4MVTA

Crystal structure of sumo e3 ligase pias3
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
283
structure length
255
Chain Sequence
b'DVTMKPLPFYEVYGELIRPTTLFEEAHFTFALTPQQVQQILTSRDYTIQVQLRFCLCETSCPQEDYFPPNLFVKVNGKLCPLPGYKRPSRPINITPLARLSATVPNTIVVNWSSRNYSLSVYLVRQLTAGTLLQKLRAKGIRNPDHSRALIKEKLTADPDSEVATTSLRVSLMCPLGKMRLTVPCRALTCAHLQSFDAALYLQMNEKKPTWTCPVCDKKAPYESLIIDGLFMEILSSCSDCDEIQFMEDGSWCPM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 SUMO-protein ligase PIAS3
publication title Crystal structure of SUMO E3 Ligase PIAS3
rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 63
structure length 255
sequence length 283
chains with identical sequence B, C, D
ec nomenclature ec 6.3.2.-:
pdb deposition date 2013-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02891 zf-MIZ MIZ/SP-RING zinc finger
A PF14324 PINIT PINIT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.780 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4mvtA01
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4mvtA02
4LK9A 4V3LC 4XI1A 2KWKA 2KYUA 4YBSA 3KV5A 5B78A 4YC9A 3M62A 4A4BA 2MUMA 2L80A 5B75A 3O33A 3ZPV1 2M3HA 3C6WA 5D1LB 1LDKC 4AYCA 4S3OC 5C11A 2C2LA 4ZUXU 3RPGB 2H0DA 1LDJB 4ZDTA 3O70A 5H9MA 4QF2A 3U5PA 5B8DA 2IDAA 3N9PA 3T7LA 5TDRA 3SOWA 1WEPA 4R2YA 2YU4A 4WZ3B 2PNXA 1G25A 5B79A 5KH7A 2MA5A 2YUCA 2MNZA 3O37A 2LXPC 1WEWA 3IHPA 1WGMA 3ZNIA 4X3GA 4FO9A 3RPGC 5LKZA 3DQVR 2MT5A 2BAYA 3KQIA 4R7EA 2KWNA 1MM3A 3O36A 4GNDA 2UZGA 2K1JA 2NAAA 3O34A 4YABA 3ZYQA 4A4CA 2MA6A 1JM7B 1WE9A 5D1MB 3PHDA 2YYRA 4I7DA 2KGGA 4N4FA 2LRIC 2CSZA 1WESA 2VJEA 1Z6UA 3FL2A 2VPDA 4GB0A 5KH3A 4QF3A 4A49A 5I3LA 2QIZA 4CA1A 3DPLR 2MD7B 3ASLA 1BORA 2LGKA 2MIQA 4S3OB 2LXHC 4MVTA 2RSDA 5DINA 3QZVA 4B7YC 3SHBA 3PURA 2F42A 2ECJA 2ECNA 5D1KB 4AP4A 1Z2QA 3N9OA 4W4UA 4UP0A 4IC3A 2KE1A 2CKLA 2YHOA 3N9QA 1WEEA 2VJFB 4UI9B 2DX8A 1VFYA 3ZVZB 1VD4A 3EB5A 2M1RA 3I2DA 5AIUA 1X4IA 3O35A 2VPBA 2F6JA 1FBVA 5TRBA 4V3KC 5FB1A 3ZVYA 4YBTA 1T1HA 2VNFA 3O7AA 2YHNA 2ECGA 2ECIA 4YADA 2L0BA 4LKAA 3L1ZB 3L11A 4I7CA 5B77A 4YATA 1WEMA 2XB1A 4AYCB 5H1UA 4F52B 2FUIA 2Y1NA 2H0DB 3M63A 3U5NA 4AUQB 2VP7A 5H1VA 2LGGA 5LKUA 3V43A 3VK6A 2K17A 5TBNA 2ECTA 1N87A 2M6MA 2FSAA 4CCGX 3HCSA 5KH9A 4IC2A 4MSXA 1IYMA 4BHWA 2KWOA 2OXQC 1FP0A 3L1XA 4WZ2A 2G45A 3MHHA 2YSMA 4P5OB 2MD8C 2LV9A 2AN6A 4NN2A 1RMDA 2K16A 2Y43A 4WZ0A 3M99A 4WA6A 4I7BA 2CT2A 4N3WA 1Z60A 5LKTA 4LLBA 3C5KA 4BBQA 4UP5A 2MNYA 2KIZA 3PUQA 1WIMA 2ECWA 3GL6A 2YREA 3SOXA 5TDWA 4A0CD 3MHSA 2VJEB 1U6GB 2LGVA 2YT5A 2KU3A 2RI7A 3N9NA 3U5MA 2VPGA 4LJNA 2KREA 2QICA 2KGIA 3ZTGA 2L5UA 2ZETC 2KFTA 4YAXA 4FK5A 2EGPA 5J3XA 4FIPA 2HYED 5G0FA 4LADB 3EB6A 2EODA 4C9ZA 1E4UA 2YW8A 2JMIA 2E6SA 2M85A 1WENA 2LGLA 2E6RA 4ZQLA 2LQ6A 2CKLB 3LRQA 5LKXA 4GNFA 3N9MA 3HTKC 3T6RA 2EA6A 5FB0A 4GNGA 4L7XA 5FEYA 1X4UA 4Q6FA 2JMJA 4TKPB 1WEVA 2I50A 2L43A 1WEUA 2JMDA 1ZBDB 1WILA 3HCUA 2KWJA 4PTBA 5AITA 1JM7A 2K4DA 4FJCA 1WFKA 3N9LA 5FERA 5B76A 2Y1MA 2JRJA 1K2FA 1WEOA 3LQJA 4R8PK 2F6NA 1V87A 5G05B 1X4JA 5H1TA 2QJ0A 4PPEA 5C13A 3SOUA 3ZPVE 2XEUA 3NG2A 1MM2A 3KNVA 2C2VS 5JG6A 2PUYA 4B86C 5G04B 2D8SA 2YQMA 1HYJA 2FUUA 4AVXA 2ECVA 2VPEA 2L75A 2YSJA 2YURA 1VYXA 5EYAF 2KR4A 3GV4A 3LQHA 3RTRB 2G43A 2LDRA 3HCTA 5LCWB 1WEQA 2VJFA 3U5OA 2YQLA 2HDPA 5TABA 3LQIA 1XWHA 4GNEA 1DVPA 1JOCA 4O64A 3KV6A 1F62A 4YBMA 2LN0A 1HYIA 1CHCA 2G6QA 5DKAA 4L58A 2CSYA
chains in the Genus database with same CATH superfamily
1J3QA 1X82A 1UKRA 1W90A 2VM9A 2PLV2 3NNGA 4LK9A 1GANA 3NV4A 5IWFA 2O8OA 3CIHA 2VBPA 2VTXA 3U14A 3MIFA 1CAWA 1GOFA 2KWKA 3WNXA 1RUE2 1KS4A 1PMIA 2EIGA 3E5XA 4WM7B 4OMCA 4CZSA 1RUNA 2R6QA 5H9SA 1QWRA 2D5HA 1ULCA 4PBOA 5B78A 1Y4WA 1D2QA 2OVUA 4LA3A 2EICA 4NROA 4A4BA 5KHGA 4F3JA 1IKPA 1X33A 5F6KA 5FZ4A 5LATA 4LKSA 3R05A 2CGOA 4C1WA 1LHNA 4BJ0A 4DPNA 4GB32 1GMMA 2XXZA 5ACA2 3WDTA 4YG0A 1UX6A 3C6WA 1LDKC 3VZKA 4S3OC 3K46A 5C11A 3J8F2 3JD71 1HRV3 1MEC2 3KV9A 4Q4V2 3AC0A 1UU6A 4QPIA 4TLGA 3U1XA 4IESA 1SHWB 4J25A 2OYZA 1AVBA 1HX6A 2VNRA 3LA3A 3M3IA 4QPGA 2R0HA 3R4SA 4J1XA 2JD9A 4RD7A 4KG0A 5EJ3A 3KHCA 5JXHA 1OUSA 4S2HA 4QF2A 3ZXDA 5JLVA 1TMF3 1NLQA 2J1UA 1V6KA 2HLEA 4A45A 1WCSA 2K46A 3N9PA 3VN4A 5TDRA 4AVTA 2X29A 4K1ZA 2EXHA 4R2YA 2YU4A 3VHNA 4CP9B 2PNXA 4PCRA 2VW0A 4QXBA 4EWDA 2NN8A 1FOD2 4BZ4A 3BVCA 1W6OB 4QXHA 1OA3A 3O14A 5T5JA 2A3WA 2CWMA 3N36A 5B79A 3HQXA 1VIWB 4YVWB 5L9VA 5KH7A 3W58A 3O37A 1O59A 1OLRA 5TSWA 4P9IA 1V6OA 4JGZC 1RUD1 3AP9A 1COV3 5C70A 2DVFA 1KJLA 2ZKLA 4XVHA 3QH6A 3WDXA 2VXJA 3ACGA 1W0OA 4YYOA 5F39A 4XACA 1H1AA 1UAIA 4MUVA 3TYJA 3O12A 1HLCA 4AEDC 5JAXA 3ZNIA 4X3GA 3JZVA 4L8QA 3HT2A 5IK8A 1PO11 1UYPA 3I4IA 2C4XA 5A7QA 2Q5TA 3HR9A 2BQPA 2N7GA 3KB5A 3CZJA 3KQIA 1N1TA 1NXMA 5C3SA 1VBD3 3M7AA 4JV4A 2Q1MA 1CIYA 1F35A 4GNDA 2UZGA 2ZOEB 3UKVA 2HWB2 3FBMA 5D8AC 3RYKA 3LOIA 2NAAA 4YLZA 3BTXA 5E6HA 3ZMNA 1PMHX 1K3IA 1E5IA 2JE9A 1AYN2 3WP4A 1OA4A 4LO7A 1PO22 1U5ZA 2DU0A 1FYUA 3FUQA 2XKPA 3O0VA 4HN0A 2K4DA 3H8XA 4MGTA 3GDBA 2Y6LA 4SBVA 5FOJB 4JCKA 1FPN3 1ULFA 2GP5A 5BNPB 5A3PA 2YYRA 3VBOB 4LLFA 4XF1A 2ID4A 1U5YA 4AWDA 3H8OA 4AEMA 1HW5A 3J7LA 3NKGA 5BV6A 2GSYA 4CCDA 1SLCA 1I3HA 1WCDJ 4WV8A 1VBA2 2Q0AA 4M3CB 1OD3A 3LVRE 1WLCA 1Z0HA 4Q4W3 4BLJA 2D43A 4QF3A 4HK8A 1DYOA 1UXXX 2CSGA 3BB6A 5HPOA 3A22A 3FZ3A 4P5YA 1YFXA 1EY2A 3NAPB 1BBT1 5E89A 5FWJA 5ABJA 2Y6GA 1G9CA 4OMDA 1QQP2 2W46A 2YU2A 3J9SA 4QDRA 1S4CA 4XFHA 5FZLA 3X29B 1JZ5A 3DPLR 1BEV2 4QQHA 2CGNA 5LRRA 5FXZA 1W0NA 2CRRA 2BTVC 2LGKA 2JXAA 1JOBA 2C1FA 4GD4A 4WM8A 1XBFA 2GALA 1Q8QA 5F2WA 2Y0OA 3K4DA 3IDBB 1RUF3 5L7OB 5FYHA 5T3NA 1F15A 2QUOA 4LBQD 4ZZ5A 4HVOA 1OPMA 1AXZA 1UZ0A 3PURA 2P1BA 2VVEA 4GAZA 1AL21 3VL8A 1CR7A 1VBD1 4AYUA 2ORXA 1LECA 3FLPA 4ET7A 4OUMA 3FJUB 1JZ7A 3UJQA 4AQTA 5FO8B 1QJX3 5FPAA 1JYWA 1POV0 5GZFA 4UWDA 1DLLA 1WW5A 3N9OA 5CFDC 3O1UA 2VE1A 2QQJA 4GH4A 3LWCA 4XUTA 4G3YC 1VBB2 4RN5A 1MZFA 3ZXFA 1Y3TA 4CXYA 4UP0A 4NAOA 3BALA 3GJBA 3OGSA 2KE1A 4D3WA 4OHWA 4R8HA 4CVUA 4Y3OA 3UL2A 1C3HA 1N1SA 1PGL1 4IGQA 3T1LA 2JDPA 2VOTA 5IK5A 3ZIWA 4IV1B 4LXLA 3VBFC 3BU7A 3RZJA 5FPUA 1VFYA 4DXRA 2BVVA 4LHLA 1NQDA 4Q4W1 3SC7X 1SLLA 1ZA7A 2KM2A 2UU8A 1UY0A 1S0JA 2WAOA 2XB6C 3WF4A 4CDQB 3VDBA 4OGEA 1NE6A 3ACHA 1UD1A 3L2HA 2GC0A 4XUPA 3K77A 5FK7A 4EN0A 1QGLA 1JOPA 4NIHA 2MEV3 3GZTB 4EJRA 2X5IB 2HWC1 1PNFA 4FQZA 4QKBA 5CU1A 2BV4A 2I74A 3NSTA 4CXWA 1TE1B 3ZN4A 3ZX7A 3P3PA 4B4PA 2BOIA 2WYSA 2WWJA 2F6JA 3NJVA 1SFYA 1RUF1 1VMHA 2ZX1A 5IATA 4OI0A 4XURA 4XW3A 4I3PA 2WFF2 1E5SA 2A71A 3LKJA 4XBQA 3ZSLA 5CKNA 2ZS6B 2FDFA 3VZJA 1JU4A 1C57A 2Z5WA 3KF3A 5F5IA 1C8M2 1SBDA 5FLJA 5CFCC 2ZGRA 1EP0A 3LA2A 5FUNA 4JTNA 4XUOA 3J7NA 1D4VB 3SCFA 3VHOA 1VP6A 4HL0A 4J6GA 4L9BA 2ADEA 4ASMB 1W6PA 1QJX1 3NL1A 5C5UA 3JCIA 1YLLA 2XUEA 3EQEA 4LKAA 1HN0A 1K5MC 4MADA 4UFIA 5GJ6A 3ACFA 1JUHA 2ZHNA 4MH0E 3AXDA 4YGCA 1XU2A 4I7CA 4YM1A 4YATA 2W52A 3AZWA 1PK6C 1HXS2 2GNBA 2WDBA 2WT0A 1POV3 1W2OA 4F52B 5D1IA 2IFWA 1ZBE1 4RR3B 5SVYA 1QDOA 1C4RA 1JOJA 3AL5A 3AYEA 3IIIA 1MS5A 4LITA 3KCCA 4NIAA 1WZXA 2JEMA 3GBFA 2RS32 2W0XA 2ZABA 3JXSA 4CDWB 4B4RA 2VP7A 3M3OA 2PHFA 3N7MA 1URXA 3VD9A 4P02B 5EV7A 3AYDA 2Y34A 1GZ9A 2RDRA 1C28A 3OPTA 1SFPA 2BU9A 4LQRA 2EXUA 3R0RA 3TEZA 5A70A 4ZY9A 3MLJA 3WHUA 2FDKA 1V0AA 2FSAA 1TME1 2Q8DA 3E97A 3GM8A 4IC2A 3RSJA 3WW2A 4MSXA 5JOXA 4ORFA 2JG9B 5C7GA 4UW4A 3L1XA 2OXQC 1FP0A 1RC6A 2AH2A 2IVJA 1JI6A 4WZ2A 2HWF3 4RA0A 4P5OB 1RVF2 4IV3C 3WG3A 5FY8A 2ZHKA 1OUXA 4FXGB 4OQ8A 2AEYA 3I8TA 5GALA 1PIV2 1QNYA 3CJIA 4LK7A 5KXEA 1RMDA 3IN9A 5DZEA 4A4AA 3ENRA 3AP7A 2R0FA 2WJSA 2QTWB 2VC9A 2XHNA 4QDQA 1KXGA 3FL7A 1HV1A 4BXSV 4I7BA 5F3EA 4AW7A 1RUH3 4DQAA 1O4TA 2JDMA 3DUIA 3ZYPA 1BK1A 1GWLA 2WSUA 3C7HA 2IXIA 4LBNA 4JGYC 4TSVA 1RUI3 4COZA 4N3WA 4BQ4A 1ODMA 1WW6A 1KQRA 2OA2A 1OI6A 2J42A 4XBNA 2VO5A 4DB5A 2CAVA 2D40A 3VUOA 5LKTA 1POV1 2LTNA 4PDWB 3W59A 3OSDA 3Q8BA 4XHBA 3PLQA 4CEWB 1TNRA 4WM7A 2RDSA 4FOVA 2WT1A 4X8NA 3EO6A 4W6WA 2R49A 3IPVB 5T5PA 4CCLA 4K8FA 3I59B 4YFWA 1ASJ2 5HI0A 4Y5SA 1ND3B 5IYYA 3BIWE 3UGGA 2KIZA 3ZKUA 3FHQA 3MPPG 1D4M1 5FZ7A 2YREA 2DFBA 5M0TA 5TDWA 3QD6A 1W9WA 3ZXLA 3MHSA 1AR63 1APNA 1L7RA 1YIPA 4XCBA 2WZR1 4LLOA 5B4XA 2PN5A 1F5JA 2LROA 3B93A 4RFT0 3THDA 2DUPA 3PMSA 5FZ6A 1WWYA 1CAXA 1XNTA 2NMNA 1OOPB 2XJPA 2BP6A 3AKQA 3ILRA 2EIBA 3U5MA 2YC0A 4BQ2A 4ASKA 4YRDA 4P9GA 1IPSA 4LKEA 1K12A 3HN1A 2OQ6A 2L5UA 1LOEA 4QQLA 2P3JA 2ZETC 4GA9A 1UY3A 1W2AX 1BYHA 1NAEA 1JMUB 2HKXA 2W68A 2ZZQA 1GOGA 1FV2A 3DN7A 3PJQA 3CBNA 4CP9A 2EGPA 1IS5A 2EXIA 4OHVA 2XOMA 1NA1C 1RJ7A 4C90A 5K8SA 4GB33 4XIOA 1W8NA 5HXVA 5K0UB 3LFIA 3WQ7A 3VBRB 1GWKA 1RUH1 5FY5A 4LADB 2DSMA 3GHNA 3J8F3 3J7HA 4LNVA 4YVWA 3ETQA 2OS2A 4KU7A 2OKXA 2YW8A 3IDEA 1HRV2 1HB1A 2E33A 1YIFA 3O1SA 4YZ4A 3G6JB 2WIIB 3CHXA 5DN2A 1E57A 1CAWB 1W8WA 2LGLA 1ND2C 4QQ4A 5C6CA 2W1WA 1QJU1 2EF6A 1JU3A 5F3IA 3T09A 1F4AA 4XF3A 1J3PA 4D7YA 1AX2A 4URTA 1TMF2 4EN6B 1O6UA 3N9MA 2WQ8A 3FWEA 1PZ8A 3B9IA 3OUHA 5FB0A 4BQYA 1AR61 3LA7A 1JHNA 4XBLA 2WNVC 5FREA 1X4UA 2MHFA 4QB1A 1DFQA 1HRI2 3FM8C 2WABA 3Q8FA 5DXDA 1RMU3 3VBSC 1TZOA 1UPIA 3R6SA 1RGSA 1N47A 4PHZA 5BNOC 3PL0A 5BXXA 1G9FA 3HCUA 2KWJA 4PTBA 5AITA 1RUE1 1WCQA 4BYYA 5BNPA 1MVQA 5GZDA 1COV2 4QPGB 2P4EA 2UWCA 3HNMA 3INAA 3M3QA 4NRMA 4LBMA 4S2FA 3VBOA 4EZ4A 2XPJA 3KVAA 4NHYA 5FY1A 5FPZA 4PLNA 2CAUA 4M3CA 4YW3A 2Y1MA 4CDUB 2P6CA 2QQIA 4BIFA 3ZXGA 4LUMA 3O7OA 2DU1A 1DU3D 2BFUL 1JZ6A 4GB31 3IKWA 3WY6A 2P6HA 5ACA1 3AMQA 3LQJA 1NCRC 2PQSA 1WD4A 3NAPA 3OTFA 4I0AA 3RYPA 3J8F1 2G9GA 1AYN3 4FCAA 4Q4V1 4Z07A 3BPZA 1ZZ6A 1V6JA 3ZYBA 2QCSB 5LBBA 3T0DA 3BKZA 4LUKA 3VL9A 1CJPA 2ZX0A 3I3BA 1YFWA 4RGGA 5GZCA 3PVBB 1XXNA 4PPEA 1NOVA 1W8HA 1WMXA 2J1AA 4HBNA 4KGQA 4DEVA 4AVCA 4DZGA 4JAAA 5L7OA 1QHDA 2ZMKA 4ZHNA 3AMHA 3ZPVE 4CU8A 3H3UA 1MM2A 3AB0A 5CEHA 3KNVA 5D2AA 4QM9A 1AYM3 1FPN2 3ZXAC 2XUMA 3AK0A 3ST7A 2XOYA 4MZUA 1AJOA 3ZYJB 3MDBC 5C3QA 1ULEA 3ELNA 4RS5C 1FOD1 3OCPA 3OF1A 3M7KA 2Z79A 2LM3A 1OF4A 3FHIB 3O0XA 1W06A 2WLPA 4NRQA 1YFUA 1WCUA 4QT6A 4Y1UA 5A7SA 1G6NA 4Q4W2 2VNGA 5FBZA 1QQP3 4NAMA 2D8SA 2FUUA 4AVXA 5CKQA 1HYJA 1UY1A 2E7AA 3H7YA 3WP5A 1PNGA 1BEV3 3LEKA 1RMU1 4CEYB 2RJKA 3U4XA 2A3YA 2XJTA 1CESA 1G7YA 1MQTB 2XBO2 1VYXA 2ARXA 3ZFFA 5EYAF 3MV11 4OHXA 3GV4A 4YARA 4QKDA 3D82A 3RTRB 2B0OE 5C4WC 2LDRA 1C5IA 3F2ZA 4RSUA 2XJRA 3VZOA 1ST8A 3BN6A 3Q8CA 1WEQA 3O1OA 1IS3A 2ARCA 2JDUA 2VQAA 1RHI2 1SG3A 4IV1A 2L7PA 1D0GA 3AZYA 3MICA 5A32B 3RWNA 3LPGA 2CNAA 3SNMA 4CDQA 2Z2SB 3LQIA 2RVAA 4JX0A 2HWB1 4CPBD 5F8PA 4GNEA 4WVVA 1JOCA 2I45A 1XJAA 2WO1A 1S0DA 1DBNA 2KR2A 4DEQA 1AYN1 3PIGA 1OURA 1WMFA 4EN8B 2D6NA 4A3XA 1PO21 2BFUS 2QNKA 1YFYA 4NOTA 3I49A 4YBMA 1F62A 1DGWX 4A41A 2LN0A 3ZFEB 1H2LA 4XDQA 2G6QA 5LY1A 4PQQA 5SV8A 3WF3A 1SFNA 4LIVA 1XYPA 1J58A 1FV3A 4LPLA 4A6OA 5AFEA 3BI3A 2PHTA 5EFUA 2XVGA 4F7ZA 4EROA 4Z0RA 4LOTA 2WS93 1VBA1 3WG1A 1FNYA 5ANNA 5FZ3A 5KC5A 4V3LC 4XI1A 3KGLA 5FKBA 2DWRA 1VAVA 2VMFA 1DG6A 5JUVA 1OC1A 2KYUA 3WF0A 4CCNA 4CP2A 2OQ7A 4M01A 4HKLA 1VMJA 3CF6E 2OX0A 5LEJA 5CG9A 3KCXA 3O0WA 2BEOA 2BERA 4K7JA 1QQP1 3HAGA 2JKXA 2ZGQA 1Q8PA 4NIIA 1BEV1 4JQRA 4M0NA 3RVHA 4Z82A 4BH9A 2L80A 5B75A 3GBGA 1UX7A 3SKJE 2JG8C 1E5HA 3C7GA 2A6YA 3N7KA 4LORA 2MEV2 4DOUA 1VAMA 1DQ1A 2K9ZA 4OQ9A 2XHKA 5JSOA 1V6NA 5GM0A 4YW6A 3DDTA 3FAOA 1NY72 1NXD1 1UF2C 2QQLA 4FAGA 1LDJB 5A3UA 3KQ4B 3O70A 5DUXA 4YZ5A 2VQ0A 3U5PA 4E9KA 1YXWA 5A1AA 1XNDA 3AVSA 2ZGLA 2VPVA 3ECQA 1LHWA 4YGDA 1G9DA 1S0CA 1GNZA 4WZ3B 3K3OA 4QX0A 4KWLA 5IW0A 3ES1A 1K5JA 1HB4A 1SBEA 1AF9A 2UYAA 4GWJA 1VBB1 1EPWA 2F6BA 3RQ0A 4AXOA 4IE6A 3T08A 1H8TB 3I2JA 4HVRA 2VUAA 4BU2A 3JB8A 2QE3A 5FY7A 5KXBA 2MA5A 1XSQA 1UMIA 2Z42A 2UY9A 4CYDA 3CKHA 1VBE2 2W08A 5JZGC 3UYJA 1LENA 1TG7A 4M4PA 4O9GA 2RS33 1WEWA 2E6VA 4QX2A 5LASA 4A3ZA 4LKDA 1IPKA 2PELA 2XWBB 5T50A 2VOXA 3LDYA 5HCHA 4SLIA 3KT7A 1HV0A 1ZRIA 2XONA 3AKTA 4CCMA 1W8TA 1DQ6A 1GYKA 4CCCA 4CRQA 3CQOA 4QU2A 4AHYA 4TWTA 3DQVR 2DVDA 3MI8A 1X9TA 3CDZB 2MT5A 4R7EA 2KWNA 5IHRA 4UAPA 3VDDB 3ZYGA 2YFZA 3JUEA 3K48A 2QDNA 4KU8A 2ZAHA 2K1JA 2WAAA 2HJIA 4PDWA 4AAXA 2WNEA 5EHDA 1RUJ3 1CJDA 1O8PA 2EAAA 2VZTA 4TZDA 2WFF1 4MGIE 4CEWA 4XHXA 4YNIA 1RXGA 5DZFA 3IPVA 4XABA 3I59A 3K4AA 1L3JA 2HWF2 2XL9A 1C8M1 1VB4A 1MPXA 1ND3A 3MFCA 2VZSA 4LO4B 3GBWA 5GZEA 4EV0A 1WE9A 2HBTA 1Y9QA 3FHAA 4I2OA 4CUBA 3OD4A 4BQ3A 3BTZA 2WNUB 3RZMA 4EWEA 1O4YA 1UU4A 1MZ6A 3GNEA 5F7UA 2LRIC 2CSZA 1LODA 5FP9A 3SEPA 1TNFA 2XL7A 1WLTA 2FZ1A 1UXZA 2R063 2V4VA 4G4FA 5FWEA 4CUCA 5B2GB 3CL1A 2BBVA 5KH3A 2KKXA 4AQ6A 4A49A 1RUH2 2VECA 3LIHA 2OZJA 5F2SA 2HWE3 3AKRA 1OOPA 1HXS1 1H4GA 1AR83 1IHMA 1RUI2 2ARAA 2ZAAA 3IBMA 4QPIC 5FYBA 4XILA 5FYYA 2GMEA 2QIZA 4CA1A 3NNLA 2ZXQA 3ZM8A 1OLME 4N43C 3MIBA 5ANQA 2RS31 3K3NA 4XFIA 2ZZJA 3ASLA 3UGFA 1GZTA 1ASJ3 1BORA 4GXLA 2HYXA 4CDXC 4L92A 3USUB 2CRWA 3ZYFA 2D6KA 1FAYA 4TXWA 4KQ7A 1AR73 2QQVA 3Q8AA 5I0RA 4BK4A 4L0PA 3D5OA 5K0UA 2P3YA 2VZPA 1O8SA 4XTPA 3VBRA 3QZVA 2VUJA 2GU9A 1NLSA 1AUYA 2CSVA 5IUQA 1VPHA 2R072 4K1YA 3B69A 5I91A 5JIUA 5IT6A 4UFKA 4AP4A 1SCRA 4ZU4A 4M4RA 1YCIA 1W99A 4QMAA 1UMHA 4Y20B 4AGRA 3LZZA 1F8VA 1KRIA 4CU9A 1OA2A 5JR7B 3RZHA 1RVF1 5K7PA 1BMV2 4ASLA 1JZ8A 1ONAA 4W4UA 1AXKA 5A7NA 5J37A 1PIV1 2XH6A 1GU3A 4FP3A 4IC3A 1UKGA 3N9QA 1CGPA 1WEEA 2GMMA 2V09A 3CMGA 3DPRA 5JI9A 4FTSA 2PHLA 2BGOA 5I8TA 1GUIA 3EB7A 5I0UA 5C3PA 4A7ZA 3N7JA 1YWKA 2D6MA 4NN0A 2RS12 2R061 1K5MB 3H1MA 3S5QA 4QX3A 4BE3A 2PFWA 1O3RA 2HWE1 2XWJB 5CZKA 1PK6B 1S1AA 3VBUB 2GP3A 1O5LA 3KT1A 4TYSA 3WG4A 1CAXB 1I9RA 5LWBA 3DYPA 2IWGB 1D0HA 1JHJA 5CNAA 5AIUA 3N35A 1X4IA 4D7TA 2QJVA 1ZM1A 4O9EA 1ASJ1 3GJAA 2RJLA 2VPBA 5G05L 4O62A 3VD7A 4OUEA 4D6RA 5EYXA 3PVNA 3U10A 4CDUA 2QQPA 1XE8A 1FBVA 5TRBA 3PU8A 1LR5A 4IEPA 3SQOA 1AJKA 2WINB 3ZN6B 4X6RB 4V3KC 3ZVYA 1MS8A 4N8MA 3BGAA 1IPJA 1HRI3 4IXLA 3O7AA 1UZZA 1A8MA 1GFF2 2W47A 4HG6B 2VCMA 3NJYA 4LBKA 3TAYA 2YHNA 5ABJC 1GQGA 3OYWB 4OYUA 1T2XA 2NM1A 2QQUA 4UT5A 2IXLA 2ECIA 4YADA 3I7DA 2HEYF 4QQPA 2VVDA 1RMU2 2E31A 3E6DA 5JR2A 2ZEYA 4FPGA 3H7JA 5GLTA 5LY2A 4PT6A 5JDBA 2WO3A 1LHUA 2VBBA 3L11A 1UOBA 5FYVA 1QOOA 4WM8C 1NCQB 4FOYA 3PLWA 4XDOA 5A33B 3AP6A 2XB1A 4AYCB 2ZCWA 1KD7A 1W8ZA 5H1UA 2SLIA 2W1UA 3WINE 2B7YA 1VLNA 3FE5A 4XC9A 4GWNA 4EE2A 1LKNA 5FZ1A 3NVCA 5EXOA 2X09A 3IT8A 2H0DB 3M63A 5I8YA 2FFWA 1ZBA2 1I6XA 4AUQB 3OG2A 1WMDA 5HCBA 5IVEA 1VRBA 3OGJA 1MS1A 4AI2A 4W65A 5LCWL 1YUDA 4NRPA 4XMIA 2Y8KA 4KG8A 4CEYA 5CB7A 3ETPA 3KWVA 5DG1A 2ECTA 5DAVA 1MQTA 1HRV1 1WA4A 2DV9A 2ZGPA 1BVVA 1GP6A 3MF6A 3R4DB 4GH4C 4META 5EZWA 5IAVA 4AG4A 2EALA 1JTZX 2GN3A 3E1F1 4CCGX 1C1LA 1QH7A 5GLZA 2IQJA 3HCSA 4BCUA 3ZYHA 4D6SA 4KWKA 2CYFA 1IYMA 2ERFA 5FYTA 1LOGA 3AJZA 1TMF1 4IGOA 5FJKA 4Y5Z0 4ZU5A 4XUNA 5A32A 1G9BA 2PA7A 2G45A 1AYM2 3SH3A 3VZMA 4DY5A 3W21A 5AVAA 1DYKA 3H8UA 2YSMA 1A78A 2XLFA 3AZZA 2A3XA 3MW4A 2RM23 2LV9A 4ZONA 5FZEA 1MS9A 1HRI1 2D98A 4NN2A 5SVXA 3K51A 3MEPA 5BNNB 3PVOA 3VDAA 4WZ0A 2DJAA 3M99A 3NRUA 2BWCA 3K4ZA 3HIFA 2XBO3 4YVSB 3ZXKA 3OUJA 3ZFEA 4Z1VA 1MS3A 4KI5M 3I2IA 4XPVA 1O3QA 5FR3A 3AMPA 2JWPA 2LUWA 2VZVA 1COV1 3D3AA 2H0VA 3SISA 2DVGA 2P57A 3NNJA 2G9ZA 3WQBA 1F2NA 2GC1A 1Z60A 5C8WA 4Q1PA 3LIGA 2PHUA 3MYXA 4XOGA 1WW4A 1RHI3 4KGGA 1S2BA 2YBSA 4YZ2A 5I0SA 2OWAA 2ZMNA 4XJAA 5GLUA 3ZIXA 3ZO0B 4TN7A 1YYNA 5FZIA 3WOGA 1W6QB 3ZVXA 2VNOA 2E7TA 1GSLA 3EBRA 3OBTA 4QGLA 3UGHA 2VMGA 1MACA 2C5DA 1LGCA 3O1MA 5DPNA 2XOZA 4NWWA 2D7FA 3NV2A 4FI9A 4Q5OA 4BQ1A 5AFBA 2VW2A 1WA6X 4YG6A 4YG3A 4FBFA 3P3NA 1D7PM 3SKVA 5FOBB 1WIMA 2ECWA 4M00A 1W39A 2C24A 5E1RA 3OOXA 4A0CD 3OGVA 2NP0A 3OBAA 5FZBA 1VE0A 2BPA2 5EIYB 1SPPB 4QHZA 4BIOA 2C6SA 4XFCA 2WWUA 1ZA4A 2WN3A 3ZFFB 5ERLA 2Y6HA 1JYXA 1FPN1 2TEPA 4ZS2A 3AFKA 4YW5A 1R1A2 3V65A 2A1XA 4QXCA 3LJUX 3ZR5A 1XYNA 4PJYA 4LJNA 2PHWA 5DQ0A 4B1LA 1NUKA 4LMFA 4AE2A 2B39A 5DG2A 4RGKA 3O1TA 1ZRDA 2WS92 1LHVA 3GZAA 1IQDC 2NPIA 2VUDA 1UOJA 1UOFA 1GP4A 4P14A 2JJ6A 3POJA 4I3GA 3KLSA 4Q4X3 1OQEA 4FK5A 4YAXA 3B01A 1RIRA 2WUHA 4MV2A 4AHWA 3I3EA 2WA3A 3OD0A 4CA9A 3KSCA 4MGYE 5BNOB 2VGDA 1OPOA 2XBO1 5LZ6A 5J3XA 4QGNA 3N3HA 3ZN5A 4FTEA 2HYED 3H7HA 1OQ1A 5G0FA 1H8TA 4PQ9A 4LULA 3WDUA 4QQOA 4FSJA 3EB6A 4C9ZA 4RHV3 5J7MA 2VG9A 4COWA 1V6MA 3WNNA 2ZJCA 3DV8A 1PGW2 2HEVF 4AI8A 3DXTA 1BXHA 1H0BA 3DCQA 4PF1A 5A80A 1RHI1 1ULDA 3ACLA 1DQ2A 2YG0A 1H30A 5FAXA 5C71A 1EUTA 4NMIA 2BJSA 2E32A 2VNVA 4KMQA 3T4VA 5J98B 4OI2A 1YC61 1NE4A 3CJIC 4GKXA 4GKYA 4IETA 5IK4A 1PVC3 4ZQLA 1NCRB 1Y9GA 5FO7B 4N53B 1XRUA 3LRQA 3ZFGC 1AL0G 2EXKA 3D6EA 4NHXA 4XFFA 4BQXA 5T5OA 1M06G 1V00A 2ILMA 2H0BA 1X9PA 3DL3A 1CZSA 1WBFA 3OGGA 5FZDA 3H3LA 3VDDA 3WNMA 1CAUB 2EA6A 4H7LA 4R9BA 1PGSA 5IVCA 4Q6FA 3Q8EA 1K42A 1WEVA 1VBE3 4YW4A 2L43A 2JIJA 3DF0A 2IC1A 2JMDA 5FZAA 1ZRCA 2AUYA 3CLPA 1PX3A 2W95A 2A75A 4LHKA 4K6BA 1UYZA 1EAH3 4PIXA 4WM7C 1YI9A 3ZXJA 2Y6KA 4AF9A 1OH3A 2FBEA 2QDRA 4AAPA 4E2SA 1F4HA 3WLUA 3N9LA 5KHHA 2WNUA 1JN2P 4L2NA 2EVXA 4UW6A 3BCWA 2WFPA 4A44A 1DDLA 2JDAA 5LA9A 1K2FA 3MBWA 5E8AA 5CKMA 2OUHA 3BIEA 4XTMA 1ZZ8A 2MEV1 1UQXA 3NJZA 3NV1A 2QZ2A 4LR4A 2J1EA 1OKOA 5FY4A 4R52A 4RHV1 3POEA 4JKKA 1RYYA 2NQYA 2VZOA 2YV8A 5DZGA 3U11A 1D2SA 3AZVA 4LBOA 2PHRA 4MHUA 4IEYA 1LNSA 1NY71 1LOFA 4B3NA 5FZ9A 1Q8SA 3A0NA 4UBHA 1RUJ2 2J1SA 1A6CA 4UW5A 1EV12 2UYBA 3CJXA 2GC3A 2VVFA 3OY8A 3RI8A 3USUA 5C8CB 4DUXA 3RZZA 1SACA 4H7MA 2R32A 2VBDA 4YPJA 5F37A 1WUVA 5HCAA 1DQ5A 5DUUA 1S0FA 3QACA 3WDYA 1CX1A 5BUVA 1WLDA 1QEXA 4PF5A 2TBVA 2XP0A 4XQ4A 4Y5TA 5T54A 1R083 4HZFA 5JSPA 5JOYA 2H6BA 2PHXA 2WQ4A 3D4KA 2JX9A 4W6XA 3NWKA 1W04A 3C3VA 5FY9A 2FMDA 4YVWC 5KHIA 2R062 4QX7A 5G04B 4Y20A 4E4HA 3S7IA 2YQMA 4XJWA 3ABZA 2B4KA 1VBE1 3HT1A 2WZEA 2HWE2 3POIA 4GMP0 4XQWA 5HV0A 1B09A 3UKNA 4Q0SA 4I30A 1AR82 2YURA 5DMYA 1XC6A 1XE7A 3FFZA 2KR4A 3OUIA 4Q1RA 4XQDA 4HXCA 2YXSA 3FJSA 2RR13 3LAGA 5I93A 1LU1A 4XEZA 5IVFA 2F17A 1QNWA 4BQWA 1QDCA 1R64A 3U07A 2R073 1WCKA 1AR72 1NKGA 1K5MA 5SVIB 4IUGA 4V2VA 4QB6A 2NMOA 3E5UA 3AYCA 4DO0A 1GBGA 4HONA 5C3RA 1PK6A 2V5YA 2FCTA 2WA4A 3ES4A 1AX0A 3AVRA 3VBUA 5J48A 2D3RA 3M70A 2J7MA 3NV3A 5FIXA 4QM8A 3KV6A 5EPAA 3WQ1A 1DGRA 3W20A 1HQNA 5FYMA 3RNSA 1J1LA 1WKYA 2LW8A 4MO3M 3T3YA 1IS6A 1W9TA 1Q8OA 3SMHA 1GOHA 2HWF1 4CCEA 5DKAA 1ENRA 3I2OA 2SBAA 4AQ2A 3H50A 2WR9A 1X36A 4OVEA 5FZGA 4FT8A 5FQ0B 5J09A 1N3OA 3ZN6A 3U0ZA 2BNMA 2B45X 2CDPA 1LGNA 2OT7A 2RS13 5FLHA 3RPQA 2DVBA 2CTVA 3WR0A 2QFEA 1O3SA 3PIJA 4ITCA 1B35C 2IZWA 4AFAA 4CU6A 5K3QA 1K45A 1DQ4A 4KBZA 3NAPC 3NKTA 1NT0A 3OYWA 4RQPB 3WSOA 4OULA 1RUI1 3BOPA 5ISLA 3J7MA 3WUDA 4KWJA 3KD4A 4OFGA 3O33A 2BNNA 2IXCA 2W1QA 1JZ4A 1NCQA 1H4HA 3ZR6A 3ALQA 3VBHC 2E63A 5A33A 1YO8A 2V73A 5L7OC 5D1LB 4HSLA 3WT3A 4AYCA 3JUUA 1YJKA 2W5FA 2OZ6A 1IG3A 4HKWA 4ZUXU 4GMP3 5LA2A 1YHFA 1AXYA 3U78A 4BHPA 2H0DA 4F1PA 1JW6A 3N7LA 4PBPA 3V56A 4LBLA 3DPRB 3T30A 3RMYA 3TN93 2FHRA 2GMPA 2R071 3CZUA 4P08A 3IIAA 1KFXL 1S2EA 3JB4C 1L7QA 2CDOA 2J1RA 5B8DA 5CIRA 3D8CA 3PMEA 1UY4A 5FK8A 3WNKA 2IDAA 4N9IA 2VCAA 4OZOA 1DGLA 4LTAA 1WEPA 4QX5A 3SHRA 3LDKA 2AR6A 5FYZA 1TVGA 2EAKA 1Z78A 4M3CE 5EYYA 2FZ2A 3VKFC 1BMV1 1RUG3 2P3IA 4L97A 2ZGNA 4MXWB 1H6YA 2X05A 3OPZA 5FO9B 2YUCA 4C91A 1QMJA 4QWNA 2LS6A 5FZFA 1BKZA 3A23A 4BWOA 1FI2A 1ZBA3 1YEWA 3S6PA 3WX5A 1AHSA 2RS11 3RYRA 4CDQC 4L99A 3T4HB 3B9CA 5BNNA 4Q29A 1HQWA 1HN1A 1UCXA 4FO9A 4XFGA 2UURA 4YVSA 4GJYA 3RPGC 2X5IC 3VLBB 1JYNA 4LJHA 1O5UA 2BAYA 1UWWA 1EPZA 2V4AA 1BQPA 4LBQB 2BBAA 4AQSA 4AFCA 4N43B 5JXJA 3A21A 4NPRA 3T0BA 5JXIA 1ZREA 5JOWA 3IMMA 1MM3A 3O36A 3IDCB 4CDXB 3O34A 2EXJA 3AMMA 3WDWA 2P17A 4GMP1 1HB3A 2DCKA 1IG0A 1W6QA 2FMYA 2J22A 4MOAA 5EP9A 1J59A 3NNFA 2C26A 1DZTA 3ZYQA 4FVVA 4A4CA 4WZFA 2MA6A 3KVBA 1JM7B 2VOWA 3RRDA 1PVXA 3SH5A 2VOVA 4JC1A 4NIGA 3PHDA 3MO4A 2RM22 2DFCA 3O1RA 3JQWA 4NR1A 4EYUA 3GXUA 5FZOB 1WESA 4CUAA 3LEIA 1FMD3 2P3KA 4LKFA 5FMOL 1Z6UA 1SPPA 3VKMA 1WMEA 3MLLA 5I0TA 4GB0A 4LHSA 1ULOA 1ZVFA 3WDVA 3SUBA 1RUG1 3EJKA 4IEQA 3WXPA 2B46X 5I3LA 4MGQA 3WW3A 3POFA 1QF3A 4D94A 3ATGA 4K9SA 4RR3C 2M13A 3MIHA 1JYIA 1HKDA 4UXAA 3WF1A 5C9AC 4CDWC 2MD7B 2WN2A 4U2AA 1ZBA1 3I3DA 3UJOA 1W2TA 5DUVA 2A6WA 5BNQA 3POSA 3SLIA 2A6VA 4LBJA 3RZLA 4AVAA 5LA1A 3RMXA 4S3OB 4AK3A 2ZGOA 1O7FA 2NZ9A 1OKQA 4Q8LA 5BNOA 3A4UA 3RZGA 2RSDA 2VTFA 4PLOA 5DINA 3I3MA 2DUQA 4B7YC 2WC2A 3JBG2 3NNMA 3AP4A 2F42A 4FFGA 1Z7S3 2JE7A 3BODA 3WCSA 3RZKA 1OFSA 2A5ZA 2JD4A 2ZGTA 1R1A3 1Y9MA 2JG9C 2ORZA 2VOKA 5F9TA 3MIEA 2ECNA 2BYVE 3I2KA 2JDZA 4UF0B 1JBCA 1OT5A 3RJ2X 4KL1A 3ILNA 1AYM1 5F1RA 5KC6A 1Z2QA 3HD8B 3AX4A 2E61A 3I2HA 2AREA 1UL9A 4D7SA 2FD4A 2L9LA 2GDFA 1V6IA 1OH4A 1NCRA 3THPA 4NJ4A 4N53A 4UFMA 2Z69A 2Q1ZB 3DECA 4Q26A 4Q4X2 1LCLA 4IQPA 2LAUA 2X8KA 4CCKA 4UI9B 1CAUA 2B42B 4OLLA 1YJLA 4JGZB 3UK9A 2DDUA 1T6GC 4LIUA 4Z8BA 3NW4A 3ZVZB 1P8JA 4XXAA 4ES8A 4I0BA 2VMCA 3B94A 3KT4A 4AEDB 4PDWC 5I8SA 4CTEA 4RHV2 3EB5A 4BM8A 3HMYA 2Y0IA 1QOTA 3OEAA 1AZDA 2ZEXA 4CEWC 2YC2A 4RS5A 1QJEA 3I2DA 5LA0A 5FFOC 2RS53 4I09A 2DYCA 1ND3C 3O35A 2IFRA 4IE7A 2HWD3 2XJSA 2WO2A 2ZHMA 2DF7A 2JM3A 1VBC2 2JDHA 5FP7A 3I2FA 5D8AB 2RJ2A 3D0SA 1PVC2 2XGXA 4JDOA 2JECA 5KHKA 3ITQA 2ZACA 3Q1DA 4YBTA 1T1HA 5DDJ3 2XLGA 4C0BA 2EIDA 2E53A 1W2NA 1Z7S1 5HCFA 1OOPC 3LGRA 1AR93 3PHMA 1R1A1 2W87A 5KXDA 4FTBA 3S0MA 4DXSA 2G19A 1MS4A 2TUNA 4IL7A 4QD2A 4P9YA 2VD7A 2WRAA 4M3CF 2WS91 1IKQA 1OVSA 4MXVA 5C8CA 2L0BA 3L1ZB 2YPJA 1IOAA 1DZRA 4EZHA 3I3QA 1EAH2 1SDDB 4FPYA 3LOBA 1OFNA 4AGVA 1UO9A 3IAPA 4GWMA 4IEOA 3T2QA 3URFA 4LT5A 1RUC3 1O4ZA 5L9RA 1YQ2A 1H9PA 1A3KA 5K0UC 4WVMB 2FUIA 2ZGSA 4IERA 3VBRC 5J3UA 2Y1NA 3G7DA 3WP6A 4ATFA 2GNTA 1VRH2 3K2OA 1UY2A 2DURA 2RMU3 3JU9A 4BXFA 4R4XA 3SCHA 5JXGA 2GH2A 1GKBA 1QJY2 4CU7A 4ZXKA 1PGW1 5HV4A 2LGGA 1WW7A 3V43A 3VK6A 5F3GA 5LKUA 2K17A 4AEKA 3DGTA 2I2SA 2M6MA 1EV13 4AVBA 5FEYA 5LW9A 4YSFA 4NUBA 2O0OA 1I1EA 5JPNB 1SQ4A 4CCOA 2FDIA 5DAWA 4Y1VA 5CBLA 2WBKA 4EN7B 2RS51 2PXJA 4Y22A 5FBJA 4OGCA 3UV9A 1LHOA 4CP0A 2D6OX 4A6SA 4FFHA 1MBMA 4BHWA 4ARYA 1O91A 4P9WA 1QOSA 1ZZCA 1W3XA 1PHMA 2YFUA 5C3OA 5SVIA 1MZEA 2MD8C 3LE0A 4A2UA 5CFDB 3L9JT 1S0BA 2AN6A 1R082 1JS9A 4Y1YA 3S5AA 2K16A 2ES3A 3IWZA 1ODNA 5FYUA 4WA6A 2HEWF 3P5BA 4R9AA 4UW3A 2WLQA 1NZCA 2RDNA 4HOOA 4IW3A 4PIZA 4QPGC 3APBA 5LBEA 2LRPA 2CT2A 3D0JA 3PUAA 5FXVA 3VBFB 4CUGA 5FQ0A 1CPMA 3H8RA 3HPNA 3OY8B 5DAXA 1RITA 2Q4SA 1ENXA 1SLIA 3QOPA 4JHZA 4CDUC 2D6LX 4UI9L 1LRHA 2RR12 4LO6B 4MSVA 5IVYA 3C5KA 1KFUL 4LLBA 1HJFA 3KV4A 4O61A 1DLCA 3ZSKA 4RQPA 4BBQA 4QKFA 2RMU1 2MNYA 2BOJA 1RJ8A 3PVEA 1OMIA 5FZHA 2RDQA 3NJXA 1DYPA 4FAHA 4XJ8A 2AENA 3ZDSA 2VMEA 3PUQA 5A1LA 1STMA 5B4NA 3GL6A 4IEZA 3GYDA 2G9FA 3KS7A 1RUJ1 3KCYA 2VJEB 1CN1A 1EV11 4O65A 1N3PA 4BMEA 3B3QE 1U6GB 3TNPB 2DCTA 2UWBA 5KHJA 3WP3A 1KGYA 1W05A 3OBZA 5CFCB 3RS6A 4BK5A 2RI7A 3KF5A 1V6LA 3ZSEA 5I0DA 3N9NA 1JUIA 4NHMA 5A6QA 3O1VA 4NWVA 4ES9A 2KREA 2H6CA 3GGLA 3M3EA 3WHTA 3ZTGA 3TBDA 3WW1A 3O5SA 2PAEA 2KFTA 5BYNA 3WUCA 1L7LA 2A70A 4N7IA 1U5IA 1XPWA 1TEIA 2ATFA 1QIQA 1XYOA 1RUD3 3DKQA 2O8QA 3ORJA 1LOBA 3CEWA 4S2GA 4XFAA 4CEYC 1MQTC 1ENSA 4ARXA 1AR81 5JVVA 4LOSA 2MPFA 4B7KA 5A3MA 2LALA 1R092 4GALA 4MXWA 2NYYA 1UNBA 2VZ1A 3MIGA 1QY4A 4YM2A 3S7EA 4BPZA 4DMIA 1PO13 4UBGA 3C7FA 2EODA 4A7KA 3TEWA 4COYA 2YMZA 2PHDA 4MX3A 4B29A 3C2UA 5L73A 1OF3A 2JMIA 5FPLA 1GQHA 2R7EB 3POGA 4Y4YA 2DTWA 1AR71 4V2WA 5GZGA 3KDEC 1RL3A 5IVJA 1NZIA 3ZKYA 2VW1A 2W9XA 4Z2WA 2BRTA 2E6RA 3WNPA 2VJXA 3TN92 2VQUA 1SLAA 5A6YA 2JB8A 1US3A 3SH4A 1PZ9A 5AVPA 3GCWA 5J96B 3LEGA 1CWPA 2CKLB 5LKXA 3CU7A 1W6MB 2YY1A 4DFSA 4O7XA 4MGSA 3ZFEC 2WSVA 4LBQA 4P9LA 3PDQA 4N43A 5EQUA 3T6RA 3VZLA 4BMBA 4GNGA 4L7XA 4CDXA 4IV3B 2B9UA 4AHXA 2JMJA 1RUG2 1H2NA 4TKPB 2QQWA 1VR3A 2I50A 4Q2FA 5IVVA 3UT0A 3THTA 5DABA 5C5TA 2XLAA 4AL9A 1ZBDB 3MLKA 1JM7A 4TLFA 2CWSA 3BYWA 5DAQA 5FYCA 1IZ3A 1S0IA 5A3WA 3RJRA 4FPHA 5JOZA 1W2UA 2KXLA 4FXKB 2Q8OA 3T0AA 1BBT3 5J1XA 4NIDA 3USSA 1ALYA 3M3CA 5FERA 4JGYB 3T1MA 3MUZ1 1N3QA 3KQRA 1IS4A 3IAQA 1T6BX 5FZOA 4QGMA 1DGWA 4H14A 5B76A 2IXHA 2JRJA 5IK7A 1BVP1 5LB6A 4XIKA 2YBKA 4H55A 3AZXA 3VDCA 4R8PK 4JRAA 4N7UA 4QX8A 2F6NA 3AKPA 3W9AA 1X4JA 1R1ZA 4N9HA 1YNAA 3C7EA 4P00B 1S2KA 4TTGA 1AL23 3I2GA 3T2OA 1PM7A 2QJ0A 5H9RA 4LHNA 3TOJA 1U12A 4E4SA 1FATA 2ADDA 1PZ7A 1SDWA 2J1VA 3LSDA 4XZPA 3ZOIA 2R1DA 3SOUA 2XEUA 4Y33A 2W91A 1US2A 5A7OA 3K75B 5L9BA 2Q8CA 5LBCA 4QDSA 2C2VS 3W5NA 5JG6A 2A6XA 2ENRA 4FPJA 2PUYA 4Q8KA 1U0AA 2D5FA 2AGSA 1H8TC 1N1YA 2ZGKA 3M8LA 4YZ1A 4B86C 3B7MA 1FMD2 2YPDA 2QQKA 3HOBA 3RG0A 4MGZE 5IVBA 3PTRB 3O47A 4UF0A 5CVRA 2VMIA 2JDNA 3F95A 3C7OA 1XQNA 5FYIA 1LU2A 3VKLA 4X8PA 1ZZ7A 4DRRA 1NA1B 1QU0A 1WGPA 2WKKA 3OBRA 4FPCA 1B35B 2VTXJ 4IEVA 4K40A 3WV6A 3UNPA 2G43A 4N90A 4DXTA 3HWJA 3HCTA 1QXJA 1J3RA 3IB3A 3U5OA 1XNCA 1DGRN 4QAWA 1MR5A 2K2SA 4ZS3A 3AXEA 3J26N 5F5AA 4I0WB 2HWC3 4AI3A 4Z92B 2YBPA 3DYMA 3GZEA 3JBG3 3AKSA 4JGZA 4KH9A 3VDDC 4E2QA 5JPMB 1JZ3A 3PU3A 1JYTA 5FJHA 1OD5A 1XNBA 4AFDA 5A3OA 2AC1A 3AMNA 3HQRA 2GH8A 4WVZA 1XWHA 2ZEWA 4AEDA 3VBHB 2EGMA 1ND2B 2G1MA 4NHKA 4OI4A 1DVPA 1Z7S2 1H1IA 1NX9A 1DCSA 1UW8A 3U37A 5FV3A 1JYVA 3IZOA 3DYOA 3HNYM 4Q27A 1BHGA 2Y6FA 3ZSJA 2P37A 2FCVA 3POYA 4P5HA 2XVKA 4W50A 2BGPA 3THCA 1HYIA 4NO4A 4QHBA 2FDGA 2BVBA 2D97A 3GCXA 4L58A 1SEFA 2WO7A 4XE9A 2WNUC 3ON7A 3VV1A 2FDJA 1LOCA 3MV01 1H2MA 2RM21 3TRSB 2ZX4A 2WNVB 3I97A 5D8AA 2OIIA 1LULA 5FUPA 4CSWA 3VBSB 3POWA 4Y4RA 1CIWA 4KNCA 1LAJA 1CONA 4YBSA 3QH7A 1JXNA 4AI0A 2YUEA 5H9QA 1UZVA 4FPEA 1H8VA 2GAUA 2Y33A 3KV5A 2WYFA 2BWAA 1ZBE3 5EJZB 3T9KA 4XETA 4YC9A 2VAUA 1LOFC 2NLRA 4JKMA 4GIQA 5IFTA 3M62A 2R1BA 1VAKA 3MPBA 2VR4A 2MUMA 3E2DA 4JRLA 3VD4A 4FJCA 1UYYA 1GZWB 2A73B 3GALA 1VBC3 4KWUA 1DIWA 3VKOA 2M3HA 3ZPV1 3LB9A 1E5RA 3MDPA 2FCUA 1VB2A 1MS0A 2RS52 2C2LA 3FBYA 1G8WA 3LDRA 4WVMA 2HWD2 2W1SA 2XQXA 4JDMA 4C0HA 3RPGB 2PAMA 5L36A 3H42B 1TME3 4YW7A 4NPLA 3E6CC 4Y1XA 3JBG1 3N4MA 5H9MA 4ZDTA 2YVRA 2Q8EA 5FPXA 1HJGA 1KITA 1QXPA 4XJZA 1OSGA 2CY6A 5E88A 4Z0OA 3MW3A 2Z4FA 3ILFA 3FLRA 5DDJ2 1IGOA 1DZQA 2R30A 1REFA 3OGRA 3T7LA 3SOWA 2QZ3A 4FQ4A 5GLVA 3H3ZA 4DIQA 4I02A 1AR92 2OPWA 3CNAA 2JUNA 4OHZA 4EQVA 1GNYA 2B8MA 1KS5A 2DTYA 4QPYA 5JWPA 1W3VA 3S57A 4Q4Y2 4H9DA 1G25A 3VD5A 4RS5B 4BA6A 3BPSA 4HMZA 3FFQA 3GF6A 1LJ7A 4DUVA 1GLHA 4COUA 4XYXA 3B00A 1GV9A 3NQHA 1REEA 4XUQA 5JSRA 2MNZA 1G86A 4Q4X1 2LXPC 2O14A 1VRH3 5A7WA 2V72A 1LOAA 2WL1A 3M1HA 3AP5A 5CFDA 1RUC2 2RR4A 3IHPA 2PMWB 1QJY3 4NVPA 3MHZA 3VHPA 1WGMA 1W9YA 1XNKA 1W6NB 1J1TA 3VBUC 2RHPA 2RMU2 4K21A 5C4WB 1CAVA 4IEXA 2WZPP 3FMGA 3PUSA 5A1FA 2ARBA 5C33A 4MG2A 1HQLA 4HSJA 5LKZA 3H0OA 1OVPA 4GWIA 4XF0A 5FKCA 1KEXA 5FZ8A 2G4IA 3FN9A 1C5HA 5C9AB 3BU0A 1PM4A 2D93A 3VBFA 2R043 1IQAA 1BZWA 2VXRA 1D4M3 4KBBA 1VBC1 1I5PA 2GZWA 1LESA 1QJZA 4YABA 4QX1A 3SEEA 1PVC1 2VULA 2RE9A 1ACCA 4Q0UA 2IUWA 5F5QA 5APAA 2WZR3 5FZ0A 1UOGA 5DAPA 4WVWA 3T2PA 2DCZA 2Y38A 5AC92 1M4WA 5D1MB 2KA3A 4I7DA 3V0BB 4GZ9A 2BNOA 2KGGA 1UZWA 3AFGA 3C8XA 1TQ5A 3TNQA 2BUKA 3H9AA 5A3LA 3V0AB 2JKBA 1ULPA 1OBNA 3MZHA 3ZXEA 2YU1A 2VJEA 3RWKX 4A42A 5FDBA 3HEIA 3VKNA 1VJ2A 4FPLA 4ZPIA 3FL2A 3RGBA 2JDKA 2VPDA 1NCQC 2QVSB 2XVLA 2D44A 3FX3A 5FZMA 1EAH1 1XSRA 4JKLA 4OZXA 5CFCA 5CADA 2HYKA 3LF7A 3OEBA 3KHBA 4Y26A 5JMCA 4Y22B 3HNBM 2UY8A 2ZX3A 5FMBA 3UETA 3ZFGA 3ZLIA 4K20A 1JH5A 4EN9B 3L2YA 3WG2A 1VRH1 3ZPOA 1VALA 2EIEA 1MZ5A 4UYBA 1JZ2A 1CD3G 1V9U3 3KMHA 4ISRA 1QJY1 2IVIB 2JG8B 4ZKTB 4HN1A 4LE3A 2Q30A 2MIQA 2XJVA 3VGIA 4LO8A 2JE8A 4PLMA 4XFBA 3JD72 5E16A 2LXHC 4MVTA 5FMDA 5DUWA 5LBFA 3SHBA 4F8AA 3ZSMA 2C0ZA 1QJU3 2WT2A 3NO8A 3ZDVA 5BNPC 4AOCA 3MIDA 2ECJA 2R041 2YROA 3VBOC 1C1FA 1X8MA 2VU9A 4W8JA 2OUJA 3DKWA 4GQ7A 1EUUA 1YQCA 3P1IA 4JQTA 3ROUA 4B8EA 5D1KB 4YFZA 2JB4A 2WZ8A 4DUWA 1LGBA 2D3SA 4FFFA 5A3NA 5FP4A 3LQCA 1BK0A 4V1PA 1NYWA 3PUIA 4E4ZA 1S0EA 2E26A 3FC0A 2FQPA 1X7NA 1RXFA 3WNLA 1R081 2PLV3 5BNNC 3WW4A 4IDZA 5LK7B 2VZQA 2CKLA 5FPBA 2YHOA 4YVSC 1W6MA 2D6PA 2VQTA 4XJ9A 3ZYIB 4H3WA 4HT1T 1RUE3 2VJFB 1R093 1BJQA 1RUD2 1F31A 3OPWA 5JZGB 2DX8A 1J84A 4IV3A 5KBFA 4X6QB 2F4PA 4OUSA 4FPOB 1VD4A 4UFHA 5A7PA 3FANA 4QB2A 3PUHA 1PO12 1Q43A 4AZZA 2RR11 4W4ZA 4XF9A 2M1RA 5IFPA 3VHRA 4LEJA 1W6OA 5LEKA 1OHFA 2TNFA 5ACA3 2E7QA 4NHLA 1A34A 1HIXA 1CX4A 1SCSA 2A7AA 2AYHA 4HPKB 4N4FA 3DEMA 4Q4V3 1MEC3 1S0GA 3MW2A 2CV6A 4JGYA 5IJRA 1V9U1 1LEDA 2Y60A 2W94A 4MGKE 5K4LA 5FP8A 1LTEA 4K8RB 2YGMA 1YRZA 2VUCA 4Z2AA 2Y64A 5CG8A 5FB1A 1XB9A 1F9KA 4C1XA 3UKTA 3WZ1A 2GNDA 2P5BA 4HANA 3ZFFC 5FUIA 3LPFA 3MF9A 4HETA 4AFBA 2VNFA 4AI1A 3ZPYA 1X50A 4XAEA 3RFRA 4CE8A 4CPBA 1LB2A 2ECGA 3EHKA 1KJRA 1FOD3 2PAKA 1GWMA 2D8UA 1GR3A 2XJUA 4XAAA 2JIGA 1GNHA 1XU1A 1CQ9A 1YQ6A 2BZDA 3KZ4C 4IV1C 2GNMA 2W39A 4C8DA 4YM3A 1VMFA 2VH9A 1RINA 4UFJA 5G04L 3T2TA 4CP1A 4OCTA 3E6BA 5B77A 2PLV1 5FZCA 1WEMA 4IEUA 1CVNA 2YGLA 3OJBA 4YW1A 4DNYA 1H2KA 1BBT2 4AVVA 1Q56A 1FNZA 4QPIB 1ZRRA 2YC4A 4ZU7A 1W8UA 4QQ2A 1R091 2ZKNA 1U5XA 3JQXA 4FP2A 3U5NA 5F6LB 3KM5A 1PX4A 4P9JA 2YB7A 5H1VA 1QKQA 1Q5OA 5CA6A 5T5LA 2ZGMA 1UU5A 2B9VA 4DXZA 2X53S 3HQUA 3DWDA 1OQDA 5TBNA 4XMAA 2XDVA 3H1YA 1UIKA 1N87A 4FPFA 3EYPA 1NA1A 4AFMA 3Q9OA 1B35A 3SXWA 2HWB3 4LK6A 4Q0VA 1V70A 3SITA 1AL22 3TN91 1VBD2 4N53C 3ME2A 3BTYA 5KH9A 1H6XA 1MEC1 3HN3A 2UWAA 5JCTA 1PO23 2RG4A 5FRAA 2DCYA 2PQQA 2BDRA 3LSEA 2KWOA 3ASIA 4WZCA 2XMLA 2QBXA 1XE0A 5FCCA 5KXCA 1JYCA 2XJQA 2YZ4A 3MHHA 3B5LB 3IM0A 2ZTNA 2KD7A 5EWSA 3VBHA 5IAXA 1ND2A 2C9AA 5FZKA 1FT9A 1Y7BA 4M0HA 5FXXA 1VBA3 4Y1ZA 4AHZA 2Y43A 2AACA 2W3JA 3WD5A 2JDYA 2JENA 3SCGA 5CISA 4J1WA 2ET1A 1PGL2 1XNAA 2C9KA 3IMNA 3KGZA 3P6BA 5H9PA 2A6ZA 4BB3A 4BQ5A 1W8FA 2X10A 1UMZA 4OI1A 1EYBA 4QKNA 2WNVA 4YGBA 1BCXA 3M2MA 2V5DA 4HK9A 3AYAA 2YDEA 4FOWA 1NQJA 1UZYA 2DBNA 1WD3A 3VBSA 4IE0A 2CSYA 2QQMA 3BTAA 1W8OA 1DCQA 2QQOA 1H1MA 1SLTA 3R4UA 2HWC2 4E8CA 1QH6A 2VMDA 2ZEZA 4RYDA 3TWIA 4UP5A 4AI9A 2W92A 4IGPA 2P2KA 4NE9A 4PI2A 2OW4A 2HBUA 2DVAA 2VZ3A 3GZUC 2J1TA 3MUY1 4JVAA 1REDA 1RUF2 3OB8A 4LA2A 2DBIA 4DY3A 3SOXA 3S30A 4BOWA 5K9YA 5HXMA 5LRSA 5C8CC 2ZBJA 5SV5A 1GZWA 4AVSA 4COVA 4YZ3A 1ZX5A 4IE5A 3HJRA 4XCAA 1G9AA 3TEXA 1SZBA 4D0QA 4QXKA 3EXUA 4UOJA 2LGVA 5J36A 1UPSA 1ZZBA 1NLRA 4D8MA 2KU3A 4PIYA 3WVJA 5BY5A 2YT5A 2X5IA 2VPGA 2ZGUA 5ABJB 2CONA 3VZNA 1VBB3 5FMCA 1QJX2 1JODA 3ACIA 1Q3EA 3TB0A 2QICA 2YYOA 3WEZA 4AGGA 2XG3A 1C8NA 1KDKA 2VZRA 4E27A 2AZ5A 1FMD1 4R9CA 1O3TA 4OHYA 2KGIA 1MVEA 1YQ5A 2BGCA 5GKAC 2ZA9A 1NG0A 4XDPA 4I01A 4WM8B 2VL4A 3U75A 5FTTC 3E5QA 5L19A 4JHTA 1ZBE2 5FMOS 5KWRA 3A7QA 1DP0A 3WF2A 4FIPA 4HKOA 3RDIA 4D6QA 1XOYA 3UESA 4MLOA 1RUOA 1PMJX 5LK5A 1E4UA 4QU1A 3QCWA 5HBAA 1A8DA 2YHJA 5KR7A 4AR2A 1BLZA 2E9QA 3QLQA 1Q8VA 2RV9A 4RL7A 4MYEA 3WNOA 2E6SA 3WQ0A 2FD8A 2DUOA 1DF0A 2M85A 1CZTA 1FX5A 5FXWA 1YQ8A 3MFAA 3O1PA 5GLWA 4ATEA 1WENA 4GH4B 2I07B 3DXUA 4W6YA 1TME2 1W6NA 3I54A 1Y43B 3TEYA 5C4WA 3ZYRA 4RR3A 1HDKA 2JICA 2W2IA 5D21A 2VCCA 2WFF3 2WNOA 2LQ6A 3GHMA 4XF4A 1HB2A 4GNFA 4CCJA 5F5CA 5JMOA 1CPNA 5C9AA 4ISQA 4Q4Y3 4CDWA 2IXJA 3HTKC 1C8M3 1UYXA 4P9XA 4LO5B 4ZXEA 1AX1A 5JI7A 4INDA 3LCPA 1UN1A 5F3CA 4HFSA 1QXRA 4JTOA 4QPWA 1CZVA 3U4SA 1WEUA 2ZHLA 3NMBA 4DINB 2XOCA 3LDBA 5CAZA 2B5HA 2CU5A 3HBKA 4K3UA 1WILA 5FPVA 3B02A 2EA7A 2GC2A 3AL6A 3LFMA 4BISA 3PJYA 4RQPC 4U36A 4B4QA 1HXS3 3WCRA 3V0BA 1N1VA 1WFKA 1X8EA 3M4FA 2JG9A 1GP5A 3V0AA 4L11A 4EWAA 4FPKA 3LD8A 4QHOA 4R4ZA 2MNGA 5FYSA 5A6ZA 3MGUA 1FXZA 3PNAA 4YGEA 5EJ1B 3V64A 3BOWA 1SLBA 4LE4A 4IE4A 2BW8A 5FLIA 5FY0A 4FFIA 2D3PA 4S2DA 1WEOA 4Y24A 4HLTA 2VMHA 2IXKA 2R042 2XQRA 4GULA 5F32A 4B7EA 4E4DX 1RB8G 2FDHA 1V87A 4H2AA 2HWD1 4RGAA 1D4M2 3POBA 3DPRC 3CO2A 5A6XA 2Q1FA 4JDNA 4JZRA 4AEJA 5H1TA 5T52A 2MKEA 4BDVB 2QKDA 1YI7A 5CYYA 1W6PB 5C13A 5AC93 2VZUA 5JIAA 4XXPA 2JG8A 5A7WB 2O1QA 2WZR2 1WBLA 5DDJ1 4CXXA 3NG2A 2ZPXA 4FOQA 2WQZC 2HH9A 2XKOA 2AEZA 5FP3A 3ZMOA 1AR91 1OLQA 1RVF3 2ETEA 2WWSA 4XJUA 1CAVB 4ONUA 4YWAA 3LEMA 4XZUG 3FLTA 1PIV3 4Q4Y1 3IDAA 4PI0A 4D69A 2Y6JA 2VY0A 3AJYA 3PTYA 4ZZ8A 3EMRA 3BUCA 1F5FA 2GN7A 3HVDA 2ECVA 4MHRA 2VPEA 1OXCA 1SBFA 2CL2A 4R9DA 1H9WA 4B1MA 4URAA 2L75A 2YSJA 1RUC1 3W5MA 2P34A 3RI9A 2Y26A 2F4LA 4BLIA 2CHHA 1POQA 3J4UH 3LVQE 1WLWA 3LQHA 4G9SB 3HBZA 1DQ0A 4RFRB 4F83A 3H1WA 3AM2A 1DHKB 1W0PA 2ET7A 3JD73 4IEWA 2XR4A 2CGPA 1S55A 1W9FA 2OPKA 1LEMA 1V9U2 4E2GA 1SMVA 1W28A 2VJFA 4Q0QA 4E8DA 5LCWB 2YQLA 4DRVA 1J83A 2HDPA 2KKYA 5JZGA 2PTMA 5TABA 1RTVA 3VD3A 1ZYBA 2ZMLA 1GQPA 1ZNPA 1UIJA 4HVQA 1ENQA 1W03A 2OXBA 4NPMA 1W9SA 1I5ZA 2R16A 5A3TA 1ZRFA 5BPXA 5T55A 2VCBA 3FEHA 1QJU2 3FUOA 1GZCA 4WBBA 1GICA 2DCJA 3CJIB 4YM0A 1KDMA 4UFLA 4O64A 2QQNA 1OLMA 2ZX2A 4HPKA 1ZZ9A 5G05B 3ZFGB 4Q0PA 3VB9A 4DS0A 1ULGA 1CHCA 5AC91 1QJFA 2PYTA 3QBQA 2K0GA 1AR62 2E51A 4YW2A 4A7YA 4GJZA 3A0KA
chains in the Genus database with same CATH topology
1J3QA 1X82A 1UKRA 4LK9A 2PLV2 1GANA 3NV4A 2O8OA 3MIFA 1CAWA 2KWKA 3WNXA 1RUE2 1KS4A 1PMIA 2EIGA 3E5XA 4WM7B 4CZSA 1RUNA 2R6QA 5H9SA 1QWRA 2D5HA 1ULCA 4PBOA 5B78A 2OVUA 1D2QA 4LA3A 4A4BA 5KHGA 4F3JA 1IKPA 1X33A 5F6KA 3R05A 2CGOA 4C1WA 1LHNA 4DPNA 4GB32 5ACA2 3WDTA 4YG0A 1UX6A 3C6WA 1LDKC 3VZKA 4S3OC 5C11A 3J8F2 3JD71 1HRV3 1MEC2 4Q4V2 1UU6A 4QPIA 4IESA 2OYZA 1AVBA 1HX6A 2VNRA 3LA3A 3M3IA 4QPGA 2R0HA 3R4SA 4J1XA 4RD7A 5EJ3A 4KG0A 4S2HA 4QF2A 3ZXDA 5JLVA 1TMF3 1V6KA 1WCSA 3N9PA 3VN4A 5TDRA 4AVTA 2X29A 4K1ZA 2EXHA 4R2YA 2YU4A 3VHNA 2PNXA 4PCRA 2VW0A 4EWDA 2NN8A 1FOD2 4BZ4A 1W6OB 5T5JA 1OA3A 3O14A 2A3WA 2CWMA 3N36A 5B79A 3HQXA 1VIWB 4YVWB 5KH7A 3W58A 3O37A 1OLRA 5TSWA 4P9IA 1V6OA 4JGZC 1RUD1 3AP9A 1COV3 2DVFA 1KJLA 2ZKLA 3QH6A 3WDXA 1W0OA 4YYOA 3TYJA 1H1AA 1UAIA 4MUVA 4AEDC 3O12A 1HLCA 5JAXA 3ZNIA 4X3GA 3JZVA 4L8QA 3HT2A 5IK8A 1PO11 3I4IA 2Q5TA 3HR9A 2BQPA 2N7GA 3KB5A 3KQIA 1N1TA 1NXMA 1VBD3 3M7AA 4JV4A 2Q1MA 4GNDA 2UZGA 2ZOEB 3UKVA 2HWB2 3FBMA 5D8AC 3RYKA 3LOIA 2NAAA 4YLZA 3ZMNA 2JE9A 1AYN2 3WP4A 1OA4A 4LO7A 1PO22 1U5ZA 2DU0A 1FYUA 3FUQA 2XKPA 3O0VA 4HN0A 5FOJB 4SBVA 4JCKA 1FPN3 1ULFA 5BNPB 2YYRA 3VBOB 4LLFA 4XF1A 1U5YA 4AWDA 4AEMA 1HW5A 3NKGA 5BV6A 2GSYA 1SLCA 1I3HA 1WCDJ 4WV8A 1VBA2 2Q0AA 4M3CB 1WLCA 1Z0HA 4Q4W3 4BLJA 2D43A 4QF3A 4HK8A 3BB6A 3FZ3A 1YFXA 1EY2A 3NAPB 1BBT1 5E89A 5ABJA 1G9CA 1QQP2 3J9SA 4XFHA 3X29B 3DPLR 1BEV2 4QQHA 2CGNA 5LRRA 2LGKA 2BTVC 2JXAA 2C1FA 4WM8A 5L7OB 2GALA 1Q8QA 2Y0OA 3IDBB 1RUF3 5T3NA 2QUOA 4LBQD 4HVOA 1OPMA 1AXZA 3PURA 2VVEA 1AL21 3VL8A 1CR7A 1VBD1 4AYUA 3FLPA 1LECA 4OUMA 3UJQA 4AQTA 5FO8B 1QJX3 1POV0 5GZFA 1DLLA 1WW5A 5CFDC 3N9OA 4GH4A 3LWCA 4G3YC 1VBB2 3ZXFA 1MZFA 1Y3TA 4UP0A 3BALA 2KE1A 4D3WA 4OHWA 4R8HA 3UL2A 1C3HA 1N1SA 1PGL1 3T1LA 5IK5A 3ZIWA 4IV1B 3VBFC 3BU7A 1VFYA 2BVVA 4LHLA 1NQDA 4Q4W1 1SLLA 2KM2A 2UU8A 4CDQB 2XB6C 1S0JA 1NE6A 1UD1A 3L2HA 2GC0A 4EN0A 1QGLA 2MEV3 3GZTB 4EJRA 2X5IB 2HWC1 1PNFA 4FQZA 5CU1A 2I74A 3NSTA 1TE1B 3ZN4A 3ZX7A 3P3PA 4B4PA 2F6JA 1SFYA 1RUF1 4OI0A 2ZX1A 4XW3A 4I3PA 2WFF2 3LKJA 2A71A 4XBQA 3ZSLA 2ZS6B 3VZJA 1C57A 2Z5WA 1C8M2 1SBDA 5FLJA 5CFCC 2ZGRA 1EP0A 3LA2A 4JTNA 1D4VB 3SCFA 3VHOA 1VP6A 4HL0A 4J6GA 4L9BA 4ASMB 1W6PA 1QJX1 3NL1A 3JCIA 1YLLA 3EQEA 4LKAA 1K5MC 5GJ6A 1JUHA 2ZHNA 4MH0E 3AXDA 4YGCA 1XU2A 4I7CA 4YM1A 4YATA 2W52A 3AZWA 1PK6C 1HXS2 2GNBA 2WT0A 1POV3 4F52B 5D1IA 2IFWA 1ZBE1 4RR3B 1QDOA 1C4RA 1JOJA 3AYEA 1MS5A 3KCCA 2JEMA 3GBFA 2RS32 2W0XA 2ZABA 4CDWB 4B4RA 2VP7A 3M3OA 2PHFA 3N7MA 1URXA 5EV7A 3AYDA 1GZ9A 1C28A 3R0RA 3WHUA 3MLJA 2FSAA 1TME1 3E97A 4IC2A 3RSJA 3WW2A 4MSXA 5JOXA 4ORFA 2JG9B 4UW4A 3L1XA 2OXQC 1FP0A 1RC6A 2AH2A 4WZ2A 2HWF3 4RA0A 4P5OB 1RVF2 4IV3C 3WG3A 2ZHKA 4FXGB 3I8TA 5GALA 1PIV2 1QNYA 3CJIA 5KXEA 1RMDA 3IN9A 5DZEA 3ENRA 3AP7A 2R0FA 2WJSA 1KXGA 1HV1A 4I7BA 4AW7A 1RUH3 4DQAA 1O4TA 3DUIA 3ZYPA 1BK1A 2WSUA 4LBNA 2IXIA 4TSVA 4JGYC 4N3WA 1RUI3 4COZA 1WW6A 1KQRA 2OA2A 1OI6A 4XBNA 3VUOA 5LKTA 4DB5A 2CAVA 2D40A 1POV1 2LTNA 4PDWB 3W59A 4XHBA 3PLQA 4CEWB 1TNRA 4WM7A 4FOVA 2WT1A 4X8NA 3EO6A 4W6WA 2R49A 3IPVB 5T5PA 4K8FA 3I59B 4YFWA 1ASJ2 5HI0A 1ND3B 3BIWE 2KIZA 3MPPG 1D4M1 2YREA 2DFBA 5TDWA 3QD6A 3ZXLA 3MHSA 1AR63 1APNA 1YIPA 2WZR1 4LLOA 2PN5A 1F5JA 3B93A 4RFT0 2DUPA 3PMSA 1CAXA 2NMNA 1OOPB 2XJPA 3AKQA 3ILRA 3U5MA 2YC0A 4YRDA 4P9GA 3HN1A 2L5UA 1LOEA 4QQLA 2P3JA 2ZETC 4GA9A 1BYHA 2HKXA 2W68A 2ZZQA 3DN7A 3PJQA 1FV2A 2EGPA 1IS5A 2EXIA 4OHVA 5K8SA 1NA1C 1RJ7A 4C90A 4GB33 4XIOA 5HXVA 5K0UB 3WQ7A 3VBRB 1RUH1 4LADB 3GHNA 3J8F3 4YVWA 4LNVA 3ETQA 4KU7A 2YW8A 3IDEA 1HRV2 1YIFA 4YZ4A 3G6JB 2WIIB 1E57A 1CAWB 2LGLA 1ND2C 5C6CA 1QJU1 2EF6A 4XF3A 1J3PA 4D7YA 1AX2A 4URTA 1TMF2 4EN6B 3N9MA 3FWEA 1PZ8A 3B9IA 5FB0A 5FEYA 1AR61 3LA7A 1JHNA 4XBLA 2WNVC 5FREA 1X4UA 2MHFA 1DFQA 1HRI2 5DXDA 1RMU3 3VBSC 1UPIA 3R6SA 1RGSA 1N47A 5BNOC 5BXXA 1G9FA 3HCUA 2KWJA 4PTBA 5AITA 1RUE1 4BYYA 5BNPA 1MVQA 5GZDA 1COV2 4QPGB 2UWCA 3INAA 3M3QA 4S2FA 3VBOA 4FJCA 4LBMA 2XPJA 5FPZA 4PLNA 2CAUA 4M3CA 4YW3A 2Y1MA 4CDUB 4BIFA 3ZXGA 4LUMA 3O7OA 2DU1A 1DU3D 2BFUL 4GB31 3IKWA 3WY6A 5ACA1 3AMQA 3LQJA 1NCRC 3OTFA 1WD4A 3NAPA 4I0AA 3RYPA 3J8F1 2G9GA 1AYN3 4FCAA 4Q4V1 4Z07A 3BPZA 1ZZ6A 1V6JA 2QCSB 4LUKA 3VL9A 1CJPA 2ZX0A 4RGGA 1YFWA 5GZCA 3PVBB 1XXNA 4PPEA 1NOVA 4HBNA 4KGQA 4AVCA 4DZGA 4JAAA 5L7OA 1QHDA 2ZMKA 3AMHA 3ZPVE 3H3UA 1MM2A 3AB0A 3KNVA 4QM9A 1AYM3 1FPN2 3ZXAC 2XUMA 3AK0A 3ST7A 4MZUA 1AJOA 3ZYJB 1ULEA 3ELNA 4RS5C 1FOD1 3OCPA 3OF1A 2Z79A 2LM3A 3FHIB 3O0XA 2WLPA 4Y1UA 1YFUA 4QT6A 1G6NA 4Q4W2 2VNGA 5FBZA 1QQP3 2D8SA 2FUUA 4AVXA 1HYJA 3H7YA 2E7AA 3WP5A 1PNGA 1BEV3 1RMU1 4CEYB 2RJKA 3U4XA 2A3YA 2XJTA 1CESA 1G7YA 1MQTB 2XBO2 1VYXA 2ARXA 3ZFFA 5EYAF 4OHXA 3GV4A 4YARA 3RTRB 3D82A 5C4WC 2LDRA 1C5IA 4RSUA 2XJRA 3VZOA 1WEQA 1IS3A 2VQAA 1RHI2 4IV1A 1D0GA 3AZYA 3MICA 5A32B 3RWNA 2CNAA 3SNMA 4CDQA 2Z2SB 3LQIA 2HWB1 4GNEA 4WVVA 1JOCA 2I45A 1S0DA 1DBNA 1AYN1 1WMFA 4EN8B 2D6NA 4A3XA 1PO21 2BFUS 2QNKA 1YFYA 4NOTA 4YBMA 1F62A 1DGWX 2LN0A 3ZFEB 1H2LA 4XDQA 2G6QA 5SV8A 1SFNA 5AFEA 1XYPA 1FV3A 1J58A 2PHTA 5EFUA 2XVGA 4F7ZA 4EROA 2WS93 1VBA1 3WG1A 1FNYA 5KC5A 4V3LC 4XI1A 3KGLA 2DWRA 1VAVA 1DG6A 2KYUA 4CP2A 4M01A 4HKLA 3CF6E 5LEJA 5CG9A 3KCXA 3O0WA 2BEOA 4K7JA 1QQP1 3HAGA 2ZGQA 1Q8PA 1BEV1 4JQRA 4M0NA 4BH9A 4Z82A 2L80A 5B75A 3GBGA 2JG8C 2A6YA 3N7KA 4DOUA 2MEV2 1VAMA 1DQ1A 2K9ZA 2XHKA 5JSOA 1V6NA 5GM0A 1NY72 1NXD1 1UF2C 4FAGA 1LDJB 3O70A 5DUXA 4YZ5A 2VQ0A 3U5PA 4E9KA 1YXWA 1XNDA 2ZGLA 2VPVA 3ECQA 1LHWA 4YGDA 1G9DA 1S0CA 1GNZA 4WZ3B 4KWLA 3ES1A 1SBEA 1AF9A 2UYAA 1VBB1 1EPWA 2F6BA 3RQ0A 4AXOA 1H8TB 4HVRA 2VUAA 3JB8A 2QE3A 5KXBA 2MA5A 2Z42A 4CYDA 2UY9A 1VBE2 2W08A 5JZGC 1LENA 4O9GA 2RS33 1WEWA 2E6VA 1IPKA 2PELA 2XWBB 5T50A 2VOXA 4SLIA 3KT7A 1HV0A 3AKTA 1DQ6A 1GYKA 4CRQA 4QU2A 4AHYA 4TWTA 3DQVR 2DVDA 3MI8A 2MT5A 4R7EA 2KWNA 3VDDB 3ZYGA 3K48A 2QDNA 4KU8A 2ZAHA 2K1JA 2HJIA 4PDWA 2WNEA 1RUJ3 1CJDA 2EAAA 4TZDA 2WFF1 4MGIE 4CEWA 4XHXA 4YNIA 5DZFA 3IPVA 3I59A 1L3JA 2HWF2 2XL9A 1C8M1 1VB4A 3MFCA 1ND3A 4LO4B 5GZEA 4I2OA 3GBWA 4EV0A 1WE9A 1Y9QA 3OD4A 4N4FA 2LRIC 2WNUB 4EWEA 1O4YA 1UU4A 1MZ6A 3GNEA 2CSZA 1LODA 1TNFA 2XL7A 1WLTA 2FZ1A 2R063 2BBVA 4G4FA 5KH3A 5B2GB 3CL1A 4AQ6A 4A49A 1RUH2 2VECA 2OZJA 2HWE3 3AKRA 1OOPA 1HXS1 1H4GA 1AR83 1IHMA 1RUI2 2ZAAA 3IBMA 4QPIC 4XILA 2GMEA 2QIZA 4CA1A 4N43C 3MIBA 3ASLA 2RS31 4XFIA 2ZZJA 1BORA 1ASJ3 4GXLA 4CDXC 4L92A 3USUB 2D6KA 1FAYA 4KQ7A 1AR73 5I0RA 3D5OA 5K0UA 4XTPA 3VBRA 3QZVA 2VUJA 2GU9A 1NLSA 1AUYA 5IUQA 2R072 4K1YA 3B69A 5I91A 5JIUA 5IT6A 4AP4A 1SCRA 4ZU4A 1YCIA 4QMAA 4Y20B 4AGRA 3LZZA 1F8VA 1KRIA 1OA2A 5JR7B 1RVF1 5K7PA 1BMV2 4ASLA 1ONAA 4W4UA 1AXKA 5J37A 1PIV1 2XH6A 4IC3A 4FP3A 1UKGA 1CGPA 3N9QA 1WEEA 2GMMA 2V09A 3DPRA 5JI9A 4FTSA 2PHLA 5I8TA 5I0UA 4A7ZA 3N7JA 1YWKA 2D6MA 4NN0A 2RS12 2R061 1K5MB 3H1MA 4BE3A 2PFWA 1O3RA 2HWE1 2XWJB 1PK6B 1S1AA 3VBUB 1O5LA 3KT1A 4TYSA 3WG4A 1CAXB 1I9RA 2IWGB 1D0HA 5CNAA 5AIUA 3N35A 1X4IA 4D7TA 2QJVA 1ZM1A 4O9EA 1ASJ1 2RJLA 2VPBA 5EYXA 3PVNA 3U10A 4CDUA 2QQPA 1XE8A 1FBVA 5TRBA 1LR5A 4IEPA 3ZN6B 1AJKA 2WINB 4X6RB 4V3KC 3ZVYA 1MS8A 1IPJA 1HRI3 4IXLA 3O7AA 1UZZA 1A8MA 1GFF2 4LBKA 2YHNA 3TAYA 5ABJC 1GQGA 3OYWB 2NM1A 2IXLA 2ECIA 4YADA 3I7DA 2HEYF 4QQPA 2VVDA 1RMU2 3E6DA 4FPGA 3H7JA 5GLTA 5JDBA 1LHUA 3L11A 1QOOA 4WM8C 1NCQB 4FOYA 5A33B 3AP6A 2XB1A 4AYCB 2ZCWA 1KD7A 5H1UA 2SLIA 3WINE 2B7YA 1VLNA 3FE5A 4GWNA 1LKNA 3NVCA 5EXOA 3IT8A 2H0DB 3M63A 5I8YA 1ZBA2 1I6XA 4AUQB 1WMDA 5HCBA 3OGJA 1MS1A 4AI2A 4W65A 1YUDA 4XMIA 4KG8A 4CEYA 5CB7A 5DG1A 2ECTA 1MQTA 1HRV1 1WA4A 2DV9A 2ZGPA 1BVVA 3MF6A 3R4DB 4GH4C 4META 4NR1A 5EZWA 4AG4A 2EALA 1JTZX 2GN3A 4CCGX 1C1LA 1QH7A 5GLZA 3HCSA 4BCUA 4KWKA 2CYFA 1IYMA 2ERFA 1LOGA 3AJZA 1TMF1 4Y5Z0 4ZU5A 5A32A 1G9BA 2PA7A 2G45A 1AYM2 3SH3A 3VZMA 4DY5A 5AVAA 1DYKA 3H8UA 2YSMA 1A78A 2XLFA 3AZZA 2A3XA 3MW4A 2RM23 2LV9A 1MS9A 1HRI1 2D98A 4NN2A 3K51A 3MEPA 5BNNB 3PVOA 4WZ0A 3M99A 2BWCA 3HIFA 2XBO3 4YVSB 3ZXKA 3ZFEA 4Z1VA 1MS3A 4XPVA 1O3QA 3AMPA 2LUWA 1COV1 2H0VA 3SISA 2DVGA 1F2NA 2GC1A 1Z60A 5C8WA 4Q1PA 4XOGA 2PHUA 3MYXA 1WW4A 1RHI3 4KGGA 1S2BA 4YZ2A 5I0SA 2ZMNA 4XJAA 5GLUA 3ZIXA 3ZO0B 1YYNA 3WOGA 1W6QB 3ZVXA 2VNOA 2E7TA 1GSLA 3EBRA 3OBTA 4QGLA 2VMGA 1MACA 2C5DA 1LGCA 4NWWA 2D7FA 3NV2A 5AFBA 4BQ1A 2VW2A 4YG6A 4YG3A 4FBFA 3P3NA 5FOBB 1WIMA 2ECWA 4M00A 1W39A 5E1RA 4A0CD 2NP0A 2BPA2 4BIOA 4XFCA 1ZA4A 3ZFFB 1FPN1 2TEPA 3AFKA 4YW5A 1R1A2 3V65A 1XYNA 4PJYA 4LJNA 2PHWA 4AE2A 2B39A 5DG2A 1ZRDA 2WS92 1LHVA 3GZAA 2NPIA 4P14A 2JJ6A 4I3GA 3KLSA 4Q4X3 1OQEA 4FK5A 4YAXA 3B01A 1RIRA 4MV2A 4AHWA 2WA3A 3OD0A 3KSCA 4MGYE 5BNOB 2VGDA 1OPOA 2XBO1 5J3XA 4QGNA 3N3HA 3ZN5A 4FTEA 2HYED 1OQ1A 5G0FA 1H8TA 4PQ9A 4LULA 3WDUA 4QQOA 4FSJA 3EB6A 4C9ZA 4RHV3 5J7MA 2VG9A 4COWA 1V6MA 2ZJCA 3DV8A 1PGW2 2HEVF 4AI8A 1BXHA 1H0BA 1RHI1