWA 2QQJA 4PHZA 3ZIXA 4CDWC 5K3QA 2RDNA 2A6VA 2A6ZA 2VMHA 2BPA2 1BBT1 1WBLA 1FOD1 2GAUA 2VD7A 1RUC2 5KXEA 1DZRA 2UURA 2LUWA 2W47A 4QAWA 4OHZA 4YBSA 2XUMA 2JDZA 3KWVA 4RYDA 5A32A 5JSPA 3FHQA 1ULGA 3NRUA 1AXKA 2EIGA 4RHV3 1C5HA 3MHZA 3O0XA 2W1WA 4YFWA 5BNPA 3J7NA 4MHRA 5IVFA 1JZ7A 5H9MA 1NQJA 4CUCA 2BVBA 2VNGA 3JD71 4M4RA 5D1IA 5DAXA 4P9GA 3V0BA 1W8UA 4XW3A 2YBPA 2P1BA 4UFMA 3HCSA 1R082 1DFQA 2VBBA 3WDTA 1CPMA 4IV3B 5KXCA 1VBB2 2BNMA 1PO22 1ND3B 4QKDA 3RWNA 3KT7A 3NNFA 3VBSC 2ZTNA 3DQVR 4CXWA 2DCYA 1QQP2 2CY6A 1WEOA 2LN0A 2Y6HA 3WDXA 3SHBA 1JOPA 4YM3A 5JXGA 3H50A 4YG6A 2VMCA 1O7FA 4DO0A 3LDBA 4Q0QA 2ZACA 5A3OA 1PGSA 4E8CA 2VZSA 2ZAAA 5A1LA 3S7EA 1EPWA 5FY5A 1EUUA 3WD5A 4BYYA 1CX1A 1QHDA 4P9LA 1WW5A 5JZGB 1JU3A 5DMYA 1F9KA 1MS0A 5JI7A 5I0TA 2WWJA 4M3CB 5FZDA 4ASLA 3H42B 2KGIA 1ACCA 2ADEA 2XQRA 4D94A 1XNAA 1JHNA 1VJ2A 3WVJA 2OPWA 4P9WA 1I3HA 4LULA 1GWLA 1GFF2 1ALYA 2DF7A 3AP4A 5FYIA 1WEPA 1GNYA 1DYKA 1C8NA 2QJVA 4FFFA 3AVRA 5F3EA 3BTXA 5G05B 2VXJA 3WG2A 3DF0A 4UP5A 2DUPA 1NUKA 3LFMA 4IGOA 3MIHA 4AFBA 3KB5A 4ZPIA 5F3GA 1IQDC 2XQXA 4P9JA 2B8MA 5C3PA 4ISRA 4S2DA 4I0WB 5KR7A 1QJZA 1QOTA 4GNDA 1QJY2 2W1QA 2VJFA 3U5MA 2RS31 4OLLA 4G3YC 1W05A 1DQ2A 2HWE3 4JTNA 2OX0A 4XHXA 2HWE1 5DUWA 2WA3A 2VTXA 4IEPA 4AYCB 3MGUA 3POEA 3WZ1A 3FL7A 5A32B 4CEWB 2E33A 1AR63 4OUSA 4PLNA 4UYBA 5J1XA 2WAOA 3QH7A 1QJU3 1PHMA 2W92A 2W08A 4Q29A 4CA9A 3AM2A 3AJZA 4LOSA 3O14A 5LKZA 5A80A 3SEEA 5AC91 4XJWA 2C9KA 4Q4Y1 2VW0A 2V5YA 5FKBA 4BWOA 5FYCA 4DOUA 3VD4A 5E16A 2YGMA 4FPLA 4YW1A 5GZDA 2DCJA 1WEUA 4MSXA 3OPZA 1RVF2 3VD5A 2B9UA 3R05A 3AX4A 1UNBA 2F6JA 2F17A 3HAGA 2D6OX 2PHWA 1GBGA 2KREA 3J8F3 5F3IA 1HQLA 5EQUA 5SV8A 3WQ7A 3U4XA 1ZYBA 1MS1A 2E63A 2VZRA 5SVIB 5CVRA 2H6BA 3MZHA 4PDWA 2WDBA 3M62A 2E7QA 2MEV3 3C7HA 3KV6A 3EO6A 1LCLA 2VCBA 4MOAA 3VBOA 1JYXA 2KKXA 1LOEA 4PF1A 4MGZE 2E6VA 4MUVA 3RVHA 3E5UA 4RQPB 4YZ5A 5CG9A 1W6PA 1QJX3 1URXA 2VQAA 2VZ1A 5LB6A 1S0JA 3ZKUA 3S0MA 2RSDA 5D21A 2HJIA 1VYXA 1OLRA 1XNKA 1ONAA 4P9XA 4AWDA 3N35A 4BQWA 1AYM2 1HRI2 4BMBA 1KGYA 4EZHA 3BTZA 1F2NA 2P5BA 4M3CE 4IDZA 4OMCA 3KT4A 4HMZA 3WSOA 4URAA 2BBVA 1FOD2 2DFCA 1HN1A 2JDNA 2B46X 3GCWA 5H1TA 1BBT3 2W1SA 2ORZA 4GXLA 1X9TA 2L75A 4N53A 3HMYA 4E27A 4AUQB 5C9AA 3VBRB 4Y22B 4LA2A 4Y20B 4CCGX 4UAPA 1XQNA 1FPN2 5FLIA 1DP0A 3BU0A 1XJAA 3N7JA 1MACA 2KWNA 4IGQA 2LS6A 3O33A 5JVVA 3VZJA 4QKNA 4ARYA 1GQHA 2ET7A 2YY1A 1FMD1 2WO7A 3DECA 3EB7A 3LPGA 4BH9A 1ZREA 2PUYA 1J3QA 3PIGA 5AC93 4FTBA 2WA4A 1H1AA 4XBQA 5AIUA 3ZO0B 3AZZA 1JU4A 1S0GA 2Q5TA 4IE6A 4XUPA 2LDRA 1VRH3 1AR81 1RMU3 2CAVA 2ZGOA 1ZZBA 3HCUA 3Q8CA 4ES9A 1MM3A 2XLGA 1QJU1 1O4ZA 4HPKA 1D4VB 3KSCA 1QNWA 4IESA 1FATA 3POYA 1LESA 1XRUA 3MLLA 3UYJA 1BMV1 4I7CA 5JSOA 2J42A 3OF1A 4E8DA 4BJ0A 4JX0A 4W8JA 3T0BA 2IFWA 1N1VA 5DDJ2 4CDQC 4S2FA 2ZMNA 4YVSC 1CPNA 1XYPA 3GL6A 4NIHA 4XURA 4NRQA 5AVPA 1WA6X 5EJ3A 2WN2A 1UIKA 2O8QA 3VDBA 3LEGA 3JU9A 4OYUA 1MVEA 3AXEA 4D69A 1W2TA 2YSJA 1JN2P 3VBOB 1OQEA 4Z07A 2VNVA 4CPBA 4A7ZA 1SFPA 2VJFB 4R8HA 1F35A 1JHJA 4WZCA 4LEJA 3WF1A 3H8OA 3OSDA 5FYTA 3DPRB 5FY8A 5JWPA 3I97A 3CZUA 1R092 1VBC1 5FO8B 3M3QA 3ZN6A 5C3QA 3LB9A 2RS12 3NVCA 2D8UA 3UNPA 3H9AA 2W52A 3ZSKA 2VNFA 3SQOA 3ZYBA 3HEIA 4AQ6A 5LK7B 3B93A 2CTVA 5FUNA 5FYHA 5IFTA 3VKMA 5F32A 3O47A 2BNOA 3JD72 4Q2FA 3VK6A 3I7DA 4LJHA 3VB9A 2RDRA 5BYNA 3WOGA 1REEA 2QE3A 3PHDA 3EQEA 4TTGA 2IQJA 3AP5A 3GM8A 3SH4A 4D6QA 3VKLA 4S3OB 4PF5A 1N1SA 1HJGA 1QQP1 3SOWA 1AJKA 3SH3A 4YW5A 5FZ8A 1O6UA 1NYWA 2JXAA 2P6CA 1VFYA 1GUIA 3MUZ1 4EWDA 1BBT2 5A1AA 3IDBB 3RZJA 2VCMA 2PQQA 1H8TB 5EYYA 4OUMA 4UXAA 5IWFA 5FPVA 4CCDA 4P9IA 3RPGB 3IPVB 5GALA 1OUSA 2D6NA 3AZXA 2H0DB 4V3KC 4QXCA 1MQTC 1Y43B 3C2UA 1DGLA 4RHV1 2WT2A 1W0PA 3ES1A 5JXIA 1AXZA 1QEXA 4LBOA 3HCTA 2YV8A 5TSWA 2ZKNA 3GZTB 4G4FA 5JMOA 4UFHA 5FREA 3V43A 3P3PA 1D2SA 1MS3A 3VBHA 1W2UA 3AP6A 4HLTA 4IEWA 5K4LA 1FOD3 5TRBA 3OBTA 4UWDA 3T1MA 4BBQA 1CD3G 1RUD3 4K20A 5I91A 2ZHLA 2WNVC 5IAVA 3TEZA 1RUJ3 1CZVA 4FP3A 2XOZA 4JGZA 2ZGNA 2CGPA 2GNDA 3ACGA 2D8SA 5A33A 1RUF2 2W94A 4DY3A 2KXLA 3MYXA 4QXKA 5IK8A 4FOVA 3POBA 2WNOA 4KG8A 1KD7A 3F95A 5TDRA 5C13A 1SDDB 5LEKA 1GYKA 4JQTA 4HKLA 1JUHA 3IBMA 5FZCA 1H2MA 3M1HA 5B2GB 2HBTA 4FPEA 4Y4RA 2M1RA 2AEYA 2X10A 1HJFA 2JG8C 4MLOA 2LM3A 2YG0A 1GKBA 1KDMA 1UWWA 1Q8OA 4B7KA 3L11A 4R9BA 5F6LB 3D6EA 4N53B 2X8KA 3ZYHA 3OGJA 5CZKA 1IKPA 2C6SA 4LHSA 4P08A 5A7WB 4CDUB 4YWAA 5J36A 3HT2A 3OYWB 3N9PA 3R6SA 3RMXA 2L7PA 2QQUA 1SBFA 3OYWA 4XIKA 3UT0A 4IE0A 2FDIA 1K5JA 1SACA 4UF0A 4XTMA 5BPXA 2SBAA 5B76A 3D0SA 1O91A 2BUKA 2R043 2IWGB 4XJ9A 2JIGA 5KHGA 1REFA 2QQNA 5C6CA 2I74A 4KNCA 5LBFA 1GOHA 1V6MA 1VP6A 1DQ0A 1ULEA 2A3WA 4L99A 4GJZA 4NMIA 4XXAA 5H1UA 3ZOIA 2WIIB 3I2HA 2H0BA 5D1KB 2ZEWA 5GZEA 1MS8A 4YVWA 2J1EA 2WLPA 4WM8C 3BU7A 4OQ8A 3APBA 5EPAA 1H4HA 1LU2A 4HN1A 2CONA 4K8RB 4MHUA 5LCWL 5J98B 2VJEA 2HWE2 3LF7A 2KR4A 2Y6LA 2BFUS 2ZBJA 2ZKLA 3UESA 3KNVA 3FX3A 2DV9A 4Q4W3 4B4QA 2IXHA 3V0AB 4MGTA 2YW8A 3GJAA 3K46A 3H7HA 3FUQA 4QQOA 2Z5WA 1Q8QA 1RUI3 5C3SA 4EZ4A 2HWF3 1D0GA 1MS4A 2GMEA 4W6XA 5F2WA 1CJDA 1KS5A 2PELA 1J84A 1LODA 3AZYA 3UJOA 2PXJA 3NG2A 1NA1A 2ZABA 2D5FA 4OI1A 1K2FA 2B9VA 4CDWA 4A4BA 2VECA 4IV1B 3ZPOA 2WT0A 1W6MA 1PZ8A 3PL0A 4XHBA 3WQ0A 3U5PA 5BNNC 2WABA 4XYXA 2NZ9A 4RS5B 4CDUA 1OH3A 5BY5A 4FAGA 3POSA 4H55A 2ZEYA 2B45X 4GWMA 1WW7A 1RUI2 2GC2A 3PTRB 3WDYA 5LA1A 2CL2A 1UZYA 2UWAA 4JDOA 2EF6A 4FOWA 1HDKA 3AC0A 4DPNA 3O0VA 4Z8BA 4YARA 1KXGA 1PK6B 3VBRA 2CYFA 4AZZA 2HWC1 2X29A 2JG9B 3URFA 1DQ6A 3PMSA 3T2QA 4BIOA 3SC7X 1VBB3 2X05A 4IE4A 4HOOA 3VGIA 1NCRB 1OA3A 1W8WA 2PHXA 2ZGRA 2X09A 4CCNA 1X82A 3KMHA 1EAH2 3IAQA 4J6GA 4Q4V1 3VBHB 2ECTA 3WF0A 2QQWA 3K3NA 1C8M2 3OGSA 1R081 4R9DA 2RS13 2BOIA 4CDUC 4EE2A 4M01A 1F5FA 3U07A 1GLHA 4E4HA 1GV9A 2EXHA 4CCKA 5C4WB 3QD6A 3HTKC 3VBUB 5L7OA 1QH6A 2YHJA 2XVGA 4KGGA 4F52B 4LKAA 4V2WA 2H0DA 5JPMB 2RM21 4PQ9A 2G9GA 1W2OA 1R083 3KV9A 2X5IA 3FJSA 2VMDA 1PZ9A 1JM7A 4Q4V3 4NIAA 2X5IB 4YW2A 1RIRA 3NJYA 2ZX3A 2GC0A 1NG0A 3BIEA 3AMNA 2H6CA 3NNJA 3POWA 2B42B 2RG4A 1CX4A 1A8MA 2WNVB 2BWAA 5DAQA 1CAVA 3TN93 3LVRE 3ZSEA 3CEWA 3GBGA 1W9YA 2BU9A 4KG0A 1OF4A 1AJOA 1TVGA 2P3IA 3ZFGB 3N7LA 1RUC3 3JUUA 5A3WA 4Y5Z0 5KXDA 2QQKA 2MNZA 4XF0A 1DHKB 1ZZCA 3AVSA 2D3PA 2YGLA 2ZXQA 3WNLA 1YEWA 2OUHA 1IS4A 1S0IA 3KVAA 2WS92 4K7JA 2CGOA 4ASMB 4LIUA 1F62A 1E57A 1YIPA 2Q1ZB 3ACIA 1WKYA 3J7MA 2P3KA 4HONA 5F5QA 2V72A 3M4FA 4CCLA 4PDWC 1H6YA 3C5KA 5FYYA 4P9YA 4Y1VA 1V6IA 5F5AA 4RR3C 1L7QA 4XUOA 2CGNA 1B35A 2L43A 4UFIA 1HQNA 1NAEA 2M6MA 3E6CC 1F4HA 1KFUL 4M00A 2VQTA 4CP0A 3VBUA 4BIFA 1VE0A 4FPKA 5IVVA 1PO11 3C8XA 3IDCB 5L7OB 1DCQA 4PI2A 5IVYA 2XB1A 5LCWB 4AVTA 2A6WA 1YWKA 2WO2A 4JHZA 1DZTA 2W5FA 4LHNA 3S6PA 3OPTA 1HB1A 3ZIWA 4DMIA 2A73B 5JI9A 3ALQA 4JDMA 2KWKA 3POIA 5CFCA 2R061 1QJEA 3VKNA 1PVC2 4LNVA 2PHUA 4F8AA 4DUVA 3V0BB 5FEYA 5B75A 2AEZA 5F37A 1QNYA 5B4XA 4I3PA 1LOFC 2VOTA 2XL9A 4J25A 4LLOA 3E6DA 4XQWA 1Z7S2 2R041 3UGGA 2HLEA 4N43B 1YFXA 2V4AA 1SCRA 1UOBA 1PO21 2OQ7A 2ENRA 1OFNA 1Y9QA 3EMRA 4NUBA 2HEVF 1NE6A 2MIQA 2D5HA 3AKRA 4W65A 1DDLA 2VH9A 3HNMA 4M0NA 3NV4A 3P5BA 2ZJCA 4M0HA 4OULA 4F1PA 4R2YA 1QU0A 5A6QA 2RI7A 4DRVA 1FNZA 2G43A 3QOPA 4UF0B 4UI9B 4YM1A 1YFWA 3VZKA 3ZFGA 3N9LA 3A0NA 5DXDA 4LADB 4OUEA 5BNOB 1RVF3 3U1XA 5FZIA 1A6CA 3WP6A 3I49A 1V9U3 1YQ8A 2JDKA 3W20A 3KVBA 3TAYA 1W6NB 1H30A 3EXUA 3VDDB 1G8WA 1WEWA 1I9RA 1R1A2 2LGGA 4YATA 2KR2A 4BM8A 1HRV3 2DU0A 1VRBA 3NMBA 2ARAA 1RUD1 2BBAA 1YYNA 1H9WA 1VMFA 2VPEA 2XJPA 5FPZA 4NN0A 4Q5OA 2FHRA 4YLZA 3O12A 4JTOA 1YFUA 1Q8SA 5FMDA 4AI1A 3MBWA 2BZDA 4EN6B 1US3A 3PLQA 2VJEB 4XCBA 3MW2A 3WLUA 3TBDA 4AHZA 4EV0A 4Z2WA 5IVBA 1JYNA 1RUNA 1I6XA 2TUNA 2OWAA 4GKYA 2MPFA 5JG6A 3GNEA 5FZ4A 3LQJA 1RUD2 4XE9A 1ZBE3 4I0BA 1K5MC 4ZZ8A 4UW6A 1I1EA 2OPKA 4D3WA 2E53A 5JPNB 1NT0A 2WQZC 4O65A 1GOFA 2ZCWA 3T6RA 3BKZA 4Q0UA 5HCAA 5I8TA 1Y9MA 3UGHA 2QQPA 4LBKA 1MR5A 1WEQA 1ENRA 1ULCA 2PLV1 3ENRA 3O1PA 2FDHA 1KITA 4G9SB 4KGQA 1ODNA 1C5IA 1QWRA 3HPNA 1AYN2 5DAPA 3ZMNA 1X4UA 1YCIA 3NAPA 4YVSA 3CNAA 1STMA 2BNNA 5I0SA 3RI9A 2B0OE 2YBKA 3Q1DA 5EJ1B 2P17A 1UY4A 4HVOA 4QX2A 2JDPA 1NX9A 1TQ5A 3ZXEA 1LGCA 3OGGA 3HNBM 1H1MA 1UZWA 2GP3A 3PIJA 4RR3B 2PYTA 4C0HA 2GP5A 3HT1A 3VZLA 3FMGA 3C7FA 2VPBA 1W28A 3LDYA 5GLWA 3FEHA 3PVNA 3SCFA 1IG3A 1LHNA 1PIV3 3FANA 1Z2QA 4A6SA 4Y22A 3MUY1 1JTZX 5DZEA 2JM3A 3MIDA 1J3PA 3FLPA 1W03A 5KH3A 3IN9A 5FP3A 4A7YA 3FN9A 5IK4A 1HXS2 1AR71 1IOAA 1UY0A 1YC61 1SLLA 4YC9A 3IPVA 4I2OA 3ZYPA 3O36A 4COZA 3ZNIA 4N8MA 2ZHMA 5F7UA 3V0AA 1UZZA 2XLAA 4O9EA 3M70A 3QLQA 1AL23 1VBE3 2RHPA 3RZHA 4ITCA 2G9ZA 2QQMA 1VBD2 1W9TA 3T4HB 1GU3A 5LRSA 1GNZA 4AI9A 3HOBA 4URTA 1FX5A 1LHOA 2RV9A 1LAJA 1ULOA 3I54A 5GZCA 3ELNA 2LALA 4QU2A 2NMNA 3WCRA 3OOXA 1RMU1 1AR83 2B39A 4J1WA 4LJNA 3VBUC 3O1UA 3SOUA 1DGRA 1JOJA 3Q8BA 5C4WC 1OOPA 2IDAA 3MW3A 3PURA 1VBD1 2L80A 4JGYA 2D3RA 1UY1A 3FBYA 4KL1A 4MV2A 1FMD3 3ZFEA 1ULDA 3ILNA 4H3WA 5F39A 2BAYA 4R52A 4W4UA 4HK9A 5FZ3A 2F6NA 2W1UA 4XDQA 1QF3A 4ORFA 2VVFA 2ID4A 5FBZA 4YZ3A 3ZVYA 5FOJB 1V0AA 3B5LB 3AFGA 2AACA 2ECVA 2HYXA 1MEC1 1LOCA 2OW4A 2CT2A 1TME1 2JJ6A 5L9BA 3KQIA 4GNGA 2D40A 3ZYQA 1BVP1 2R0HA 3HN3A 3M7AA 4QDQA 1EV11 3FHIB 4WVZA 4FSJA 4FPJA 5D1MB 3MHSA 3BYWA 3HJRA 1SQ4A 4IETA 3IIAA 4BISA 1F15A 2HWB1 1DYPA 2XHNA 3ETPA 3NV3A 1S0CA 4META 5G04B 3WNXA 5FZ0A 2XPJA 3ABZA 1DG6A 1XU1A 4XTPA 1Y3TA 4XPVA 4FPCA 1WCUA 3S5AA 4WA6A 2BFUL 3GBFA 4CUAA 3PVBB 1BXHA 4FFGA 2VGDA 4NPLA 4QM8A 5BNNB 1QOSA 1QJX1 2XJTA 3INAA 4LBMA 4BK4A 1PGL1 3I4IA 1WA4A 2JD9A 4E4SA 2E6SA 5D8AC 1D4M2 2G1MA 5FIXA 1BEV1 3ZXFA 1XU2A 5ACA2 5FWJA 1XB9A 4UOJA 1VBA1 1J1LA 2ARBA 3LFIA 1XYNA 4AGGA 5A3TA 5K7PA 2FDGA 1W8TA 4IV3C 1QXRA 2MEV1 3J7LA 3PU3A 4BQXA 4AVXA 2YU4A 1LDKC 3NV2A 2QICA 1W2NA 5GKAC 4P14A 2NLRA 3TN92 3A21A 4NWVA 4JKLA 1OD5A 2CKLB 3PUAA 3M99A 4CEYC 2VZQA 3ZN5A 1TME2 2IXCA 2JE8A 1OHFA 2GDFA 4RR3A 1QIQA 4WM8B 4UW3A 3RI8A 1RC6A 4YBTA 4WM8A 1G7YA 2FQPA 1JZ3A 2XVLA 4YM2A 3I3DA 3ZXDA 1VBE2 1JYIA 3DPLR 2ECIA 4WZ2A 1KFXL 3K4ZA 4N3WA 1VB4A 2Y6FA 3WW3A 4YVWC 1U5XA 1ULPA 1Z0HA 3J26N 4B4RA 4B8EA 1AF9A 2VZPA 2J1VA 4NOTA 3T30A 2LAUA 2Z79A 4PLMA 4CYDA 3I3EA 3PDQA 1LJ7A 3MIGA 4LUMA 4JCKA 3HR9A 4FXKB 4COUA 1ULFA 3K77A 4Q26A 3WUDA 3OBZA 5A3PA 5GLVA 2FBEA 4E9KA 3MIEA 3PUIA 4N53C 1W6OB 1ZA7A 1Z7S1 2DCTA 2R042 4IV3A 1JXNA 4Y5SA 3SKJE 4RN5A 2YREA 1IYMA 2ORXA 2UY8A 4HXCA 3BPSA 1X8MA 3LRQA 2EVXA 1UPIA 5HCBA 1U0AA 2QDRA 4NHYA 3M8LA 2VTFA 3WP4A 4EWEA 4MSVA 4NVPA 5FYSA 3GALA 4F7ZA 5FTTC 1CN1A 5LW9A 1FI2A 3PJQA 1AR62 3PNAA 2QZ3A 1FBVA 1HXS1 5FZMA 1GZTA 1W9FA 5JXHA 1XPWA 2KWJA 5BNPC 3MICA 4V2VA 4YW3A 2YVRA 5HCFA 4K40A 5JMCA 2YBSA 4EQVA 4ZY9A 2R32A 3K2OA 3TEXA 2YQMA 2VZ3A 2LXPC 4SBVA 2WFF3 5LKTA 2GALA 3WNPA 1K45A 4YBMA 3ZPV1 1OXCA 2ETEA 4MH0E 4LITA 3I59B 2XWJB 5FY0A 4YW4A 4O7XA 3GBWA 4IXLA 3RPGC 3GHMA 5FYZA 4R7EA 1COV3 1E5HA 2P34A 1OPMA 5FK8A 5C8CA 1YLLA 2LW8A 4N9HA 5JIUA 1C1FA 2EXJA 1S2BA 1XE8A 3LQIA 1X9PA 4I09A 2DYCA 1F5JA 5J3UA 1J59A 1JBCA 1ND2A 2VMFA 3JQXA 2NMOA 5I93A 3CQOA 4S3OC 1OPOA 1OFSA 4QB1A 4DY5A 1ZRFA 4OZXA 4Y1YA 1H2LA 2J1RA 2Q4SA 2QBXA 3ACHA 3BI3A 3M3CA 3JD73 3LZZA 2ZS6B 4BE3A 1N87A 1AUYA 4LORA 5FUPA 1RXFA 4AVCA 1VB2A 4I30A 1HYIA 5I8YA 2JKBA 2FCUA 1ZM1A 3MIFA 3W21A 5FV3A 4PIYA 5H9PA 3WDVA 4LK9A 3IIIA 2WNUC 4LT5A 3VDAA 1BEV2 1TG7A 4NHLA 1UOJA 3WNNA 1IHMA 1NXMA 3RJ2X 5H9SA 1MS9A 2P2KA 2JMIA 2VPVA 2VUDA 4YADA 3NQHA 4QKFA 2WSVA 3RZKA 2ET1A 4L9BA 1GWMA 4XFAA 1JS9A 5A1FA 4YVWB 3VBOC 2G9FA 3DYOA 4IEXA 1H8TA 2AGSA 5IFPA 2Z42A 4QPIA 1NCQC 2CSZA 3H7YA 5FZGA 3N7KA 1IGOA 5SVIA 4AXOA 1NLRA 4YVSB 3OBAA 2A5ZA 3DGTA 5D8AA 5GZFA 2EXUA 4LO6B 5F6KA 3KHCA 1U5YA 2HBUA 2P37A 4NIIA 1FNYA 1OBNA 1YQ5A 3CDZB 4KMQA 4AYUA 4CEYB 5A3NA 2YHNA 3LVQE 1NQDA 4XEZA 5DZFA 2FD4A 4U2AA 2F6BA 2QJ0A 1OH4A 1ZBA2 2D97A 1LRHA 2JE9A 3BB6A 5FK7A 2ZHNA 5FPBA 1RUOA 5A7WA 5FZLA 5FDBA 4NR1A 2V73A 5L73A 3BIWE 1R091 5CKMA 3HQXA 5F9TA 1SLBA 5SV5A 1X4JA 1W6QA 1BK1A 2ZGMA 5D8AB 3SCGA 4AP4A 2I50A 1PO12 3A22A 1R1ZA 1JMUB 2Q0AA 4B4PA 1J58A 1US2A 3U11A 4D8MA 3DEMA 2NM1A 2WKKA 3ILRA 4WM7B 5FLJA 5FYVA 5GJ6A 3JXSA 1PVC1 1FPN3 3UK9A 2R062 4Y20A 2UZGA 3BTYA 4XACA 2RJ2A 3VBRC 4I02A 3GV4A 1JM7B 3I8TA 1SFNA 2QQLA 3ZXJA 2J1AA 3TB0A 2ECNA 2R16A 4AK3A 2Y33A 2VE1A 1LGBA 5DG2A 3WUCA 2ZAHA 1NE4A 1UY3A 2QDNA 3CF6E 5E88A 4QPYA 2WFF2 1X4IA 2OKXA 5ABJC 3HN1A 4DEVA 2VBDA 3AKQA 4XFFA 4AFDA 3I2GA 3VDDA 4HBNA 4CU7A 2JICA 1Q8VA 3RGBA 2XMLA 3U5OA 2EIBA 2PNXA 2ZMKA 3I2KA 2YB7A 1PNGA 4Y1XA 1BLZA 3ECQA 2WUHA 1POV3 2D44A 2MEV2 1OT5A 1H2KA 2FSAA 2LQ6A 1O5LA 3I2FA 1WESA 1WE9A 2VC9A 1SDWA 3ZVXA 3EBRA 3SMHA 1DCSA 3T2PA 1QOOA 4Q8KA 1POV0 2EAAA 1KQRA 2JMJA 4ZDTA 3J8F2 1UAIA 2GH8A 5CB7A 4HANA 4OI2A 1WLTA 3R4SA 1HRV2 3AMHA 2XVKA 4XFCA 2D93A 3TNPB 3TRSB 4O9GA 1AYN1 3ES4A 3OGVA 2ZGLA 2EAKA 4DFSA 2RR4A 3IHPA 2JUNA 1UZ0A 1DIWA 4LBLA 2ARXA 5CA6A 1RL3A 5FYUA 1EAH3 5IW0A 3MPBA 3VBSA 1F31A 2DCKA 5BV6A 2OXBA 1UF2C 4NHKA 2XKPA 4FIPA 1RUF1 1V6OA 5FQ0B 1AR91 1MBMA 2GH2A 1OD3A 5T52A 2RS51 3PLWA 4CUGA 3T7LA 2CDPA 4LBJA 1XWHA 4K6BA 5FAXA 4A0CD 1S4CA 1QY4A 2WZPP 4QB2A 4IE5A 2GNBA 2KWOA 2BRTA 3ON7A 4WM7A 5T54A 1RGSA 2A75A 4QPWA 5FZBA 5CEHA 5FZ9A 2WZ8A 4P5YA 5EYAF 4C91A 2PN5A 4RHV2 3N9QA 2IXKA 5GLUA 5T5JA 4X3GA 3RNSA 2EXKA 2HYKA 2VZTA 2W91A 3I3BA 2HWD1 1REDA 3WINE 3WW4A 4DXTA 5H9QA 1W0NA 1O4YA 3B3QE 4KBZA 5KHJA 5FO9B 4AOCA 4HL0A 2D43A 3V64A 2WBKA 3P6BA 3O37A 4GNEA 2BVVA 4QWNA 4XJ8A 1DU3D 1D4M3 3KGZA 5ACA3 3QCWA 5F1RA 2BOJA 4XJAA 3CU7A 3RZMA 2VL4A 3MF6A 1WILA 3KD4A 1LU1A 3DL3A 3ZFFC 1GP6A 4AF9A 4Q4W2 5DPNA 2GZWA 3THTA 3JCIA 3ZSMA 4Q4Y2 5HCHA 2FCVA 2A6YA 3ZYJB 5AC92 3O70A 1COV1 4FOQA 4GB33 1UYPA 1UIJA 3VHRA 2KFTA 2EXIA 2BP6A 5GLZA 3A0KA 1XBFA 5JZGA 4Y33A 1C4RA 1Y9GA 3IAPA 1VBC2 2Y6JA 4JZRA 2P4EA 4LR4A 4WM7C 2ADDA 5FMOS 4CE8A 4RFT0 1OI6A 4ARXA 1HV1A 4QXBA 5FZOB 4UP0A 5J7MA 4O61A 1NLQA 4CU6A 3K48A 2L0BA 1AVBA 5FJKA 4HT1T 1UMHA 4IEYA 4FTEA 2PQSA 3VBSB 2RJLA 1K42A 5J3XA 3L1XA 1HV0A 5CKQA 4K21A 4QGMA 2MA6A 4FPOB 4D7YA 4AAXA 1SLIA 3FLTA 4NAMA 4RQPA 3BGAA 3IZOA 1W9WA 5FPXA 1MZEA 4ZXKA 5TABA 1VMHA 4NJ4A 5H9RA 3RYPA 5A3LA 1CIYA 2RR12 3LEMA 1BKZA 1UQXA 3FL2A 3IB3A 1Z7S3 2CRWA 3S57A 2OUJA 4BQYA 3NJXA 3FAOA 1YFYA 2PTMA 1W04A 5CYYA 1ZA4A 2EALA 4XJUA 3MIBA 2IVIB 4ZUXU 1PM4A 1HIXA 3NNLA 4SLIA 4QHZA 4D6RA 2HEYF 1AR82 1A78A 4AVBA 1ZNPA 4CDWB 4OHWA 4QD2A 5IUQA 2XJSA 1QJY3 1UMZA 2XH6A 1N3QA 3LDRA 3SH5A 5C9AB 4NAOA 2Q8CA 2YC4A 5CFCC 1RUG3 2DVGA 3VL8A 4W6YA 2K1JA 4YW6A 3PMEA 4F83A 4Z0OA 3ZN6B 2AYHA 2R072 2OZ6A 4XAEA 5LBEA 3I59A 1PM7A 2HWF2 4LOTA 3VZNA 4Z92B 1LDJB 5C11A 2DSMA 3E5QA 1X50A 1L3JA 3WV6A 2YPDA 3AMQA 4FCAA 4A4AA 2RMU2 5JR7B 3MI8A 1B35C 4AEJA 4PPEA 3IM0A 4GD4A 3RZZA 1JOCA 5FFOC 3VN4A 2C26A 2VR4A 3LPFA 2PAEA 5EIYB 3KV5A 4KWJA 1NCQA 2BWCA 3O7OA 1AX2A 1JUIA 2E7TA 3OD0A 4LBQA 3PJYA 5KC6A 1GANA 4QQPA 2VTXJ 3WF3A 2WS93 4FPFA 3DXTA 3M3OA 4HETA 2F42A 1OURA 2ZX1A 4WV8A 4D0QA 1PGW1 3BOPA 2ZGPA 2B4KA 4AFAA 3L9JT 1J3RA 4NROA 1RUH3 1C3HA 5CBLA 2WL1A 2ERFA 2WWSA 1LHVA 2W95A 3FWEA 5A7OA 3M63A 4XVHA 5HXMA 4BDVB 4P00B 2XKOA 4JKMA 3S30A 4EN7B 2F4PA 2AREA 1LKNA 3POFA 2YQLA 1JOBA 2BDRA 2JWPA 3CLPA 1ASJ1 4KU7A 3C3VA 3ACLA 1TNRA 3RG0A 3LGRA 4E2QA 2EGMA 4AGRA 5APAA 1CAVB 4BZ4A 1TME3 4QPGA 1ZBA3 4XF1A 2O14A 5ISLA 4GNFA 4CTEA 2BGOA 3BVCA 5A6XA 3OUJA 2YYOA 3UJQA 4QHBA 2XJQA 4KI5M 2XR4A 1Z6UA 2HEWF 5FY1A 4I0AA 3T3YA 1GZWB 4YZ2A 4CU8A 1OA4A 4W50A 4BB3A 3OTFA 4B1LA 5HI0A 4CDXC 2OVUA 4WZ3B 3LSEA 4Q4X1 2RR13 3SCHA 2FFWA 1OLMA 1UW8A 1VBD3 3S7IA 4IUGA 3D0JA 2DUQA 5LASA 3B7MA 4QXHA 4BHPA 2MUMA 5EYXA 5CFDA 1GMMA 3T09A 2IFRA 3FFQA 4EYUA 3WY6A 2ZHKA 3U4SA 4LTAA 2JX9A 1HB4A 2K9ZA 2AENA 1X7NA 4AHYA 2Y1NA 1WCDJ 4LE4A 3VBHC 2E6RA 4TKPB 1UO9A 2UYAA 4GMP1 1KS4A 4U36A 4WZFA 1BQPA 2ZMLA 3R4DB 4AEDB 4D6SA 1DGWX 1YJLA 3HVDA 1DLCA 4IEVA 2JG9C 3ZSJA 4AVAA 1SBDA 5FMOL 1PK6C 3B9CA 2Y6GA 2R49A 4OHXA 3VZMA 3J7HA 2VM9A 3WHTA 3ZM8A 4AQSA 5FXZA 1TZOA 3CHXA 4H9DA 1T6BX 1WZXA 1LEDA 1QGLA 1WMFA 3ITQA 4E2GA 2IUWA 2NPIA 3FLRA 3JB8A 3LKJA 4GWJA 2QQVA 1QJU2 2PAMA 5EFUA 2YMZA 1NKGA 2RDSA 2VAUA 1COV2 4CPBD 1CONA 2LXHC 2C24A 2W9XA 5D1LB 1T6GC 1YRZA 4OFGA 3ZR6A 4YSFA 3VD9A 4A3ZA 3VZOA 4D7TA 1DVPA 1FMD2 3OUHA 2YROA 5CIRA 1WEVA 5IK5A 4BLIA 3KZ4C 3DUIA 3LEIA 4KBBA 4UW4A 3RYKA 5K9YA 1EPZA 1S0DA 2E26A 2AN6A 1UU4A 2FZ1A 3T4VA 1E5RA 3X29B 4B86C 1IPKA 3CJXA 4V1PA 1SLAA 1H0BA 4OQ9A 3MLJA 5LY2A 3VUOA 2A71A 4BLJA 5JSRA 3T9KA 5B77A 2WT1A 3UV9A 3H8UA 2WNUA 3WT3A 2CSYA 3CO2A 4AQTA 1C8M1 4NO4A 5FRAA 2JMDA 2E7AA 4JQRA 5FYMA 4Q4V2 2RVAA 4YGBA 2WZR1 2WNVA 1VMJA 3AFKA 4YGCA 5A7PA 4K1YA 3SHRA 2YT5A 1WFKA 1OSGA 2UYBA 4C1WA 4CP9B 1CHCA 1GSLA 1D0HA 4LE3A 5FY4A 5FYBA 4JC1A 1G86A 3MDBC 1LOBA 1SHWB 2R30A 2FZ2A 1WMXA 2M13A 5FMCA 3NJZA 1C57A 2VO5A 1DZQA 3GXUA 1HX6A 5H1VA 1VAMA 5LA2A 1SG3A 4A44A 5A70A 1ASJ2 1I5ZA 3JQWA 4QB6A 4DXRA 5ABJA 4FTSA 2W0XA 3GDBA 4FI9A 4JRAA 3U75A 3U0ZA 1OQDA 2WZR3 3KCXA 3N4MA 2ECWA 2WZR2 2ZGQA 5FY7A 3NSTA 2P6HA 4K3UA 4MGQA 2CSGA 5C5TA 2Q1FA 1WLCA 4XDOA 5EZWA 2YUCA 3THCA 5DUXA 2N7GA 4YG0A 4BPZA 5ANQA 4TXWA 3NJVA 1HRV1 4XAAA 5I0UA 3NWKA 4AFMA 5LKUA 5M0TA 2AC1A 4P02B 5E8AA 1RVF1 3PTYA 5DAVA 5JAXA 4XBLA 2R1BA 4Y4YA 2BERA 4HKOA 3IDAA 2OZJA 4LBNA 4NE9A 5IVEA 4XMIA 1YUDA 1XE7A 3H3ZA 1QJY1 3Q9OA 1HB3A 1OVPA 4ET7A 2FDKA 1OQ1A 1W9SA 4PT6A 4CCJA 2DTWA 1RUJ2 5A3MA 2K0GA 3UL2A 5GLTA 2WSUA 1BZWA 4QGNA 2XBO2 4FK5A 3AP9A 5FUIA 5C7GA 4GMP0 3KQ4B 1ENSA 2ZZQA 4LO8A 5LWBA 1VALA 1V00A 4X8NA 2YDEA 2VVEA 5FZAA 3DPRA 2VQUA 5LRRA 1ND2C 1WCQA 4GMP3 4ZU7A 3FFZA 2WRAA 2VVDA 1N1YA 4GAZA 4DIQA 1CAXA 4EWAA 2R063 5F8PA 1J1TA 4KQ7A 2E9QA 2DDUA 1QMJA 2XLFA 4XBNA 5IATA 1KRIA 1AL0G 1LECA 4O62A 2RR11 4Q4X3 3RRDA 3VBFB 1TMF3 3CBNA 3WXPA 3BUCA 1YQCA 2DVFA 1X36A 4B29A 2YSMA 5DINA 1QKQA 4CCEA 4COVA 2G45A 5FZ7A 1PO13 1U5ZA 2GNTA 3O1SA 1CZSA 2PHLA 1M06G 2OA2A 3R4UA 5L36A 1AHSA 2DU1A 1WD4A 5FQ0A 1WMDA 2VXRA 3ZFFA 3O35A 1ZBA1 2VOVA 4P5OB 4HVQA 2QCSB 2V5DA 5A7NA 4GB31 5JCTA 5I3LA 1UXZA 1K5MB 1MZFA 3VL9A 4ATEA 1VAVA 2G6QA 3I2OA 2CU5A 4MADA 3VBFA 3SNMA 1YO8A 5G04L 3ROUA 4QPGC 1RYYA 4PBPA 1EYBA 1V6NA 1RUC1 2K16A 4IC2A 4Q27A 2GC1A 2RMU1 3HWJA 1IPJA 4XMAA 3OG2A 5T5PA 2L5UA 3WF4A 4CDQB 3M3IA 3PVOA 1HKDA 5DUUA 1SZBA 4Q6FA 2CWMA 4JGZB 5I8SA 3WQ1A 3VDDC 3HBZA 4YRDA 2OXQC 4NHMA 3FBMA 5BNQA 1JW6A 3RJRA 5C33A 1ENXA 2TBVA 3TNQA 4FPYA 5DN2A 3MFCA 4QQLA 5BNOC 3PU8A 2C0ZA 3SISA 5TDWA 1CAUB 3ILFA 2JEMA 2DX8A 2Y0OA 1UL9A 2RE9A 2HKXA 3OJBA 2BGCA 2W87A 3DYPA 4AR2A 3ZKYA 1SLCA 1WEMA 2XOYA 5T5LA 4XQ4A 1RUH2 4NHXA 3FHAA 2Y6KA 4W4ZA 4MGYE 1JH5A 5AITA 1S1AA 4XC9A 1H4GA 4DNYA 1RUF3 3IMNA 1UU6A 2RS11 4K9SA 2R071 3NKGA 2VW1A 5HPOA 4M4PA 4QQHA 2ZGSA 1RUG1 2A7AA 3VKFC 4TLFA 4CDXA 1JI6A 4FBFA 4IC3A 1J83A 4N43C 2XB6C 2HWC3 1UX7A 1AYN3 1EP0A 2NQYA 2Y38A 1W6NA 4EJRA 3JUEA 4FOYA 1HW5A 2RS52 1WLWA 5AVAA 5K0UC 4BXSV 5FZ1A 1XSRA 1O3QA 2PAKA 1BCXA 4YFZA 3IT8A 3Q8EA 4PJYA 3O1MA 4LKFA 2JB8A 5A6ZA 4OGCA 5IAXA 3EYPA 1POQA 4R9AA 3POGA 3JBG3 1Y4WA 3HQRA 1POV1 2MHFA 4QGLA 1OA2A 3ASLA 1B09A 1RJ7A 1QJFA 3A23A 3NAPC 1CIWA 1JZ6A 2YURA 4RQPC 1WCKA 1CAXB 4RGGA 1ZZ8A 4TSVA 4QX0A 3WNKA 1P8JA 3F2ZA 1U6GB 3C7OA 5L7OC 2BYVE 3A7QA 2LGVA 1S2KA 2W39A 4Y26A 5C5UA 5LBBA 5JXJA 2VUJA 3WW2A 4AVSA 2W3JA 4BU2A 2A1XA 3TEYA 2BQPA 2PMWB 3G7DA 1ZZ6A 2XOMA 4PDWB 1W6OA 4Q4W1 1AL22 3RZLA 5KWRA 1D7PM 3GF6A 4Q0PA 1LULA 1FAYA 1HYJA 4UFLA 4JHTA 2WYFA 2JDMA 1CQ9A 1OC1A 1W8HA 4EN9B 3RFRA 1FPN1 5BUVA 4XJZA 2KYUA 5KHHA 4ES8A 3CKHA 2W68A 3ZFGC 2EODA 2VPDA 1E4UA 2R7EB 4GALA 4LLFA 3LDKA 3GZUC 3THPA 3H7JA 2GNMA 4OMDA 1UD1A 3E1F1 3K51A 1XOYA 3NW4A 4TLGA 1KDKA 1VIWB 2XEUA 2KD7A 1RHI1 4WVWA 3Q8FA 4M3CA 1R093 1WW4A 3AL6A 4H7MA 3WP5A 4A45A 3BN6A 4S2GA 3B9IA 2JG8A 3B94A 4CXXA 1AYM1 1HRI1 5B8DA 4I3GA 2ZEZA 2DTYA 2X5IC 3KCYA 4L11A 1AR72 2UWBA 2XWBB 1N47A 3EHKA 3GCXA 4XIOA 4CEWC 2D6LX 4CZSA 3NAPB 4IQPA 4C1XA 1UU5A 2CSVA 4RFRB 1UPSA 3A4UA 5A33B 1JYWA 4WZ0A 4YGDA 1AXYA 2CRRA 2HWD3 1O4TA 3O7AA 3LQHA 2VP7A 5CADA 1TMF2 2XJRA 2ILMA 4IEOA 4UW5A 4ONUA 4YG3A 4L58A 3B69A 4XZUG 1RUE1 3LOIA 4OVEA 4COWA 2NAAA 1VR3A 4JRLA 3CJIA 5K0UB 1NCRC 5B4NA 1G9FA 1TE1B 2VOXA 2XJUA 4JKKA 1V6JA 2VNRA 3WDUA 3ZYGA 4TN7A 2VU9A 5T5OA 4AEKA 4CCOA 2WFPA 1PGW2 3O1TA 1AR93 1OF3A 3LEKA 1RUE3 4LHKA 5L9RA 1YQ2A 1PX3A 2GN3A 1GP5A 3AB0A 3KQRA 4NRMA 4RGKA 4DEQA 4CP9A 1O3SA 1AX0A 2B5HA 1H1IA 3AYAA 4N90A 2ARCA 5JZGC 1DYOA 3K4AA 5C4WA 2M3HA 5IJRA 2EA6A 2JIJA 2P3YA 4QX5A 3PHMA 4Z2AA 2PHDA 4RS5C 5K8SA 4OHYA 3U5NA 3DCQA 3MDPA 1NA1C 5EV7A 4IV1C 4HPKB 3USUA 3EB6A 2WNEA 2QNKA 5HV4A 3USUB 5FERA 2HDPA 1AYM3 1D2QA 1HRI3 1CESA 4XDPA 2A3YA 2VZUA 3CMGA 3W9AA 2R0FA 3HQUA 1QQP3 1RHI3 1W8ZA 2Y64A 4JGZC 4BQ4A 3VD3A 3O1OA 1WIMA 3ASIA 3BTAA 3GZAA 1UY2A 1GZ9A 4ATFA 3RMYA 2VPGA 2J1TA 4CU9A 1DQ1A 2XUEA 1OMIA 4CEYA 2YUEA 2ZGKA 4CSWA 4DINB 5F3CA 1BVVA 1YQ6A 3M3EA 3ZDSA 5IVJA 5J09A 1GZCA 4PQQA 1O8PA 2VJXA 4LXLA 4C90A 3T0AA 3KF3A 5FWEA 4CCMA 4MO3M 2CDOA 2V4VA 1OUXA 2WFF1 4RS5A 5DDJ1 3VHNA 2NYYA 5FZ6A 3WG3A 4CXYA 2VMGA 3M7KA 4ISQA 5C3OA 1YIFA 3H1MA 2XJVA 5CU1A 4PI0A 5HXVA 4YAXA 1FT9A 1GQGA 2KM2A 4J1XA 5IK7A 1Q8PA 1PVC3 1U12A 2QFEA 2YC0A 4LKDA 2FD8A 3OUIA 4QDSA 1OKQA 2LTNA 5JDBA 3MV11 5FXWA 4A2UA 1IQAA 3WF2A 2KKYA 1K3IA 3ZXAC 3MW4A 5KBFA 4AG4A 4IEQA 2OS2A 2WQ8A 3IDEA 2VW2A 2V09A 2QVSB 2E32A 3O0WA 2C4XA 4PIZA 4XF3A 5FOBB 3PUSA 4LLBA 3JBG1 1PIV2 1WCSA 2JG8B 1V70A 1SEFA 2EIEA 2XXZA 3VLBB 3B01A 2FMDA 3RTRB 1CAWB 4MXWA 4ZS2A 2ZX2A 2I45A 1CAWA 3AMPA 3I2DA 5E6HA 4AE2A 5CG8A 1K5MA 4I01A 4XXPA 2D3SA 3BODA 3LA2A 1ENQA 1HLCA 3B02A 4IERA 4K8FA 1VRH1 2HYED 3FM8C 3N7MA 2GU9A 2GC3A 4IEUA 4R4XA 3TYJA 1ZZ7A 4XILA 1H9PA 1BORA 2ECJA 2WQ4A 5LATA 1UYYA 2R073 2IXLA 3ZSLA 1PZ7A 2EA7A 2MA5A 4WBBA 4A41A 2YHOA 2WAAA 4OI0A 1PVXA 4AW7A 1XNBA 2Q1MA 2LRPA 4PBOA 2Y0IA 3DYMA 3VD7A 1E5SA 2VOWA 1BYHA 4LO7A 3KHBA 4B7YC 1MQTB 4YABA 3OBRA 3SITA 1XNTA 4XF4A 2CNAA 3POJA 1GNHA 2Y43A 1Z60A 2HWD2 2ZX0A 4INDA 4HSJA 1H8TC 1UYXA 5FZOA 4Y24A 2NN8A 5F5CA 2W46A 5C70A 4HVRA 4YZ4A 1APNA 5J48A 4XF9A 2AR6A 1V9U2 1BEV3 4B3NA 4HZFA 4BXFA 3MEPA 2ZA9A 5IT6A 4NIGA 1C28A 3NV1A 4BQ2A 4YGEA 1NY71 1Q5OA 1Q56A 5CNAA 4CEWA 1IS5A 3M2MA 2RMU3 3LIGA 4QDRA 3D82A 1AR92 4BQ1A 3WP3A 4BMEA 2BTVC 5G0FA 3KM5A 1TEIA 2MNYA 2I07B 1JYCA 2VMEA 4FQ4A 3ZYRA 2K4DA 4GH4C 4AEDA 4MGIE 2FUIA 5JOYA 2LGKA 1GOGA 5FP9A 2HWB2 3H1WA 5BNOA 1XYOA 5FO7B 3D3AA 3LA7A 1VBA2 4LKEA 1WWYA 1ZVFA 3WR0A 1SBEA 3ST7A 1X33A 2F4LA 3DPRC 4A6OA 3P1IA 1UMIA 4L2NA 3E6BA 2Y1MA 3QBQA 2H0VA 4LKSA 3J8F1 4Y5TA 1MEC3 1ST8A 1CJPA 1S0FA 4CA1A 2KIZA 4QX3A 2XONA 2DURA 3PVEA 4QX1A 3PUQA 3KV4A 3TEWA 4FXGB 5JOXA 5DAWA 4M3CF 5DKAA 1QH7A 4EN8B 2JD4A 1TMF1 4IL7A 3GHNA 3E2DA 3OEAA 1ZRIA 2MD8C 4N43A 4Q4Y3 4LPLA 5J96B 4OCTA 4UI9L 5C71A 1G9DA 3QACA 2ZGTA 4CCCA 4E4ZA 3I3QA 2GMMA 3D8CA 4RSUA 1GR3A 1RMU2 4FJCA 5JOWA 4QF3A 1LENA 1HXS3 3JB4C 3OB8A 4TWTA 5DG1A 1ZRRA 4GWIA 2ZGUA 1R64A 1NA1B 1IS6A 1AR61 3MHHA 1QXPA 4MYEA 1BHGA 5FLHA 2VUAA 3VHOA 3W58A 1JZ2A 5J37A 4AQ2A 4TYSA 1S55A 2O1QA 2VBPA 5EHDA 3RDIA 4ZHNA 3LIHA 5JIAA 1RTVA 1SLTA 2ECGA 2ZOEB 3ZDVA 1VBE1 3TOJA 2RS33 2VZOA 4AVVA 1GWKA 3UKNA 2BGPA 4MGKE 1UXXX 4OI4A 4X6QB 3ZTGA 4L97A 2IXJA 2ZEXA 5FPUA 2C2LA 2IZWA 4H2AA 1Z78A 4NRPA 3ZXLA 5KXBA 3N9OA 4HFSA 3DDTA 2VMIA 2WWUA 4IGPA 4AAPA 4ASKA 3H8RA 2BV4A 1JZ8A 4DUXA 1FXZA 2D98A 3WG1A 4K1ZA 5FP8A 3SXWA 1RMDA 4GH4A 1LHUA 4HK8A 4JV4A 3ZMOA 4AEDC 2YC2A 1O3RA 3DKQA 4D7SA 1JYTA 3OCPA 3ZX7A 5AFEA 2IXIA 3W59A 3DWDA 5FKCA 2D6KA 5JUVA 4C0BA 2KU3A 3KT1A 3FUOA 4GZ9A 2YFZA 3AZWA 1HN0A 4MGSA 1F4AA 2ZZJA 3NO8A 4P5HA 3H8XA 1ZBE2 2K46A 4GULA 3ZN4A 1PK6A 2ATFA 5AFBA 1FV3A 4JVAA 3LAGA 3WHUA 2UU8A 3IMMA 3WX5A 2VULA 1VAKA 4XZPA 3ZFEB 2LRIC 3N3HA 3C7GA 2PHTA 2QKDA 4QT6A 4XUQA 3ZPYA 3AYCA 5LA0A 2PLV2 2ES3A 3CZJA 3BPZA 4E4DX 2PLV3 3VV1A 4I7DA 3ZXKA 1VBA3 2Z4FA 3FZ3A 3HIFA 3K3OA 5A7SA 5T50A 4QX8A 1WGMA 3ZPVE 4COYA 1EV12 1S0BA 1WMEA 2P3JA 3O5SA 4KH9A 3KF5A 5CISA 1ZBE1 1MEC2 1I5PA 5I0RA 4XFHA 3ORJA 1JZ5A 4S2HA 1O59A 3LOBA 3OY8A 1IKQA 3DXUA 4WVMA 4JGYC 2W2IA 1TNFA 3OY8B 2TNFA 4WVMB 4AFCA 5LEJA 4NIDA 3P3NA 1CVNA 4MX3A 1JODA 2JG9A 2WR9A 3CJIB 3LE0A 1H8VA 2HWB3 5K0UA 5LBCA 2Q8EA 3ZR5A 1C8M3 5FBJA 2Y60A 1NCRA 5BNNA 3L2HA 3J9SA 2VZVA 1EV13 4RD7A 3S5QA 2CWSA 2Y26A 5KHKA 1RITA 4NPMA 4ZKTB 4LBQD 2E31A 2GN7A 4XUNA 2B7YA 1PMHX 4Q1PA 2JDUA 1VD4A 4LHLA 3OD4A 1V9U1 4XCAA 1L7LA 2GSYA 4QQ2A 2R6QA 2VG9A 3ZVZB 4A42A 4FT8A 2DUOA 1GP4A 4L8QA 4XABA 2MKEA 4AHXA 4Z0RA 1YI7A 2WN3A 4XQDA 4XFGA 3L1ZB 1A34A 5FB1A 4IV1A 1G25A 4Y1UA 2XDVA 1OKOA 2WZEA 1W6MB 4FVVA 1UOFA 4LA3A 5F2SA 5FZEA 4AEMA 4FO9A 2I2SA 2WO1A 4FP2A 4WVVA 2YU1A 3E5XA 1PO23 4UFKA 2AUYA 2XBO3 2XP0A 2DVBA 3I2JA 3JBG2 2VCCA 4PLOA 4DQAA 5C9AC 5CAZA 4CP1A 3O1VA 1WUVA 4BK5A 1H2NA 5FPLA 2HH9A 1AL21 1WBFA 3UETA 1FYUA 3OEBA 2C9AA 2EIDA 4MXVA 2QUOA 4UT5A 1ZX5A 2KA3A 5T3NA 5C8CC 2EGPA 2OIIA 4FAHA 1AR73 3RZGA 1CZTA 2A70A 1S2EA 5TBNA 5IHRA 3T2TA 4LBQB 4F3JA 4E2SA 1IZ3A 4QPIC 4A7KA 2JE7A 3OPWA 4LO5B 4R9CA 4UBGA 4MG2A 3LWCA 5KC5A 1PIV1 1W39A 3U78A 4BOWA 1G9BA 3AXDA 4QQ4A 3KLSA 4PCRA 2OYZA 4NN2A 5FB0A 3E97A 1HQWA 3FE5A 3MLKA 3ZYIB 4LUKA 2LROA 2R1DA 3W5MA 1ND3C 2CAUA 5LZ6A 3N36A 1IG0A 3LCPA 1LEMA 1YNAA 1XE0A 4Q1RA 1UOGA 2UY9A 4C9ZA 4XUTA 1ASJ3 1UZVA 2CV6A 2A6XA 1FP0A 4QPIB 4YM0A 1A3KA 1RUG2 4GJYA 4YPJA 4BHWA 2D6PA 3KCCA 1MPXA 4IE7A 4YNIA 3SKVA 5JLVA 1BMV2 2E61A 1CR7A 4QPGB 4HG6B 2TEPA 2UWCA 3NKTA 4LQRA 4TZDA 3U37A 5F5IA 3AP7A 2WLQA 4LIVA 2CKLA 4CP2A 2C5DA 5C8CB 1RUH1 4EROA 4CRQA 2JENA 1LOGA 2EICA 1R1A1 3TN91 1ZZ9A 1YI9A 1JYVA 4V3LC 3ZFFB 3KGLA 5FR3A 2XOCA 4XFBA 5BXXA 3QZVA 1OLQA 2A3XA 2WS91 4B7EA 1JZ4A 3KS7A 1W8NA 4QX7A 2Q30A 1T1HA 1WW6A 4B1MA 2JECA 4OHVA 4AGVA 4DS0A 3ME2A 4IW3A 3VBFC 2RM23 1O5UA 3RS6A 1PGL2 3C6WA 1VRH2 2QQOA 3EJKA 1QJX2 1SPPB 3V65A 1G9CA 1BJQA 1WD3A 2PFWA 4GA9A 2KGGA 1IS3A 1VLNA 4Z82A 5FCCA 5FZKA 5LK5A 3RYRA 4YZ1A 1QDOA 2XGXA 1N3PA 3NL1A 4OZOA 5FXVA 2K2SA 4L92A 1ND2B 4LMFA 3N9MA 2Q8DA 1X8EA 4NWWA 4ZS3A 3D5OA 4AI3A 2X53S 1DQ4A 1EY2A 2M85A 2RM22 4N9IA 1GQPA 2JDYA 1LNSA 3O1RA 1HB2A 1V6KA 3AKTA 2FCTA 3WW1A 1LTEA 5GM0A 5DUVA 5G05L 4N4FA 2Y34A 1XNCA 3UGFA 3HBKA 4HKWA 1EUTA 3CJIC 3WG4A 4DRRA 3G6JB 2AZ5A 1OOPB 3GZEA 4O64A 5LKXA 3USSA 4JGYB 1RJ8A 1SMVA 2VQ0A 5A6YA 1LGNA 3SOXA 5FXXA 4R4ZA 2HWC2 3O34A 5FZHA 5LY1A 3HD8B 2QTWB 3VDCA 3FJUB 1RINA 2AH2A 2NP0A 2OT7A 1LHWA 2FDJA 2D6MA 4KWUA 3U14A 4DB5A 5IYYA 3UKVA 1SPPA 2QIZA 1RUI1 3Q8AA 2PA7A 5JR2A 1U5IA 5I0DA 1NZCA 1RHI2 3LA3A 1E5IA 4N7IA 2L9LA 1XC6A 3DV8A 3H3LA 1CAUA 3N9NA 4JDNA 2C1FA 5DDJ3 3ZFEC 4GIQA 3CIHA 2MNGA 3RPQA 2WO3A 4DXSA 4QHOA 5ANNA 1DQ5A 5FY9A 5CFDB 4CVUA 4XFIA 5GZGA 1L7RA 1UKGA 1CGPA 1SFYA 4NPRA 5ABJB 2DJAA 2YYRA 4HSLA 4AL9A 2MT5A 4XETA 1T2XA 2VOKA 2SLIA 1UN1A 3T0DA 2Q8OA 4UBHA 1W3VA 4L7XA 1GZWA 5FMBA 4GKXA 3MPPG 1W2AX 4FPGA 5D2AA 5C8WA 4BQ5A 1VPHA 1UX6A 3I2IA 2JB4A 2RS32 5FJHA 5DQ0A 4ZQLA 2YXSA 1WENA 3DN7A 3PUHA 4LK7A 1KEXA 3GYDA 1RXGA 3AYDA 5SVYA 3AK0A 3SEPA 1LR5A 1D4M1 1MZ6A 1OVSA 5ACA1 5A7QA 4JAAA 2VNOA 5EP9A 1W90A 3WQBA 2K17A 4YYOA 4GB0A 4W6WA 4FPHA 1WGPA 4LO4B 4Q0SA 5C3RA 1W06A 3SLIA 3GJBA 1YHFA 1Q3EA 2GMPA 3K75B 1MM2A 1F8VA 1RUE2 1NXD1 5FP7A 1H6XA 1G9AA 5EJZB 3LJUX 2DWRA 4H14A 1XSQA 3WCSA 5KH9A 1YXWA 3JZVA 3OGRA 3AJYA 3MFAA 4ZZ5A 2DFBA 2Z2SB 3NNGA 3FC0A 3C7EA 3T2OA 3V56A 5HV0A 4X8PA 1LOFA 3ATGA 4HN0A 4A49A 5CKNA 2WYSA 1KJRA 4Q8LA 4KU8A 4QMAA 5EWSA 4AI8A 4XOGA 1RB8G 2RS53 1NY72 3LSDA 3GGLA 5SVXA 4YW7A 2O0OA 2J7MA 1NLSA 4GQ7A 1MZ5A 1PMIA 1W6PB 2VY0A 4CDQA 3AKSA 2IC1A 4N7UA 1OLME 1W3XA 4CUBA 1IPSA 1LB2A 5ERLA 2WINB 4C8DA 2O8OA 1NCQB 3RSJA 1DGRN 3ACFA 4Y1ZA 3ZLIA 4A4CA 1EAH1 3AMMA 4QF2A 4BA6A 2VCAA 5DZGA 3LQCA 3W5NA 2Y8KA 5FP4A 2RJKA 1VBB1 1MQTA 3BALA 3DKWA 4FFIA 4KWKA 1K12A 3NNMA 4ZU5A 1PMJX 2RDQA 1R1A3 4MZUA 2YU2A 4FFHA 1ODMA 4FQZA 3CL1A 2PHRA 3R0RA 2ZX4A 1Y7BA 1O3TA 1SCSA 1FV2A 2VUCA 1AZDA 2WNUB 1MS5A 5FZFA 2FDFA 1V87A 2LGLA 3SUBA 2BEOA 3LD8A 4QM9A 5L19A 3I3MA 4GWNA 3QH6A 4GH4B 5EXOA 2DCZA 1ND3A 1GICA 5CFDC 5B79A 4R8PK 5KH7A 2P57A 4OGEA 4QU1A 4AHWA 4XI1A 4CDXB 4ZXEA 1N1TA 1C1LA 2E51A 4IEZA 5B78A 4UFJA 1N3OA 2XHKA 3H0OA 3RWKX 1ZRCA 4MXWB 1DBNA 4BQ3A 2J1UA 2JDAA 2BJSA 3UKTA 1PNFA 3VHPA 4EN0A 1O8SA 1QXJA 2QZ2A 2DBIA 5A3UA 2IVJA 2HWF1 4DXZA 3K4DA 3WNOA 5L9VA 1W0OA 2KE1A 1QDCA 1VBC3
chains in the Genus database with same CATH topology
4RGAA 3H3UA 1G6NA 1DGWA 2DVAA 3H1YA 1YJKA 4AYCA 1LOAA 4GB32 2DVDA 3IKWA 2YPJA 4AI0A 4I7BA 1OOPC 3T1LA 1DLLA 2LV9A 2PHFA 1MVQA 4RA0A 3B00A 3RQ0A 4H7LA 3D4KA 2ZPXA 1A8DA 2XG3A 4A3XA 1KJLA 4Q0VA 4KWLA 1XXNA 3WDWA 1M4WA 2FMYA 4RL7A 5BNPB 3MF9A 1NOVA 4PIXA 4Q4X2 2Z69A 4PTBA 3BCWA 3U10A 2FUUA 2WC2A 2XBO1 3J4UH 4Z1VA 5HBAA 1ZBDB 5T55A 2YZ4A 5JOZA 4DZGA 1Q43A 1S0EA 1V6LA 4ZU4A 1WEEA 4AI2A 2G4IA 1WLDA 1B35B 3AZVA 1W6QB 2MD7B 3AYEA 1XNDA 1AX1A 3L2YA 3AKPA 3TWIA 2C2VS 2XL7A 2D7FA 4MVTA 2BW8A 3VKOA 2WJSA 3IWZA 3EB5A 2ZETC 4X6RB 1UKRA 4BCUA 1ZRDA 3ZXGA 1DF0A 5CFCB 2JRJA 5E1RA 5E89A 5KHIA 1RUJ1 3ETQA 1UCXA 3BOWA 3ZIXA 4CDWC 2A6VA 2A6ZA 2VMHA 2BPA2 1BBT1 1WBLA 1FOD1 2GAUA 5KXEA 1RUC2 1DZRA 2UURA 2LUWA 4YBSA 4OHZA 2XUMA 2JDZA 5A32A 5JSPA 1ULGA 1AXKA 2EIGA 4RHV3 1C5HA 3O0XA 4YFWA 5BNPA 5H9MA 1NQJA 2BVBA 2VNGA 3JD71 5D1IA 4P9GA 3V0BA 4XW3A 3HCSA 1R082 1DFQA 3WDTA 1CPMA 4IV3B 5KXCA 1VBB2 2BNMA 1PO22 1ND3B 3RWNA 3DQVR 3KT7A 3VBSC 2ZTNA 2DCYA 1QQP2 2CY6A 1WEOA 2LN0A 3WDXA 3SHBA 4YM3A 3H50A 4YG6A 1O7FA 4Q0QA 2ZACA 1PGSA 2ZAAA 3S7EA 1EPWA 3WD5A 4BYYA 1QHDA 4P9LA 1WW5A 5JZGB 1F9KA 1MS0A 5JI7A 5I0TA 4M3CB 2KGIA 4ASLA 4D94A 1JHNA 1VJ2A 3WVJA 4P9WA 1I3HA 4LULA 3AP4A 1GFF2 1ALYA 2DF7A 1WEPA 1DYKA 1C8NA 2QJVA 5G05B 3WG2A 3DF0A 4UP5A 2DUPA 3MIHA 4AFBA 3KB5A 4P9JA 2B8MA 4ISRA 4S2DA 4I0WB 1QJZA 1QOTA 4GNDA 1QJY2 3U5MA 2VJFA 2RS31 4OLLA 4G3YC 1DQ2A 2HWE3 4JTNA 4XHXA 2HWE1 5DUWA 2WA3A 4IEPA 4AYCB 3MGUA 3WZ1A 5A32B 4CEWB 1AR63 4OUSA 4PLNA 3QH7A 1QJU3 1PHMA 2W08A 4Q29A 3AM2A 3AJZA 3O14A 5LKZA 5AC91 4XJWA 4Q4Y1 2VW0A 2V5YA 4BWOA 4DOUA 5E16A 2YGMA 4FPLA 4YW1A 5GZDA 2DCJA 1WEUA 4MSXA 3OPZA 1RVF2 2B9UA 3R05A 3AX4A 2F6JA 2KREA 3HAGA 2D6OX 2PHWA 1GBGA 3J8F3 1HQLA 5SV8A 3WQ7A 3U4XA 1ZYBA 1MS1A 2E63A 5CVRA 2H6BA 3MZHA 4PDWA 3M62A 2E7QA 2MEV3 3KV6A 3EO6A 1LCLA 3VBOA 1LOEA 4MGZE 2E6VA 4MUVA 3E5UA 4RQPB 4YZ5A 5CG9A 1W6PA 1QJX3 1URXA 2VQAA 2RSDA 1S0JA 3S0MA 2HJIA 1VYXA 1OLRA 1XNKA 1ONAA 4P9XA 4AWDA 3N35A 1AYM2 1HRI2 4BMBA 1F2NA 4M3CE 3KT4A 4HMZA 2BBVA 1FOD2 2DFCA 2B46X 5H1TA 1BBT3 4GXLA 2L75A 4N53A 3HMYA 4E27A 4AUQB 5C9AA 3VBRB 4Y22B 4LA2A 4Y20B 4CCGX 1XQNA 1FPN2 5FLIA 3N7JA 1MACA 2KWNA 3O33A 5JVVA 3VZJA 1GQHA 2ET7A 2YY1A 1FMD1 4BH9A 1ZREA 2PUYA 1J3QA 5AC93 4FTBA 2WA4A 1H1AA 4XBQA 5AIUA 3ZO0B 3AZZA 2Q5TA 1S0GA 2LDRA 1VRH3 1AR81 1RMU3 2CAVA 2ZGOA 1ZZBA 3HCUA 4ES9A 2XLGA 1QJU1 1O4ZA 4HPKA 1D4VB 3KSCA 1QNWA 4IESA 1FATA 3POYA 1LESA 1XRUA 3MLLA 4I7CA 1BMV1 5JSOA 3OF1A 2IFWA 1N1VA 5DDJ2 4CDQC 4S2FA 2ZMNA 4YVSC 1CPNA 1XYPA 3GL6A 5AVPA 5EJ3A 1UIKA 2O8QA 3JU9A 1MVEA 3AXEA 4D69A 2YSJA 1JN2P 3VBOB 1OQEA 4Z07A 4A7ZA 2VJFB 4R8HA 4WZCA 4LEJA 5JWPA 3DPRB 1R092 1VBC1 5FO8B 3M3QA 3ZN6A 3LB9A 2RS12 3NVCA 3H9AA 2W52A 3ZSKA 2VNFA 4AQ6A 5LK7B 3B93A 2CTVA 3VKMA 2BNOA 3JD72 4Q2FA 3VK6A 3I7DA 5BYNA 3WOGA 1REEA 2QE3A 3PHDA 3EQEA 3AP5A 3SH4A 4S3OB 3VKLA 4PF5A 1N1SA 1QQP1 3SOWA 1AJKA 3SH3A 4YW5A 1NYWA 2JXAA 1VFYA 4EWDA 1BBT2 3IDBB 2PQQA 1H8TB 5EYYA 4OUMA 4UXAA 4P9IA 3RPGB 3IPVB 5GALA 2H0DB 2D6NA 3AZXA 4V3KC 1MQTC 1Y43B 3C2UA 1DGLA 4RHV1 2WT2A 1W0PA 3ES1A 1AXZA 4LBOA 3HCTA 2YV8A 5TSWA 2ZKNA 3GZTB 4G4FA 5FREA 3V43A 3P3PA 1D2SA 1MS3A 3VBHA 3AP6A 1W2UA 4HLTA 4IEWA 5TRBA 1FOD3 4BBQA 3OBTA 3T1MA 1CD3G 1RUD3 4K20A 5I91A 2ZHLA 2WNVC 1RUJ3 4FP3A 4JGZA 2ZGNA 2CGPA 2GNDA 2D8SA 2KE1A 5A33A 1RUF2 4DY3A 5IK8A 2KXLA 3MYXA 4QXKA 4FOVA 4KG8A 5TDRA 1KD7A 5C13A 5LEKA 1GYKA 4HKLA 1JUHA 3IBMA 1H2MA 3M1HA 5B2GB 4FPEA 2M1RA 2JG8C 4MLOA 2LM3A 1GKBA 1KDMA 4B7KA 1Q8OA 3L11A 4R9BA 5F6LB 3D6EA 4N53B 2X8KA 3OGJA 1IKPA 5J36A 4GNEA 4CDUB 3HT2A 3OYWB 3R6SA 3N9PA 3RMXA 1SBFA 3OYWA 4XIKA 1SACA 4XTMA 5BPXA 2SBAA 5B76A 3D0SA 1O91A 2BUKA 2R043 2IWGB 4XJ9A 5KHGA 1REFA 5C6CA 2I74A 4KNCA 1V6MA 1VP6A 1DQ0A 1ULEA 2A3WA 4L99A 4XXAA 5H1UA 2WIIB 2H0BA 5D1KB 5GZEA 1MS8A 4YVWA 2WLPA 4WM8C 3BU7A 3APBA 1H4HA 1LU2A 4HN1A 2VJEA 5J98B 2HWE2 2KR4A 2ZKLA 2BFUS 2ZBJA 3KNVA 3FX3A 2DV9A 4Q4W3 4B4QA 2IXHA 3V0AB 2YW8A 3FUQA 4QQOA 2Z5WA 1Q8QA 1RUI3 2HWF3 1D0GA 1MS4A 2GMEA 4W6XA 1CJDA 1KS5A 2PELA 1LODA 3AZYA 3UJOA 3NG2A 4A4BA 1NA1A 2ZABA 2D5FA 4OI1A 1K2FA 4CDWA 2VECA 4IV1B 2WT0A 1W6MA 1PZ8A 4XHBA 3WQ0A 3U5PA 5BNNC 4XYXA 4CDUA 2NZ9A 4RS5B 5BY5A 4FAGA 3POSA 4H55A 2B45X 4GWMA 1WW7A 1RUI2 2GC2A 3WDYA 2CL2A 1UZYA 2UWAA 4JDOA 2EF6A 4FOWA 1HDKA 4DPNA 3O0VA 4Z8BA 4YARA 1KXGA 1PK6B 3VBRA 2CYFA 2X29A 2HWC1 2JG9B 3URFA 1DQ6A 3PMSA 4BIOA 1VBB3 3VGIA 1NCRB 1OA3A 2PHXA 2ZGRA 1X82A 3KMHA 1EAH2 4J6GA 3VBHB 4Q4V1 2ECTA 1C8M2 1R081 4R9DA 2RS13 4CDUC 4M01A 1F5FA 3U07A 1GLHA 1GV9A 2EXHA 5C4WB 3QD6A 3HTKC 3VBUB 5L7OA 1QH6A 2YHJA 2XVGA 4KGGA 4F52B 4LKAA 2H0DA 5JPMB 2RM21 4PQ9A 2G9GA 1R083 2X5IA 3FJSA 1PZ9A 1JM7A 4Q4V3 2X5IB 4YW2A 1RIRA 2ZX3A 2GC0A 1NG0A 3AMNA 2H6CA 3POWA 2B42B 1CX4A 1A8MA 2WNVB 2BWAA 1CAVA 3TN93 3ZSEA 3CEWA 3GBGA 4KG0A 1AJOA 2P3IA 3ZFGB 3N7LA 1RUC3 3JUUA 4Y5Z0 5KXDA 2MNZA 4XF0A 1DHKB 1ZZCA 2D3PA 2YGLA 2OUHA 4ASMB 1IS4A 1S0IA 1F62A 2WS92 4K7JA 2CGOA 1E57A 1YIPA 2Q1ZB 5F5QA 2P3KA 3M4FA 4PDWC 3C5KA 4P9YA 4Y1VA 1V6IA 4RR3C 2CGNA 1B35A 2L43A 1HQNA 2M6MA 3E6CC 1KFUL 4M00A 4CP0A 3VBUA 4BIFA 4FPKA 5L7OB 5LCWB 1PO11 3IDCB 2XB1A 4AVTA 2A6WA 1YWKA 1DZTA 4LHNA 3S6PA 3ZIWA 4DMIA 2A73B 5JI9A 3ALQA 4JDMA 2KWKA 5CFCA 2R061 3VKNA 1PVC2 4LNVA 2PHUA 4F8AA 5FEYA 5B75A 1QNYA 4I3PA 1LOFC 2XL9A 4LLOA 3E6DA 4XQWA 1Z7S2 2R041 4N43B 1YFXA 1SCRA 1PO21 2ENRA 1OFNA 1Y9QA 2HEVF 1NE6A 2MIQA 2D5HA 3AKRA 4W65A 1DDLA 2VH9A 4M0NA 3NV4A 4M0HA 2ZJCA 4OULA 4R2YA 1QU0A 2RI7A 4DRVA 1FNZA 2G43A 3QOPA 4UI9B 4YM1A 1YFWA 3VZKA 3ZFGA 3N9LA 3A0NA 5DXDA 4LADB 5BNOB 1RVF3 3WP6A 4YBMA 1A6CA 1V9U3 3TAYA 1W6NB 1H30A 3EXUA 3VDDB 1G8WA 1WEWA 1I9RA 1R1A2 2LGGA 4YATA 4BM8A 1HRV3 2DU0A 2VPEA 1RUD1 1YYNA 1H9WA 2XJPA 5FPZA 4NN0A 2FHRA 4YLZA 3O12A 4JTOA 1YFUA 1Q8SA 4AI1A 4EN6B 2VJEB 3PLQA 3MW2A 3WLUA 3TBDA 4AHZA 4EV0A 4Z2WA 1RUNA 1I6XA 2TUNA 4GKYA 2MPFA 3GNEA 3LQJA 1RUD2 4XE9A 1ZBE3 4I0BA 1K5MC 4UW6A 1I1EA 2OPKA 4D3WA 2E53A 5JPNB 2WQZC 2ZCWA 3T6RA 4Q0UA 5HCAA 5I8TA 2QQPA 4LBKA 1MR5A 1WEQA 1ENRA 1ULCA 2PLV1 3ENRA 1KITA 4G9SB 4KGQA 3ZMNA 1C5IA 1QWRA 1AYN2 1X4UA 1YCIA 3NAPA 4YVSA 3CNAA 2BNNA 5I0SA 3RI9A 2P17A 4HVOA 1TQ5A 3ZXEA 1LGCA 3OGGA 1H1MA 4RR3B 2PYTA 4C0HA 3HT1A 3VZLA 3FMGA 2VPBA 5GLWA 3PVNA 3SCFA 1LHNA 1PIV3 1Z2QA 4Y22A 1JTZX 5DZEA 3MIDA 1J3PA 3FLPA 5KH3A 3IN9A 4A7YA 5IK4A 1HXS2 1AR71 1IOAA 1SLLA 4YC9A 3IPVA 4I2OA 3ZYPA 3O36A 4COZA 3ZNIA 2ZHMA 3V0AA 1UZZA 2XLAA 4O9EA 3M70A 3QLQA 1AL23 1VBE3 2RHPA 4ITCA 1VBD2 5LRSA 1GNZA 4URTA 1FX5A 1LHOA 3I54A 5GZCA 3ELNA 2LALA 4QU2A 2NMNA 3WCRA 1RMU1 1AR83 2B39A 4J1WA 4LJNA 3VBUC 3SOUA 1DGRA 1JOJA 5C4WC 1OOPA 2IDAA 3MW3A 2L80A 1VBD1 3PURA 4JGYA 2D3RA 3FBYA 4MV2A 4KL1A 3ZFEA 1FMD3 1ULDA 3ILNA 4H3WA 2BAYA 4R52A 4W4UA 4HK9A 2F6NA 4XDQA 1QF3A 4ORFA 2VVFA 5FBZA 3ZVYA 4YZ3A 5FOJB 3B5LB 3AFGA 2ECVA 1MEC1 1LOCA 2OW4A 2CT2A 1TME1 2JJ6A 3KQIA 4GNGA 4YAXA 2D40A 3ZYQA 1BVP1 2R0HA 3M7AA 4FSJA 1EV11 3FHIB 4WVZA 4FPJA 5D1MB 3MHSA 1SQ4A 4IETA 3IIAA 2HWB1 3NV3A 1DYPA 4META 1S0CA 5G04B 3WNXA 2XPJA 1DG6A 1XU1A 4XTPA 1Y3TA 4XPVA 4FPCA 4WA6A 2BFUL 3GBFA 3PVBB 1BXHA 2VGDA 4QM8A 5BNNB 1QOSA 1QJX1 2XJTA 3INAA 4LBMA 1PGL1 3I4IA 1WA4A 4E4SA 2E6SA 5D8AC 1D4M2 3ZXFA 5ACA2 1BEV1 1XU2A 1VBA1 1J1LA 2ARBA 5K7PA 1XYNA 4AGGA 4IV3C 1QXRA 2MEV1 4AVXA 2YU4A 1LDKC 3NV2A 2QICA 5GKAC 4P14A 2NLRA 3TN92 4NWVA 1OD5A 2CKLB 3M99A 4CEYC 3ZN5A 1TME2 2IXCA 1OHFA 2GDFA 4RR3A 4WM8B 4UW3A 3RI8A 1RC6A 4YBTA 4WM8A 1G7YA 2FQPA 2XVLA 4YM2A 3ZXDA 1VBE2 1JYIA 3DPLR 2ECIA 4WZ2A 1KFXL 4N3WA 1VB4A 3WW3A 4YVWC 1U5XA 1Z0HA 3J26N 4B4RA 4B8EA 1AF9A 4NOTA 2Z79A 4PLMA 4CYDA 1LJ7A 3MIGA 4LUMA 4JCKA 3HR9A 4FXKB 4COUA 1ULFA 4Q26A 3WUDA 5GLVA 2FBEA 4E9KA 3MIEA 4N53C 1W6OB 1Z7S1 2DCTA 2R042 4IV3A 1JXNA 1IYMA 2YREA 2UY8A 3LRQA 1X8MA 2EVXA 1UPIA 5HCBA 1U0AA 2QDRA 3M8LA 3WP4A 4EWEA 4MSVA 4NVPA 4F7ZA 3GALA 5FTTC 1CN1A 1FI2A 3PJQA 1AR62 3PNAA 2QZ3A 1FBVA 1HXS1 2KWJA 5BNPC 3MICA 4YW3A 5HCFA 4K40A 5JMCA 2R32A 2YQMA 2LXPC 4SBVA 2WFF3 5LKTA 2GALA 3ZPV1 2ETEA 4MH0E 3I59B 2XWJB 4YW4A 3GBWA 4IXLA 3RPGC 3GHMA 4R7EA 1COV3 2P34A 5C8CA 1OPMA 1YLLA 4N9HA 5JIUA 1C1FA 2EXJA 1S2BA 1XE8A 3LQIA 4I09A 2DYCA 1F5JA 5J3UA 1J59A 1JBCA 1ND2A 3JQXA 2NMOA 5I93A 4S3OC 1OPOA 1OFSA 4DY5A 1ZRFA 4OZXA 4Y1YA 1H2LA 2Q4SA 3M3CA 3JD73 3LZZA 2ZS6B 4BE3A 1N87A 1AUYA 4AVCA 1VB2A 4I30A 1HYIA 5I8YA 2JKBA 1ZM1A 3MIFA 3WDVA 4PIYA 5H9PA 4LK9A 2WNUC 4LT5A 1BEV2 4NHLA 1IHMA 1NXMA 3RJ2X 5H9SA 1MS9A 2P2KA 2JMIA 2VPVA 4YADA 2WSVA 2ET1A 4L9BA 4XFAA 4YVWB 3VBOC 2G9FA 4IEXA 1H8TA 2AGSA 2Z42A 4QPIA 1NCQC 2CSZA 3H7YA 3N7KA 1IGOA 4AXOA 1NLRA 4YVSB 2A5ZA 3DGTA 5D8AA 5GZFA 4LO6B 5F6KA 1U5YA 2P37A 1FNYA 4CEYB 4AYUA 2YHNA 1NQDA 4XEZA 5DZFA 4U2AA 2F6BA 2QJ0A 1ZBA2 2D97A 3BB6A 1LRHA 2JE9A 2ZHNA 1RUOA 5FDBA 4NR1A 2V73A 5L73A 3BIWE 1R091 3HQXA 5F9TA 1SLBA 5SV5A