4MVTA

Crystal structure of sumo e3 ligase pias3
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
283
structure length
255
Chain Sequence
DVTMKPLPFYEVYGELIRPTTLFEEAHFTFALTPQQVQQILTSRDYTIQVQLRFCLCETSCPQEDYFPPNLFVKVNGKLCPLPGYKRPSRPINITPLARLSATVPNTIVVNWSSRNYSLSVYLVRQLTAGTLLQKLRAKGIRNPDHSRALIKEKLTADPDSEVATTSLRVSLMCPLGKMRLTVPCRALTCAHLQSFDAALYLQMNEKKPTWTCPVCDKKAPYESLIIDGLFMEILSSCSDCDEIQFMEDGSWCPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 SUMO-protein ligase PIAS3
publication title Crystal structure of SUMO E3 Ligase PIAS3
rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 63
structure length 255
sequence length 283
chains with identical sequence B, C, D
ec nomenclature ec 6.3.2.-:
pdb deposition date 2013-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02891 zf-MIZ MIZ/SP-RING zinc finger
A PF14324 PINIT PINIT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.780 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4mvtA01
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4mvtA02
2D8SA 5EYAF 2KU3A 3ZPV1 3U5OA 1DVPA 2H0DB 3O35A 4S3OC 3GV4A 2LV9A 5B75A 2YT5A 2YHOA 5AITA 2C2LA 1G25A 3HTKC 2KIZA 1FBVA 2JMDA 2G6QA 3FL2A 2KFTA 3C6WA 4B86C 1Z60A 2MA6A 3O34A 1IYMA 2MNZA 4PPEA 2VPGA 4LK9A 2LGVA 2K4DA 3U5PA 1WEMA 3O33A 5LKTA 5H1VA 3PURA 4YBTA 1CHCA 1JOCA 5I3LA 1HYIA 4S3OB 2YHNA 3RTRB 4WZ2A 1WGMA 4V3KC 5H1TA 3T6RA 4GNEA 2C2VS 4LKAA 4CCGX 2HYED 3EB6A 4A4BA 5D1MB 2L43A 2LGKA 3ZVYA 4FJCA 2RSDA 3MHSA 2LQ6A 4TKPB 2YURA 1WFKA 2VPBA 2VP7A 1U6GB 1WESA 4I7DA 3N9QA 4P5OB 5D1LB 2JMIA 5G05B 3M62A 2VJFA 2LN0A 5LKUA 3LRQA 1Z6UA 3RPGC 2EA6A 3ZVZB 2K17A 1XWHA 2YUCA 2DX8A 3I2DA 3KV6A 2E6SA 2ECVA 2VNFA 4YABA 4YADA 4LJNA 2RI7A 3HCSA 3N9MA 2NAAA 5LKXA 1F62A 1X4JA 2LGGA 2KWJA 3DQVR 4YATA 2VJEA 2EODA 3RPGB 2YQLA 3O37A 4AUQB 2ECJA 4AP4A 4R8PK 5TBNA 1WEUA 2FSAA 4O64A 5G0FA 5TDRA 4PTBA 3ZYQA 2BAYA 3KV5A 2JMJA 3N9LA 1WILA 4BHWA 2M3HA 4WZ3B 2AN6A 1JM7A 2KGIA 2CSZA 3ZTGA 4WA6A 4C9ZA 4UP5A 4UP0A 4AYCA 1X4IA 2L5UA 4F52B 1MM3A 3KQIA 2ZETC 5KH9A 2L80A 5KH3A 2KE1A 1ZBDB 3KNVA 4GB0A 4FK5A 3DPLR 2VPDA 4X3GA 3ZPVE 5C11A 2LXPC 4AVXA 2IDAA 2UZGA 3SOUA 1RMDA 2HDPA 1WEEA 2YW8A 1WEOA 4ZDTA 2QICA 3NG2A 4YAXA 3N9PA 2I50A 2EGPA 3HCTA 2VJFB 2KYUA 5LCWB 5FERA 5LKZA 4A49A 2L75A 5TABA 2QIZA 5G04B 2CKLA 4R2YA 4YC9A 2G45A 5B8DA 3L1XA 1HYJA 3PUQA 3U5MA 4BBQA 2XB1A 2MNYA 2LDRA 5JG6A 2YSJA 4YBSA 3L1ZB 5C13A 1V87A 2LRIC 2QJ0A 2K16A 4N3WA 4YBMA 2ECNA 4NN2A 4L7XA 2Y1MA 2M85A 1T1HA 5FB1A 4UI9B 2PUYA 2G43A 1X4UA 2JRJA 2FUUA 1WIMA 2KR4A 1MM2A 3U5NA 2K1JA 2PNXA 4B7YC 5B78A 2OXQC 2YQMA 4ZUXU 3M63A 4GNDA 1VFYA 2KWOA 2M6MA 3PHDA 1VD4A 5B79A 3QZVA 2E6RA 2H0DA 5TRBA 3V43A 2CT2A 4QF2A 3LQJA 1WEVA 2FUIA 3SOWA 2YU4A 4XI1A 3T7LA 1JM7B 1K2FA 4GNFA 3C5KA 2LGLA 4FO9A 4AYCB 2ECTA 4V3LC 4L58A 3M99A 3ZNIA 3SHBA 3MHHA 2F6JA 1E4UA 1LDJB 5DKAA 1WEWA 3O36A 2MD8C 2ECWA 1VYXA 3EB5A 1LDKC 5J3XA 4QF3A 3VK6A 5FB0A 3N9NA 4IC3A 3N9OA 4W4UA 1BORA 2MUMA 4A0CD 2LXHC 2XEUA 2F42A 4R7EA 1FP0A 2Y1NA 4LADB 4I7BA 2MD7B 1Z2QA 2KWKA 2F6NA 4I7CA 2KWNA 2CKLB 4FIPA 4WZ0A 2YSMA 2KREA 4LLBA 5DINA 1WE9A 4CA1A 4N4FA 2ECIA 4GNGA 3ASLA 1WENA 2M1RA 5B76A 3LQIA 2YREA 3IHPA 5D1KB 2MIQA 5TDWA 3L11A 3O7AA 3SOXA 1WEQA 4A4CA 4Q6FA 2CSYA 2KGGA 2VPEA 5KH7A 3GL6A 2L0BA 2ECGA 1WEPA 4MSXA 2VJEB 2Y43A 5FEYA 5H1UA 5AIUA 1N87A 2MT5A 3O70A 2YYRA 3LQHA 5H9MA 2MA5A 4MVTA 3HCUA 4IC2A 4ZQLA 5B77A
chains in the Genus database with same CATH superfamily
2RI7A 2QQPA 1PIV2 5EJ3A 2KU3A 4QPYA 1H0BA 1KD7A 1ALYA 2GNBA 2W9XA 1RUH1 1ZM1A 3LOIA 3DKQA 4BQYA 3VBRB 2VQ0A 1JXNA 4Z2AA 3D82A 1ZZ6A 4YGDA 5IAVA 1RC6A 4JGYB 2CWSA 5EYYA 4MZUA 4LT5A 3VHNA 3H1WA 5IK8A 3HVDA 2VMDA 5AVPA 5SV8A 3TN91 1NY71 1J58A 2BEOA 2VOWA 3SKVA 4BK5A 3ZSKA 3D8CA 2JG9B 1LU1A 3E6DA 1UZYA 4SBVA 4BH9A 2PHXA 1SFYA 1G25A 2WC2A 1QKQA 4AEDA 5A1AA 2D3RA 4W6YA 3ZYBA 4QDQA 5GLWA 3BTZA 1PGSA 4HKOA 1ONAA 1W2UA 3MZHA 2G6QA 5IVEA 1YJLA 3VHRA 1SDWA 3JZVA 3O34A 2ZX2A 2VBBA 3LIHA 4AVCA 3WF1A 5JOWA 1BHGA 3TOJA 2XR4A 2FDIA 4WVVA 4PPEA 2BW8A 1FPN2 2Y0OA 3ECQA 3UKVA 1JUIA 2LGVA 3ZFEB 3ACLA 4AQTA 5F1RA 1HN1A 4XF1A 1S0JA 4CCCA 2AREA 1WCQA 2GN7A 3B01A 3WDUA 1LOAA 4MXWA 3PURA 5H1VA 4XCAA 1LEDA 1TG7A 2DV9A 4S3OB 3N3HA 3O1OA 3VD4A 3RTRB 2YBSA 3IZOA 1YUDA 2J1RA 3MEPA 4N53C 3WX5A 2QVSB 2AH2A 5H1TA 1AYM2 1DF0A 4JGZC 3MI8A 3KDEC 2QZ2A 3MFAA 4OI1A 1W9SA 3J7MA 2Z2SB 4KG8A 2X5IB 5LBEA 1JZ3A 5A7SA 4GNEA 4LO4B 5LA9A 1LOBA 2KXLA 1G6NA 3WINE 4CCGX 1R1A3 3ZPOA 4LHNA 2HYED 2AEZA 3ZOIA 5FYTA 4JHZA 2EVXA 4L8QA 5FK7A 1AX1A 4A4BA 4RS5C 2W1SA 1G9BA 1UIJA 2L43A 4P00B 5FKBA 3AC0A 1LB2A 4GWNA 4CCJA 4XVHA 4O7XA 5K8SA 1S1AA 2LQ6A 2NM1A 1IGOA 3IAQA 4Q4V3 1NOVA 1DQ0A 1U6GB 1R1ZA 1ZRCA 2Z5WA 1JYTA 4FPEA 3MV11 4CEYB 4FPGA 1WESA 1YQ6A 2A70A 2EGMA 4Y33A 4N9IA 4C0HA 1U12A 2C4XA 4O9EA 2DF7A 2K9ZA 3PIJA 5BNPA 5J48A 2DU1A 4W8JA 4E4HA 3WF3A 4CDUA 3M62A 4HOOA 3W58A 3SUBA 2DTYA 2HKXA 1U5IA 3JBG1 1YIPA 2VGDA 2LRPA 4C90A 2VJFA 5GZFA 5HCBA 1C8M3 5A3NA 4P9IA 3MPPG 2DCZA 2SBAA 4K40A 5D8AA 1WD4A 3LWCA 1YI7A 3WF0A 5A7NA 1FI2A 1XYNA 3WVJA 3I59A 1JYVA 4NO4A 3Q8AA 2EA6A 2J22A 1QJX1 4YRDA 5T5LA 3NNFA 5EHDA 4KWLA 4M00A 3ZVZB 1RUF2 1VRH3 3MLJA 5F2SA 2RS31 4LBOA 3D3AA 4M3CF 3O1MA 1BJQA 4BQWA 3RI9A 2CRWA 3R0RA 4FPOB 4EN7B 3JD71 3V0BB 1WLDA 2HJIA 4IEZA 4JKKA 2E6VA 4K20A 1YC61 4O61A 5IVVA 2X8KA 1ULGA 3I4IA 3KMHA 1QOTA 5AFBA 1H1IA 1LR5A 2QQOA 1YI9A 2NMNA 4Y24A 2L7PA 3FM8C 2ECVA 2ZHKA 2YUEA 1APNA 1ZBE3 4DRRA 1PK6B 1JBCA 2ZGRA 3RYRA 4BZ4A 2NAAA 1QNWA 1YCIA 1GSLA 4GZ9A 2D7FA 3ETQA 4RR3C 1S0DA 3RZJA 3DECA 3O1RA 1CWPA 2ARBA 4DMIA 5LBCA 2VTXA 4ZHNA 4GB33 2LGGA 4XJAA 3R4SA 1W6QA 5M0TA 3O5SA 5FRAA 1LOGA 1QJFA 1QOOA 1VBE2 4CDXC 2WABA 1JHNA 2VNGA 5LEKA 2RG4A 3JUUA 5LK5A 3GJBA 5SV5A 5ABJA 3MF9A 1RHI2 1COV3 1W3XA 3AJYA 1UOJA 1PNGA 3RPGB 2CGPA 3JB8A 4A7ZA 2VOKA 3LOBA 2YQLA 5ACA2 1IPJA 1FATA 4FPFA 3ZSMA 1DGWA 4BLJA 3LDRA 4N90A 2RS11 1WLTA 2TUNA 1XU2A 4FPKA 2GC1A 1CZSA 1NA1C 2WNUC 2P1BA 4NHKA 2PHLA 3AZZA 2HWB1 3SLIA 2D6KA 5FY5A 1RIRA 1AYN1 4P9YA 3NKTA 1WEUA 3U1XA 3NVCA 5TDRA 2VE1A 4AEDB 2BAYA 4BQ2A 3AMQA 4MOAA 1ND2C 2Y33A 1JI6A 3BTAA 4OHZA 3CF6E 4Q0UA 3VDDB 5C7GA 3M70A 3VD7A 2ZMNA 1UY0A 3AL6A 2ZX3A 1CX1A 4META 2JMJA 2ETEA 1TME3 3N9LA 3FFZA 3UYJA 4CUCA 1WILA 1KFXL 1VPHA 4QX8A 3HPNA 5CFCA 3LKJA 1EV11 2KGIA 1DDLA 2IXCA 3I54A 4YVSA 1F35A 2H0VA 5J09A 1RUJ2 3ZN5A 1NQJA 2ZX0A 4U2AA 1QNYA 4UW3A 4XUOA 3ZYRA 4BXSV 2CDPA 2RVAA 1X4IA 3P3PA 4RFRB 3VL8A 1W03A 4IEWA 1RMU1 3NAPA 4QHOA 1G9AA 4F52B 3KQIA 2B0OE 2RHPA 4YM0A 4MXWB 5KH3A 4LR4A 5JXIA 1HB2A 1C5IA 1MEC3 1QQP2 2EIBA 2ZGUA 4FVVA 2JB4A 4Q1PA 4LO5B 5F2WA 4D7YA 2XOZA 3POIA 1TMF1 2A6VA 4LORA 1NUKA 4RGKA 2DCKA 3WNOA 3NO8A 5C70A 5K0UC 4YZ4A 3K3NA 4NR1A 3J7HA 1DGRN 3RPQA 1CX4A 1FAYA 1XE0A 2WFF2 3PJYA 4LOTA 4XCBA 3VBHA 5CKNA 4GKXA 4CXWA 1RUG2 3I97A 2XQXA 4N7IA 5C11A 4CEWC 3IAPA 1UY3A 2CDOA 2JECA 3OPWA 3D0JA 1HRV2 4K6BA 4Q4X3 1UOGA 4AHWA 5A3TA 5T5PA 4AVXA 2EIGA 2GP3A 2ZZQA 1J3RA 3FFQA 4LMFA 4H7LA 2B9VA 4TTGA 5ISLA 2VULA 3B02A 3GNEA 1OKQA 1RMDA 4OMCA 3H3LA 3N7MA 3RZHA 1LNSA 4IEVA 5GLUA 4Z0RA 4PF1A 4XBLA 4R8HA 2Y6FA 4AHXA 2Q5TA 5CA6A 5LRSA 1WEEA 1XNBA 2W92A 5FXVA 1HKDA 1EAH2 5FY8A 5C9AA 2E51A 3VKFC 1JTZX 2D6LX 2QQWA 2ZBJA 3N9PA 5BNPB 2I50A 4CDUB 2HWD2 5BUVA 1E5HA 1VMJA 2XG3A 3LEMA 1D4M3 4XILA 5DDJ3 5EQUA 4CZSA 4ZU7A 1BK1A 2WR9A 3EJKA 2KYUA 2LAUA 3MIBA 1HX6A 2NP0A 1DBNA 2YPJA 1AX0A 1J1LA 1WMEA 2WZPP 3VBUC 2IUWA 2LM3A 2VZSA 5F32A 4NE9A 5F37A 5JOXA 4A49A 2HYKA 1MVQA 4JGZB 3T1LA 1KRIA 2PELA 4E2GA 2WWJA 1IS3A 2Y6GA 1JU4A 1N1YA 3FHIB 3N35A 4MYEA 4R52A 4QM9A 4LO7A 1OA3A 2A5ZA 2ADDA 3RZZA 3ZXGA 1CAWB 2PHDA 3WDXA 2PAKA 5A7QA 4W65A 2OT7A 5K7PA 3AMNA 3PNAA 5JIAA 1VBA2 1HYJA 3PUQA 2DUOA 2XB1A 2MNYA 3U78A 4RGGA 2PLV2 2QQKA 3PLQA 2Z69A 2Y64A 3DYMA 1V87A 4UFKA 3AVSA 1GKBA 5EZWA 5FFOC 3OBTA 3ZXLA 1ZA7A 1ZX5A 4LBNA 4GWMA 5I0SA 5JXHA 1H8VA 2K16A 3BCWA 3PU3A 4YBMA 5FWJA 2I07B 4G3YC 4NHYA 5LCWL 1LHVA 5A7PA 3OGGA 1Z7S1 1W2AX 4X6QB 2WUHA 2D6PA 1T1HA 3AZVA 5G04L 3BGAA 1OOPA 4B4QA 5FLIA 5BNNA 1PGL2 1W6QB 4NWWA 2RMU3 2WNVA 3ZXKA 3AM2A 4KI5M 4XC9A 4RN5A 5FZAA 3ZFFA 5C71A 4CXYA 2P57A 2V4VA 2ZGQA 4XBQA 2FUUA 5ABJB 4ZPIA 2GU9A 5KWRA 1MZFA 5LEJA 2OXBA 1WGPA 1O3TA 1RL3A 4J1XA 1UXXX 1ZRDA 2OUJA 2AEYA 4BK4A 2HWC2 3JB4C 2OXQC 3EMRA 1G9DA 1R1A1 2D43A 3M63A 1LULA 2HEVF 5L9VA 5A7OA 1VFYA 3T2OA 2M6MA 1UPIA 2WT2A 3PHDA 4H9DA 5A3LA 5FZ3A 2ZA9A 3QZVA 3AKQA 3DPRB 5B79A 1P8JA 2QQIA 3SHRA 1ACCA 4TWTA 2OVUA 3USUB 1LTEA 4QB1A 5C3SA 4YGEA 1K12A 3PL0A 5L7OB 2FHRA 1PMIA 2WFPA 2B9UA 1HJFA 4CA9A 2H0DA 3V43A 3DKWA 4Q4V1 3TB0A 5FLJA 3ZDVA 1SBFA 2CT2A 5DMYA 3ORJA 4QF2A 4F3JA 3DF0A 3WW2A 4XAAA 3A0NA 1MVEA 4GAZA 4NVPA 2QJVA 2YU2A 3UGFA 2FDFA 4XURA 4RR3B 5IHRA 2A6XA 2W52A 4HVOA 1PO13 4DUXA 1GNZA 2YU4A 1CD3G 5F6KA 2NN8A 4I3GA 1K2FA 3KD4A 4YVSB 1RUD3 5C4WA 2P4EA 4XZUG 4IEUA 5FXZA 1TEIA 3Q8EA 1C8M1 4QHBA 4I01A 5JSOA 1YLLA 1X82A 3H7JA 4FTBA 5DAVA 3NAPB 2AACA 3H42B 1JYXA 3OYWA 3RWNA 4EROA 3V65A 1VRH1 2ZAAA 4Y4RA 3OCPA 3QACA 1VBD1 4GH4A 3H3ZA 1BMV1 4MGZE 1WMFA 2VNOA 1NXMA 1DU3D 2HLEA 4YNIA 2WZR2 3WG4A 1OC1A 4XFBA 1YEWA 1WEWA 4IESA 5FO8B 1ZZ7A 2YU1A 3QLQA 3VBHB 5FR3A 2ECWA 2ZMLA 2R043 4FXKB 2KKXA 1POV3 4N7UA 1VYXA 4FFIA 1QJEA 3EB5A 4LXLA 2ZX1A 4CE8A 1ND2B 5J3XA 4QF3A 1POV0 3CBNA 3VK6A 1DP0A 1ZBE1 1AL0G 1NCRC 1VBB3 3ZLIA 5FB0A 1WA6X 3O1VA 3N9OA 4P9WA 4A44A 5C3OA 5LZ6A 2EXIA 5FZ7A 4NN0A 1BORA 1YFUA 3ZYIB 4I3PA 3W5NA 4UW5A 2IQJA 2LXHC 3ON7A 5JCTA 2RR13 3WP4A 2BOIA 4GB31 2Y1NA 1OVSA 5IVCA 4OULA 4FFHA 4QU1A 1FMD3 2W2IA 3ZSJA 3F2ZA 4AVAA 4YZ5A 5D1IA 2YYOA 5C9AB 3DXTA 3M1HA 4PBOA 3UETA 2MD7B 4ZXEA 2DBNA 1COV1 4OLLA 1HB1A 4AAPA 4BHPA 5CFDA 2KWKA 5K4LA 2E32A 1U5ZA 4GQ7A 4PQ9A 2WO2A 3TEXA 4OFGA 3AP9A 3IIAA 4L2NA 1A8DA 3WP3A 1HQNA 1SBEA 2XBO2 1QJU2 1L7LA 4CDQA 2NYYA 1XNTA 5D21A 3NNLA 1Y3TA 5K0UB 1DZTA 4AVVA 3EHKA 2JM3A 1LOFA 5C8WA 1IS4A 3J7LA 2PHWA 2KREA 3ACGA 3MICA 1R093 1QJZA 4CA1A 3ATGA 1OMIA 3M7AA 2OX0A 4BMBA 1US2A 4LUMA 3IDBB 4AGRA 4K8RB 4QX3A 3KB5A 3P3NA 3J8F3 1MACA 1WLCA 3BB6A 1LHWA 1JH5A 1RUI3 3IMNA 4QKBA 3WW3A 1MS8A 1QJY2 1SHWB 1TME1 2OUHA 2XJQA 2ZKNA 3NRUA 2OKXA 3UK9A 3VBRC 1WENA 2RJ2A 2M1RA 2VW1A 1LHNA 1KGYA 4R4ZA 1C57A 2MNGA 1I3HA 4CVUA 3B93A 1DGLA 4UBGA 5CADA 4KBBA 4RQPA 4Z92B 4OHVA 2MIQA 3IHPA 5D1KB 1SLAA 3O7AA 4MUVA 3SH4A 4BYYA 1ENSA 2HWE1 1UOBA 2JG9C 1OPMA 1ULDA 1ZA4A 4Q6FA 2AUYA 1W2TA 2RM22 2XLAA 3AZYA 2OQ6A 3PTRB 4AQ2A 1HRI2 1OOPB 5BNNB 4OVEA 1CESA 2XVLA 1GQHA 4KWKA 2RS53 2VY0A 1O5LA 2WNVB 1LOCA 4XIOA 4MSXA 3ZFFB 3ZVXA 2YBPA 3CO2A 4K1ZA 2TBVA 5JI9A 3U75A 5FEYA 2E61A 4IETA 5AIUA 1N87A 3O70A 1NY72 5FYZA 5KHIA 3RFRA 1DLCA 5EPAA 3G6JB 1H4HA 4ATEA 3FX3A 4M3CA 4I02A 4B3NA 2CSGA 5GJ6A 2CNAA 2CTVA 2NPIA 4D8MA 4Z8BA 3OOXA 4IC2A 4AFAA 1CN1A 5JI7A 5KBFA 4JDNA 2PTMA 1H2MA 3ZFEC 3OPZA 2JICA 2FQPA 4Q4X1 1S4CA 2WLPA 4OUSA 4GWJA 2D40A 2VQTA 2BQPA 4G4FA 4FFFA 1V9U2 3U5OA 1E57A 1UX6A 3RJ2X 1DVPA 1AUYA 1GMMA 1G9FA 5FPLA 2H0DB 4S3OC 2YFUA 3MDBC 2LV9A 1XU1A 1LGCA 5HV4A 1WW5A 4JKMA 5T55A 2ZHLA 1UWWA 1ODMA 1UX7A 4SLIA 1QWRA 3OEBA 4UF0A 5IWFA 3POJA 1GWMA 4OUEA 1NYWA 2X5IC 4JC1A 4IEQA 1SDDB 1JMUB 1UMIA 1CPMA 1OLQA 2R32A 2D3SA 4YYOA 2Q8DA 3ZKYA 3HNMA 2ET7A 1I5PA 1VAVA 3AB0A 1D4M1 3OBAA 2GMPA 5C4WB 5IATA 2JDAA 1XNCA 2A3YA 1IPSA 5IAXA 3GBGA 2KIZA 2JMDA 3TYJA 2LS6A 2WO1A 5FYCA 3V0AA 3C7OA 1LGBA 4TN7A 1SFNA 1RITA 1W6NA 3W9AA 1V0AA 2MA6A 4NPLA 2ZXQA 4URTA 2Q30A 1PHMA 5CYYA 1YHFA 4LHLA 2VZRA 2GH2A 5IK4A 3ZN4A 2BGCA 2HBUA 2BGOA 2WAAA 2Y6HA 4YW7A 2XUMA 4CEYC 5I0RA 1CGPA 1VBC2 2VG9A 3W5MA 1ND3A 1VMFA 4NRPA 1RUOA 3CHXA 2GC0A 4S2HA 3POBA 1Y7BA 4IDZA 2R062 3U5PA 1LJ7A 3VBSB 1H1MA 2WL1A 3ZFGA 1WEMA 2CRRA 3O33A 2C24A 2ORXA 2Q1ZB 4FXGB 4Y5TA 4WM7A 5LB6A 1OA2A 2XJSA 5I3LA 2RJLA 4BDVB 1U5YA 5GZDA 4Z1VA 4AR2A 3MIFA 4IE7A 4YFZA 3K46A 4H14A 2YHNA 1NX9A 4QAWA 1DHKB 4XUTA 2B7YA 2P17A 2WA4A 2XVGA 4LOSA 2ID4A 2VMCA 2J1TA 2WQZC 4BOWA 2WYFA 4MO3M 3ZYFA 4LKAA 3UJQA 1OBNA 4AXOA 1N1TA 2RMU1 4AF9A 4V2VA 1OUXA 4ISQA 4Q4Y3 3BODA 3CJXA 3LDBA 4NPMA 3S30A 2XQRA 5JLVA 5D1MB 2DVFA 1AJOA 1KEXA 3I2HA 3RVHA 4Q29A 3ZVYA 2A3WA 2YURA 3DYPA 5CFDB 4K7JA 1PZ7A 2VPBA 1OKOA 4DFSA 5FBJA 4HANA 4LLOA 5GALA 4O65A 4CDQB 4I7DA 1ZRFA 4CU6A 1AR72 4P5OB 3PDQA 2ZACA 2VO5A 1CJDA 5KC5A 4JQRA 4C1WA 5JZGC 3E6CC 2JMIA 1ENQA 5G05B 5A3WA 3BPSA 2ENRA 2WN2A 2ZKLA 1SEFA 1AF9A 3I2FA 1X36A 3ES1A 3MDPA 3MHZA 3D0SA 2YMZA 4G9SB 4XQDA 2LN0A 4M0NA 3KCYA 1LENA 2RDNA 4S2GA 4A2UA 5EV7A 3AMHA 3VD9A 1S0GA 4HVQA 4HBNA 4QPIA 4LE4A 1VR3A 2A6YA 3RPGC 4OQ8A 3SQOA 1AR62 2EAAA 1E5RA 5EWSA 4KH9A 2VM9A 5FZ4A 2Q1MA 1PO11 4BXFA 2YVRA 4DO0A 2K17A 1L7QA 5HXMA 2WO3A 3A4UA 3QH7A 1O5UA 1RUD1 1UYZA 1JN2P 3N7LA 3KT1A 4RQPB 2DFBA 3BKZA 2MEV2 2WSUA 1PM4A 2A3XA 3NNGA 4MGIE 3OG2A 4LKSA 4IEXA 4ARXA 4FAHA 4HPKA 3KCXA 2NQYA 3TNQA 4QKFA 4WVMA 1BCXA 1QHDA 1DGRA 2W68A 3KCCA 4CSWA 4YSFA 2Z4FA 2RDSA 2YZ4A 4NAMA 2R072 4LLFA 3THTA 4RHV2 3ZN6A 3EO6A 4AEDC 3WQ1A 3PHMA 3SITA 2UY8A 4YABA 4Q8LA 1WCUA 4RGAA 1VJ2A 2UWAA 2YFZA 4XTMA 2QNKA 1XNKA 1UW8A 4CCNA 2BGPA 3N9MA 4N43A 4CUAA 1UF2C 2IXJA 4PT6A 3AFGA 3J9SA 3VHOA 2BV4A 4YG6A 4A7KA 1QXRA 5JR7B 5FMBA 3G7DA 2Y6KA 2ZCWA 2R16A 2VUJA 1W28A 1X4JA 4YW2A 4GA9A 1POV1 2AGSA 4L9BA 4AVTA 1KJLA 3MFCA 2TEPA 1NT0A 1W6MA 2DFCA 3BOPA 3V64A 1W8UA 2P3KA 4BQ3A 1S0EA 4PDWA 4XHBA 3DQVR 2A73B 2VJEA 4QHZA 5F5QA 2X05A 1FPN3 3IT8A 1OH4A 4EZ4A 2VUAA 2ET1A 3L2YA 4XFFA 4UFJA 4XTPA 2EODA 3WT3A 4Y1VA 3AP6A 3BTYA 5BNQA 2RR11 2ZEWA 4JQTA 4Y5Z0 3ZXFA 1UKRA 2QBXA 1CAUB 5A3UA 4WVWA 5L36A 4P08A 1JZ2A 1POQA 1W8WA 3O37A 1FMD1 4IL7A 4D7SA 4AUQB 4QX2A 3H3UA 3T09A 2ECJA 4P9LA 3VBFA 4R8PK 5TBNA 4YG3A 4QGMA 4K9SA 1RUE2 4ZS3A 3ZXAC 5FO9B 4O62A 1AYM3 3R4UA 1GZWA 2FSAA 1SZBA 3I3MA 4O64A 1GP4A 3AVRA 1JZ4A 1MQTA 4NIDA 2DBIA 3T3YA 3OGVA 2ZGOA 2DVGA 2HH9A 1PX3A 4JDOA 3THDA 4EQVA 2BPA2 4X8PA 4HXCA 3HEIA 1B35A 4JKLA 4XIKA 2ZMKA 4QB2A 3LAGA 5FQ0A 3VDAA 1FXZA 5H9RA 4UI9L 1GQGA 1W6NB 3OTFA 5FMCA 1DCQA 2C9KA 1ZRRA 3PIGA 2M3HA 3CQOA 3GZUC 4WZ3B 4DOUA 3VUOA 2V72A 2O14A 5FJHA 1A78A 4QKNA 3MW3A 5DZEA 1IKQA 4Y22A 1JHJA 2D5HA 4NMIA 1R091 4WA6A 3ZTGA 1WCKA 2ADEA 4A45A 3OJBA 1ND3B 1TE1B 1BEV2 3M3IA 4UP5A 1K42A 5BNPC 4AYCA 3LDKA 3D5OA 4CU9A 5FDBA 1RUI1 4DEQA 4GMP3 4CDUC 3AP4A 1PX4A 5KH9A 1H30A 3I7DA 2ZOEB 2QUOA 2R49A 3HBZA 4GMP0 3I2IA 2PHUA 4Y4YA 5A70A 4BWOA 2ZX4A 3ETPA 3GZTB 1DZQA 5IVBA 3O0WA 4L97A 1SACA 1R081 2E63A 4QQHA 4H3WA 2DJAA 2XJRA 4B8EA 3KNVA 2UWBA 2WNEA 4FK5A 1YXWA 3AXDA 3E2DA 4QQLA 4NROA 3SCGA 1SLIA 3SEEA 5FP7A 2VPDA 3WNMA 4X3GA 4MGYE 3SMHA 3WNKA 1KS4A 1RUF3 1OURA 2RS51 1O3RA 4AQSA 4Z2WA 2DCTA 1UYPA 3WHUA 3RMYA 4YPJA 2P34A 3FHAA 3IPVA 3IM0A 1MS1A 5A7WA 3FHQA 3CDZB 3WG1A 2UZGA 2V09A 3DL3A 3FE5A 4XMIA 4AL9A 2QCSB 3SCHA 2VXRA 1XQNA 1X8EA 4YVWA 1AR82 3WCSA 2FCVA 4AG4A 4D7TA 3KHCA 4X8NA 2D6OX 4COYA 4Q4W2 3VDCA 3HR9A 3MPBA 1OXCA 3P1IA 1WEOA 5KXBA 2VMEA 1ZZ9A 4RSUA 4KQ7A 1FT9A 4CPBD 1ENXA 5IFPA 1N3OA 1I6XA 4Y20B 4OZXA 1LHOA 1OD5A 5EIYB 3UKTA 4BCUA 1MS3A 5CNAA 3HMYA 2WWUA 5E8AA 4IEPA 2ZGPA 5LKZA 5ABJC 4YW4A 2R0FA 1VBE3 3I3DA 2IFRA 2W08A 5F7UA 5TABA 3H50A 3POFA 5KHHA 4NIHA 1Z7S2 2Y6LA 1RJ7A 4FPYA 2BP6A 4V1PA 2CONA 3USSA 2DSMA 1RHI3 1QF3A 4YC9A 1BQPA 3NNMA 1W39A 1BBT1 3UGHA 4XUQA 5JOZA 2BRTA 1C4RA 4X6RB 4B1MA 1S2KA 5ACA3 2Z79A 3DPRC 2E33A 1F2NA 3WUCA 5LWBA 5SVYA 2B4KA 4QM8A 5CG9A 3U5MA 4BBQA 2VH9A 2YB7A 3H0OA 4H2AA 4YW3A 1O4TA 4FOVA 4EYUA 2YSJA 1BVVA 2FBEA 4CU8A 5L7OC 1CAXA 2BYVE 2HWF1 3CL1A 2M13A 3L1ZB 4NPRA 4AAXA 3D6EA 5A32A 3O1TA 4QDRA 4URAA 2VECA 4GJZA 1RINA 2PMWB 4LHKA 4QPWA 2OYZA 4N43B 3KS7A 4NN2A 1HJGA 3ZSLA 5JPNB 1WBFA 1CZTA 1SG3A 1CZVA 4J25A 2Q8OA 2XWJB 2VPVA 2IWGB 2OIIA 2X29A 1CIWA 5FB1A 3ZSEA 2WBKA 1K3IA 2JB8A 4PCRA 4YVSC 3R6SA 3W59A 1GNHA 4XETA 4AFBA 5JXJA 4UI9B 1SCSA 1LOEA 2V5YA 2PUYA 1GNYA 1ASJ2 1DQ6A 2YDEA 1LHUA 4PDWB 3DCQA 4IGOA 5BV6A 2G43A 1QGLA 4C1XA 1RUJ3 1XSQA 3AXEA 3NV1A 3NAPC 3RYPA 2JDUA 1XC6A 1X4UA 5GKAC 3NNJA 2RE9A 2OPKA 5IUQA 1TVGA 1ZBA2 2IFWA 5BYNA 2K1JA 4YG0A 5B78A 1RXGA 4ZXKA 3ALQA 4K1YA 5CVRA 4EN8B 2VQUA 3L2HA 4GNDA 1G7YA 4EN9B 2JKXA 2KWOA 4R9AA 3NJVA 1EPZA 1QQP3 2B46X 2P6HA 3MBWA 4M4RA 2FDKA 3FEHA 1GYKA 1S2BA 2RDQA 1HLCA 3VBFB 4AI9A 4C91A 3VBHC 4I0BA 3AP7A 5A3OA 1EUTA 3IB3A 1GZWB 5DAXA 3IWZA 1W90A 3SXWA 2WFF3 1VBD2 3VBOA 2K46A 2ILMA 1RUG3 1O8SA 4K3UA 5GM0A 4PLNA 2BVVA 1TZOA 4R9CA 1B35B 3SCFA 1YO8A 5IK5A 3LQJA 3FUQA 4NAOA 3RDIA 2OS2A 2VMGA 1HRV3 1W8NA 2VVDA 4LTAA 2W94A 3T4HB 5FPXA 4ZS2A 4YZ1A 3AKSA 5AC92 5EFUA 2JE8A 1QDCA 1T6GC 5LRRA 4XI1A 2J42A 5FP9A 3OBRA 3T7LA 5JSRA 1C28A 2P37A 1KS5A 5IYYA 5JPMB 1AR92 1MBMA 1GZ9A 4RL7A 4GNFA 4Q0VA 3C5KA 2LGLA 5C33A 5C9AC 5FTTC 3QD6A 4IUGA 5LA0A 3DGTA 4AYCB 1OLMA 3GYDA 3K48A 4RFT0 2ECTA 2G4IA 4L58A 4V3LC 1EAH3 1UYXA 3POGA 4QXHA 5H9QA 3ZNIA 1PIV1 3JU9A 5CZKA 5FPUA 5FZEA 4BIOA 3E1F1 2XHNA 4DNYA 3RQ0A 2HWD3 2Q4SA 2XL7A 3VGIA 1W9WA 5DAWA 4QMAA 1BZWA 4Y1ZA 4QGLA 1LDJB 5FY1A 2RV9A 4YGCA 4AGGA 4CXXA 1JU3A 5KXDA 2GC2A 4XAEA 5A6ZA 3D4KA 2ZPXA 4PJYA 2CAUA 3I2JA 3KLSA 5DUVA 1IG3A 4AK3A 1LDKC 4PQQA 5FZKA 2UYBA 4IGQA 2ARAA 2WS92 5FCCA 1LGNA 3IPVB 4Y3OA 5FPAA 1AL22 1D7PM 1VBA3 3KVBA 3Q9OA 4B29A 4BIFA 4W4UA 1RYYA 3LF7A 3NV2A 2X53S 3GF6A 4A0CD 4CPBA 5FP3A 2JE9A 2PLV3 5BNOA 4DRVA 2ZJCA 4YVWB 1BKZA 4F8AA 2R30A 5F8PA 5JMCA 2KKYA 4ZKTB 4I2OA 1FP0A 3ZDSA 5KHJA 4A42A 4DB5A 4LADB 3S7IA 2ARCA 1CAVA 3B69A 3WZ1A 4I7BA 5L19A 2XWBB 1FPN1 3AKTA 3N7KA 3I2OA 3I8TA 1HW5A 1MS4A 3INAA 3LVQE 1IS5A 1OOPC 2K0GA 3BYWA 2VW2A 1S0CA 2OPWA 5BNNC 1X9PA 3A21A 3FBMA 4LK7A 4XXAA 1Z2QA 2JDNA 2WNVC 3CU7A 3OGSA 4LBLA 5FYHA 4OQ9A 3ZFFC 5D8AB 2F6NA 1I9RA 1PO22 3NMBA 3I59B 5CB7A 2QDRA 3THPA 1UZ0A 2ZGLA 4WV8A 5A6QA 3PVNA 2BOJA 1WMXA 4JDMA 1CONA 3I2GA 4QPGA 5HPOA 2YGMA 2HWE2 2KWNA 2WJSA 3JQXA 1XB9A 4LUKA 1AYM1 1UCXA 1Y9GA 4WZ0A 3RJRA 5FPVA 2PA7A 4DEVA 2HWC3 4LLBA 1WE9A 2XJPA 3I3EA 3ZIWA 3I3QA 4PLMA 4N4FA 4IE0A 2JIGA 1V6JA 4BQXA 1OA4A 5DZGA 1WUVA 3HIFA 1CAXB 5L9BA 3UESA 4GNGA 5ERLA 4XOGA 1ZZBA 4XJWA 5CISA 5A32B 4NIAA 1SFPA 3O0XA 3VKLA 3T2QA 3S5AA 2VVEA 2VVFA 3LQIA 2YREA 3BIEA 3VB9A 3VLBB 5F5AA 1U0AA 2DVDA 3FUOA 3WD5A 1GUIA 1F4HA 1WZXA 2FDHA 4XFHA 3L11A 2JIJA 2LROA 3E6BA 4TLFA 1GV9A 4KGGA 3WOGA 3O1PA 4A4CA 1HQWA 4FOWA 4GMP1 2CSYA 3APBA 5C4WC 5JIUA 4QX0A 1JOPA 3MIDA 2Y34A 5KH7A 1L7RA 5C5UA 2G9FA 5APAA 1W9YA 1WEPA 1AXYA 4UT5A 3S57A 2QQLA 4V2WA 2PAMA 2Y43A 1VRBA 5H1UA 3B9CA 3ILRA 4TSVA 3THCA 3ILFA 3CEWA 2MT5A 3HWJA 1QOSA 4HKWA 5FPZA 4CP2A 1JZ7A 1U5XA 2CGOA 4ZU5A 3H9AA 3M8LA 3BPZA 4GH4C 4AWDA 2MA5A 2DUQA 3UKNA 2FCTA 1RUF1 1UL9A 5IK7A 5B77A 3ZIXA 4E2SA 2I74A 5FYSA 4EV0A 2E53A 1AJKA 1C1LA 1GLHA 2WZR3 3KF5A 2VU9A 3VBSC 4ARYA 4B7EA 4EN0A 5EYAF 4CYDA 2E7QA 3ZPV1 1WKYA 5KXCA 4XUPA 2D98A 1OF3A 4NOTA 2BBAA 5FZMA 1NCQA 3E5QA 3M4FA 1PVC2 1CQ9A 3POYA 5DQ0A 3GV4A 5B75A 1LCLA 1F9KA 5B4NA 5FOBB 3KGLA 1RVF2 1NKGA 5CIRA 2Q0AA 1DCSA 5CFCB 4B7YC 1O4ZA 3FN9A 5AITA 1W3VA 1VAMA 1UYYA 1W6PA 2MHFA 2VD7A 2W91A 2Y6JA 3JXSA 3MW2A 3P5BA 4GULA 4I09A 5DPNA 5DUXA 4AEMA 4B7KA 2PQQA 5C8CA 4WVZA 3HTKC 4OCTA 3EXUA 4B4PA 5FZLA 1PMHX 3HJRA 3B9IA 2DCJA 1VBE1 5LY1A 4HSJA 3H8XA 1Z60A 2B42B 2VZQA 4LBQD 3WDYA 1HXS2 5CFDC 5FBZA 1NAEA 2L9LA 1AX2A 1RHI1 3T0BA 4UYBA 2EAKA 2MNZA 2ES3A 1J59A 4L92A 4XQWA 2FDJA 2ZS6B 4CDQC 4CCDA 4FFGA 5ACA1 2VPGA 1VIWB 4LK9A 4E8DA 2XBO3 2C6SA 1LOFC 3CKHA 3UL2A 1QJU3 1O59A 3IMMA 4LITA 3OGJA 1XE8A 1IOAA 4YBTA 2GNMA 1CHCA 4COWA 4YWAA 1HYIA 3BVCA 2JDHA 3AMPA 3ZMNA 1BLZA 4JRAA 2JD4A 2Z42A 2CGNA 1QH7A 3B5LB 1GQPA 1HQLA 3RZLA 3CJIA 1JODA 4WM8A 5BNOB 4UW6A 5CG8A 3RI8A 1YQ2A 4J6GA 2UU8A 1QJY3 1UD1A 4KL1A 3FMGA 1PGW2 4XQ4A 2ZEXA 2OA2A 1WMDA 4RQPC 2GP5A 1PNFA 4YZ2A 4Q2FA 4MHRA 1QIQA 5IVJA 1RUJ1 3M3OA 3BOWA 3O7OA 2LGKA 1FOD2 4F7ZA 4IV3A 3WDTA 1STMA 2XJUA 4HZFA 4BJ0A 2B8MA 3KQRA 3MHSA 2ZABA 4AHYA 1WFKA 3HQUA 2GN3A 1UMZA 3OD0A 1RUH3 3RSJA 2RM23 1HIXA 2IVIB 1PMJX 1HRI3 3GBFA 3KV4A 2JENA 4QQPA 1N3QA 2R1BA 5HXVA 1QQP1 4XFGA 2YXSA 4M3CE 5C3RA 3KGZA 3N9QA 4QPGB 2VJFB 4XFAA 2VTFA 4A6SA 1DYPA 3DYOA 1UOFA 3BALA 2DYCA 1N47A 2WFF1 3ZYHA 3HNYM 3LA2A 4D69A 3GGLA 1VLNA 1DG6A 1RUG1 2E31A 2JEMA 4XXPA 5C6CA 5EXOA 4YW5A 1UMHA 2CSVA 2ZZJA 1Z6UA 1KQRA 1RUC2 1HRV1 2EALA 2XKPA 1NE4A 2LUWA 5D2AA 3CLPA 3RZMA 3WW1A 1V9U3 2QQJA 2OZJA 3HOBA 5CKMA 3ZMOA 4DXZA 2DX8A 2H6BA 4QU2A 4INDA 1OLRA 5HV0A 4DINB 2JUNA 2EIEA 4AI1A 3U11A 3LEKA 1XXNA 1RUH2 4DIQA 4LEJA 1K45A 4LKFA 5FXXA 2RJKA 4QXKA 1E5IA 1MEC1 2WQ8A 2Y60A 5F3GA 2FFWA 2VR4A 5G05L 5HCHA 2HWD1 5FUIA 1FV2A 2E6SA 2NZ9A 1Q8QA 4K8FA 3ZYPA 3TN92 2QE3A 3MV01 4QB6A 3C7HA 2D44A 4KNCA 4OI0A 4LJNA 3WQ7A 3HCSA 1JS9A 1SLLA 5LKXA 3PUSA 4KGQA 2C2VS 1K5JA 1Q8PA 4TXWA 1Y4WA 2IC1A 3K4AA 3B94A 3LA3A 5DG1A 1KJRA 3GZAA 4L99A 4YZ3A 4H7MA 5FAXA 4DQAA 3E5UA 1DGWX 4IEOA 1ND3C 3IDAA 4A3ZA 4EZHA 4Z07A 1BYHA 2JG8A 1W9TA 4YATA 4IE4A 2ZHNA 1VBC3 1VBA1 5FJKA 1V6MA 2IZWA 1S0IA 4GD4A 1SLBA 4WM7C 4FT8A 2PLV1 2PXJA 2R063 5FZ9A 2CHHA 4XEZA 1R64A 1NCQB 1NQDA 3LQCA 2VZUA 3HD8B 1XNAA 3VDBA 2DDUA 5EJ1B 5FZHA 3M2MA 4CP1A 1IHMA 1LU2A 3MUY1 3U37A 2WN3A 5FY0A 1GZTA 3AYEA 3R05A 2ZGSA 4AGVA 2C9AA 5FMOL 1OVPA 5DDJ1 4LBQA 1IZ3A 1W6PB 2PYTA 4PTBA 5C8CB 3RNSA 1F8VA 3ZYQA 1O7FA 2MKEA 3VBRA 1X33A 1PGL1 2YPDA 1GP5A 4D6RA 4GALA 1UU5A 2N7GA 4JGYA 2VTXJ 3OYWB 1UU4A 2WLQA 3POWA 2XL9A 3ACIA 4OGEA 4NJ4A 4XFCA 1ULCA 4BHWA 1OQ1A 4GH4B 2AN6A 4LBMA 4W6XA 1YQCA 3C3VA 1GICA 4W50A 5TSWA 2CSZA 5FUNA 1GOFA 3WR0A 2HWC1 5HCAA 4LKEA 4FOQA 4JAAA 4UP0A 3BIWE 4CDWA 3CZUA 1REFA 3LSDA 3GHNA 1AR73 4PLOA 1MM3A 3B00A 4XFIA 4ZZ8A 2GSYA 2L80A 1W04A 1KDMA 5A1LA 4FTSA 1OF4A 3UJOA 1PM7A 3HQRA 2JKBA 2KE1A 4BQ1A 5LK7B 4EE2A 1ZZ8A 4IV1A 3N4MA 2R6QA 4GB0A 1QH6A 2JJ6A 4FPJA 3CJIB 3AFKA 4WM8B 3DPLR 1TNRA 4NRQA 2C0ZA 3RMXA 2P3JA 3VZNA 1AR63 2EF6A 3JBG2 3RWKX 4DY5A 2XP0A 1AHSA 1NLSA 1UKGA 3J7NA 2IXIA 4LA2A 4NUBA 3WV6A 3DDTA 3UGGA 1F5FA 2DTWA 4UFHA 4EJRA 1QJX2 4UFMA 3GJAA 2MEV3 3AYCA 3KHBA 3OPTA 4IV3B 4AFCA 2F6BA 2IDAA 4BE3A 4YLZA 2E7TA 3SOUA 4D6QA 2RS32 3O14A 3HN1A 1BBT2 1JZ5A 1K5MA 2IXKA 2R073 2WA3A 2EIDA 4KWJA 3JD72 4HMZA 4RHV3 2HDPA 5BPXA 3CIHA 4N43C 1O6UA 3FLRA 2QICA 3PLWA 2WZR1 1SPPA 1X8MA 2HWF2 1VP6A 4ZU4A 4CP0A 2EA7A 2I45A 1GANA 1XYPA 2I2SA 3ZM8A 3HCTA 4CU7A 1J3PA 3LEIA 5J3UA 1QXPA 4PDWC 4F1PA 1OSGA 4RD7A 3SH5A 1Q3EA 3H8RA 4IGPA 1O3QA 1HV0A 4ITCA 2PAEA 5FK8A 1LESA 4MGTA 2L75A 1OPOA 4OYUA 4CEYA 2QIZA 5SVXA 5HCFA 3WF2A 5FOJB 2J1AA 5T5JA 4W6WA 5J36A 4L0PA 2CKLA 3H1YA 3PU8A 5E16A 3WDWA 3FBYA 1X9TA 3X29B 1ZNPA 3W20A 3T9KA 1F4AA 5FP4A 5FZBA 1N1SA 2R7EB 3ZKUA 4XZPA 3L1XA 3VBFC 3S6PA 1S55A 1W0OA 2XJVA 2LDRA 4LBKA 5JG6A 1KDKA 1SLCA 2EXJA 4AOCA 3OUHA 1MQTC 2ZEZA 5AFEA 5EP9A 5C13A 3A22A 1RUE3 2LRIC 2QJ0A 2RS12 5IVFA 2IXLA 1B35C 2XLFA 4N3WA 1WLWA 4PF5A 4R9BA 2ECNA 2HWB2 2YY1A 5F39A 1AYN2 4F83A 2XBO1 3GM8A 2Y1MA 1QJU1 2R041 3IDCB 2CV6A 4M3CB 5FMDA 3U14A 3V0BA 2M85A 4DXRA 3T0DA 1DQ2A 2VW0A 4GIQA 2E7AA 2WZ8A 5JAXA 1VBB1 4PBPA 1W2OA 3KM5A 3LZZA 4MHUA 5IFTA 1HN0A 2JG8B 4QDSA 2YC0A 4QWNA 3L9JT 2XPJA 1H8TA 2ZGMA 3QBQA 4XHXA 2P2KA 3LJUX 1BEV3 2A71A 2JDYA 1PK6A 5L9RA 4LNVA 2VCAA 1EV12 3QCWA 4XF0A 1MM2A 5K3QA 4GJYA 4XE9A 2PNXA 4CUGA 1QJY1 4JX0A 4U36A 2G9ZA 2W46A 4ZUXU 1VB4A 2AR6A 3NJZA 3FANA 4CCKA 2D8UA 4UF0B 3BTXA 4BQ5A 3NV3A 1RMU2 3M3CA 3KT4A 1QU0A 1W9FA 1WW6A 3WDVA 3POSA 5FUPA 3LCPA 3GCWA 2SLIA 2W1UA 1MPXA 3MYXA 4Q0SA 2AZ5A 2E6RA 2XOMA 4LBQB 4XF3A 1TQ5A 2JXAA 4J1WA 4AI8A 5J96B 5JDBA 1TMF2 2RM21 1W2NA 1QY4A 3T1MA 1HRI1 2B45X 4UXAA 5J98B 3V0AB 2ATFA 1ULPA 4BA6A 1X7NA 1VALA 3LE0A 3PJQA 4HK8A 5F3IA 5FY7A 3WHTA 3O1UA 3TEWA 2WT0A 2XOCA 2XMLA 4YVWC 2O0OA 1RXFA 3SOWA 3SH3A 1MZ5A 3TWIA 2VBDA 3PTYA 4D3WA 2GH8A 1AR83 1H6YA 5IW0A 4COVA 3MW4A 2W87A 3POEA 4FO9A 4Q4W3 3J8F1 3FAOA 2WNOA 3DN7A 2TNFA 1REDA 1VE0A 3KWVA 4WZFA 3VDDA 3ZFGB 4CDWB 3AP5A 3ROUA 4YW1A 1N1VA 3WCRA 2FD4A 4WM7B 4ES9A 4XDOA 2BVBA 4IE5A 4A3XA 2BFUL 3LB9A 5I8SA 5D8AC 1V9U1 3FL7A 2V73A 2VL4A 2XLGA 1URXA 4DXSA 2CYFA 3I3BA 3IBMA 1E4UA 5FYIA 1UZZA 1C3HA 2VZOA 3HT2A 4IV1B 1Z0HA 2VZVA 4M01A 5LATA 5LA1A 1FNZA 2DU0A 5FZCA 5DKAA 5A6YA 4Q0PA 2MD8C 1DFQA 4FQ4A 2VC9A 1Z7S3 4HK9A 4N9HA 4XW3A 4LO6B 1T6BX 2QTWB 2RDRA 4JVAA 1YQ5A 5E88A 4XJ8A 5DXDA 1JOJA 1CJPA 2J7MA 3HN3A 3N9NA 4KU7A 5DUWA 4IC3A 3A23A 1GU3A 2R0HA 2MUMA 2WZEA 1YYNA 4OI2A 4KG0A 5F3CA 2XEUA 3VZKA 2F42A 1WD3A 4D6SA 1ZZCA 1K5MB 2B5HA 1GR3A 4E2QA 4S2DA 3ZXJA 1T2XA 3HT1A 2E9QA 1UN1A 1G86A 1UNBA 4HONA 1UXZA 2KR2A 4BMEA 1VBC1 1SPPB 4AVBA 2BTVC 5ANNA 4E4SA 2R061 1OQEA 1SMVA 3Q8BA 4UBHA 3CMGA 1SBDA 4KBZA 5J1XA 4QPIB 5B4XA 5C3QA 4BU2A 1ASJ3 1FNYA 1XNDA 2QQVA 2QFEA 5FZOA 2GALA 4JTOA 2CKLB 4UW4A 2PQSA 5FIXA 3ZR6A 4NIGA 4QD2A 3OEAA 2YSMA 1ZBA3 2UURA 1PVXA 2WQ4A 4I0AA 3T2TA 4LK6A 1LEMA 4FBFA 5H9SA 4HPKB 1O91A 3C2UA 3UT0A 3OB8A 4MV2A 4WVMB 2VZ1A 1W8TA 1OHFA 3ZN6B 1D0GA 5GLZA 2BUKA 2JDZA 3E97A 4N53A 3JUEA 1R1A2 3WEZA 4JGZA 3VBOC 5B76A 5BXXA 5KHGA 3Q8CA 3ZO0B 1RB8G 3LD8A 2VOVA 1BK0A 3P6BA 4NHXA 1F5JA 1ZYBA 1CAWA 1VBD3 4DS0A 1DQ1A 5TDWA 4E27A 5CFCC 5CEHA 4ONUA 3VZLA 2DCYA 4QX7A 3VZMA 5JZGA 3ACHA 4RS5A 1RUNA 1J84A 3NL1A 3AJZA 4UWDA 5FLHA 1AR71 2W1WA 1XOYA 4Y1YA 4Q4V2 1WBLA 3TAYA 4TZDA 2YV8A 1W6MB 2KGGA 2YBKA 2VPEA 1OLME 1NG0A 2D6MA 5AC93 4AZZA 3RZKA 2Q1FA 1H4GA 3GL6A 2L0BA 2XUEA 4UFIA 4QT6A 4D94A 3ME2A 1AR93 4QGNA 2VJEB 3ZXDA 1H8TB 1EYBA 4WZCA 2YYRA 1ULOA 1H9PA 3K75B 1AR61 4UOJA 4XJ9A 3LFIA 1JZ8A 4CCEA 1C8M2 2EXHA 4Q4Y1 3WSOA 2G19A 4DZGA 4QKDA 1V6IA 5I0UA 3SC7X 3HCUA 4ZQLA 2ZGTA 3NJYA 2D8SA 5LASA 1D0HA 3H8OA 2MEV1 2X10A 4YARA 2BNOA 1VRH2 1MQTB 3WY6A 3ZXEA 4OMDA 1N3PA 2PN5A 5FZGA 5A80A 1BMV2 3O35A 2HEYF 2OWAA 1GOHA 2R071 2VBPA 3LDYA 4RHV1 5FQ0B 2YT5A 5GZCA 2OZ6A 1RGSA 1YQ8A 2XKOA 2YHOA 1KFUL 3W21A 4MSVA 2A6WA 3ZYJB 2WS93 1G8WA 4ASMB 5E89A 5BNOC 4CRQA 2PHRA 1AL23 3DPRA 2C2LA 3K4DA 2F17A 4Y22B 2WDBA 5CU1A 1EP0A 2HBTA 3USUA 4LHSA 3J4UH 4HVRA 5L7OA 3DWDA 1ZBE2 1OI6A 1A6CA 2KA3A 1FBVA 1YFXA 2FZ1A 4LIUA 2Y26A 5H9PA 4HL0A 1C8NA 3MIHA 3FL2A 2KFTA 3C6WA 4B86C 1QDOA 4FP2A 2AYHA 3N36A 3H1MA 4XJUA 1WA4A 4GB32 4RR3A 5KHKA 1IYMA 2W1QA 1MS0A 3WQ0A 4PIZA 1Y9QA 4A4AA 2NLRA 4QPGC 2A6ZA 1OT5A 4Y26A 1PO23 4CDXA 1H2KA 1COV2 1ENRA 4AHZA 2K4DA 3WNPA 2BNNA 2ZGNA 3NW4A 5LKTA 5FO7B 1ODNA 2HWE3 2XONA 4XJZA 1J3QA 1RUE1 1UPSA 2H0BA 4JRLA 2A75A 1JOCA 3NJXA 2O8QA 3U0ZA 1W6OA 3K51A 3ST7A 4XF4A 2CAVA 5A7WB 1GWLA 4FPLA 1SLTA 1MZEA 4LJHA 4C8DA 4FAGA 1I1EA 3AYDA 1WGMA 4WZ2A 2VZTA 2FDGA 4V3KC 5J7MA 1NA1A 2RR4A 2WNUA 1IQDC 1H1AA 1MR5A 2Y0IA 5FV3A 4Q27A 2Q8EA 2ORZA 4OZOA 4EWEA 5GZEA 1RJ8A 2G1MA 5JWPA 4Z0OA 5FKCA 2ARXA 1MS5A 3PMSA 3OSDA 4MG2A 3EB6A 2VAUA 3LSEA 3MLKA 4OHWA 4FTEA 5JVVA 3OY8A 3ASIA 1ND2A 2UWCA 1TME2 1Y9MA 1DQ5A 5FZ0A 2AENA 2V5DA 1BEV1 5A33A 1S0BA 3RZGA 2WYSA 1D2SA 2RSDA 4FJCA 4TKPB 2GMEA 4Y1XA 1AXKA 3ENRA 4M4PA 1Y43B 2E26A 2QZ3A 3C7GA 2VP7A 4COUA 2F4PA 2O8OA 1GBGA 2PHTA 1US3A 4B1LA 2DUPA 3H7HA 3V56A 5K9YA 3ZX7A 2UY9A 3UV9A 3IKWA 3VKNA 2XH6A 4AI0A 5D1LB 3M3QA 5FZOB 2VJXA 3SKJE 5BY5A 1CIYA 1Q5OA 3WUDA 1UZVA 1MEC2 4OGCA 2NMOA 3VHPA 5F3EA 4K21A 4AQ6A 4P9XA 1AZDA 4NHLA 5EYXA 5FZDA 2P3IA 5LKUA 1H2NA 1SCRA 1WW4A 2H6CA 2HEWF 4MLOA 3F95A 3VKOA 1IG0A 3LRQA 3J26N 3RGBA 1X50A 4E8CA 2VCBA 4ZZ5A 4W4ZA 3NV4A 2YGLA 4N53B 3FJSA 5K0UA 1NCQC 2PFWA 2W3JA 4P9JA 2X09A 2CWMA 3T0AA 1XWHA 2JDMA 1OFSA 2GNTA 2OW4A 4JCKA 4DXTA 2YUCA 4Q4X2 3MLLA 1AR81 5A1FA 1PVC3 3I2DA 2KM2A 4KU8A 4CEWA 4Q4W1 5A3PA 3AZWA 3GCXA 3KV6A 4ISRA 2Y8KA 4LIVA 1YRZA 1RVF3 1GWKA 2WSVA 3PUHA 4RS5B 4QXBA 3K77A 4FOYA 3QH6A 3EBRA 4I0WB 5C8CC 1SQ4A 5CAZA 5HBAA 4UFLA 4LQRA 1NLRA 5FPBA 1OQDA 5LBFA 2VNFA 5DN2A 1REEA 3DXUA 4YADA 3GBWA 1EPWA 3BI3A 4CUBA 2CU5A 4S2FA 1QMJA 4Y1UA 1J1TA 5DDJ2 1GP6A 5CKQA 1D4M2 2VOTA 3NKGA 4Q0QA 4QX5A 3WG3A 1F62A 1HXS3 4MGSA 4AEJA 4AVSA 1JW6A 2EXUA 5DUUA 2GMMA 2IXHA 5IJRA 4A6OA 2KWJA 4NRMA 2W0XA 1Q8SA 3MIGA 1DYOA 1OUSA 4EWDA 1CVNA 3VBUA 2P6CA 3C8XA 2B39A 1BVP1 4MXVA 3ZPYA 1IPKA 1UU6A 4XUNA 4Q26A 3VBOB 1XPWA 4ASLA 3C7EA 5ANQA 4XYXA 2XDVA 5I91A 3ABZA 4A41A 1DZRA 4QQ2A 1JYCA 3CJIC 5FWEA 3WG2A 4WM8C 4ATFA 1GFF2 3PUIA 1WW7A 3AYAA 5FZFA 2WINB 4AYUA 4AP4A 2EXKA 3RRDA 1KITA 3GHMA 3KZ4C 4CP9A 1C5HA 3KV9A 5IVYA 2J1SA 2MPFA 4QQOA 5G0FA 2C26A 5JUVA 1J83A 4C0BA 3OUJA 4MX3A 2D6NA 4IV3C 3C7FA 3LA7A 4NWVA 1ASJ1 2QKDA 3KV5A 3MIEA 5FREA 3RS6A 4CCOA 4COZA 5T3NA 2VUDA 3WP6A 5SVIA 1Z78A 2GC3A 3FZ3A 2GAUA 1FOD3 1DLLA 4OUMA 2W47A 1LODA 2O1QA 3H8UA 5FYBA 1OD3A 1ZVFA 2RMU2 5FP8A 3I49A 1ZBA1 3BN6A 1JM7A 4PI2A 4BQ4A 4LKDA 4DUVA 2BDRA 2LW8A 2YHJA 5I8YA 2XVKA 4C9ZA 4MGQA 4PHZA 5J37A 4CDXB 1M06G 2L5UA 1W06A 4H55A 3DEMA 1FYUA 1HB3A 1V70A 4AFDA 2ZETC 4LO8A 3KT7A 4Y5SA 1W6OB 3ITQA 3TRSB 5F5CA 4HG6B 1IQAA 2FCUA 4AW7A 3BU0A 2QQMA 4XBNA 1ZBDB 3T6RA 1JUHA 1NLQA 2J1VA 3B7MA 3E5XA 3T30A 1NA1B 1ZRIA 3TBDA 2WNUB 3HAGA 4XABA 3T2PA 1RUC3 2P3YA 4PI0A 3GZEA 5B2GB 2YROA 4DPNA 3WXPA 2W39A 3ZPVE 3VBSA 5AC91 3M7KA 4YM3A 2EICA 2LXPC 1CAVB 2QQUA 3VKMA 3HNBM 3PVOA 4ZONA 1ULEA 5L73A 3OY8B 1AR91 1ULFA 2ZEYA 3MUZ1 3OGRA 4XMAA 5FMOS 1D2QA 1FX5A 1UY2A 2BWAA 2VQAA 2YC4A 1PO12 3TNPB 4GKYA 3ES4A 5A33B 1HDKA 2XXZA 2P5BA 3VD5A 1G9CA 1RUD2 1Q43A 5KC6A 2GZWA 1H2LA 2IVJA 4B4RA 3DUIA 4IE6A 2JDPA 2JE7A 2YW8A 3FJUB 2DVAA 2DVBA 2ZTNA 4ZDTA 3NG2A 4RA0A 3TN93 1C1FA 2JWPA 3IIIA 4D0QA 2J1EA 4QQ4A 4P5HA 4YAXA 1DQ4A 3ACFA 2JDKA 4MGKE 4LULA 3A7QA 5LBBA 4BM8A 3LVRE 3O47A 2WRAA 2EGPA 3KSCA 3MGUA 5FYMA 5I0TA 5T54A 4ET7A 1UQXA 3AX4A 2JG8C 5CBLA 3VZJA 5LCWB 2V4AA 5FERA 2Q8CA 2ZGKA 4QXCA 1W0PA 2R1DA 3I2KA 2WKKA 1D4VB 2WS91 4JTNA 4YM1A 5G04B 2R042 3AKRA 1AL21 1W0NA 2FMYA 5GLVA 4AEKA 1WCSA 4R2YA 3KQ4B 4HSLA 3WNXA 2G45A 3VL9A 3AMMA 3H7YA 1OFNA 2W95A 3RYKA 1NXD1 1VB2A 2WIIB 1VBB2 3BUCA 4CEWB 4PIYA 4DUWA 2XOYA 2C1FA 2VMHA 5JSPA 5B8DA 1W8ZA 5I8TA 1AXZA 1UO9A 2OQ7A 1VMHA 1EAH1 3GXUA 4LBJA 4WBBA 5T52A 1NCRA 5GLTA 1XE7A 4L11A 5DG2A 3UNPA 1AVBA 2RR12 4Q5OA 4QX1A 2LTNA 3ZR5A 4AE2A 1H9WA 5KR7A 1FMD2 3RG0A 4PIXA 4JGYC 5E6HA 3AZXA 5JMOA 1PO21 1R083 5F6LB 4L7XA 3T08A 2D93A 2BU9A 3O0VA 1I5ZA 5IT6A 2XGXA 2JD9A 3ELNA 3HBKA 3O12A 4P02B 5I0DA 4R9DA 2F4LA 1DIWA 4CDWC 2WT1A 3EYPA 3ZFGC 3B3QE 4OI4A 2JRJA 1LKNA 5AVAA 1NZCA 4LA3A 3VBUB 1ZREA 1WIMA 3OF1A 2KR4A 3EQEA 3LEGA 1JYNA 4FPHA 1L3JA 5FZ8A 3NWKA 3U5NA 4P14A 3WNLA 3OD4A 1R092 2VOXA 1YIFA 2AC1A 2VCCA 4IERA 4E4ZA 4EWAA 4FPCA 2YQMA 4Q1RA 3JCIA 3WLUA 3DV8A 4YFWA 4IQPA 3WNNA 4IV1C 1VD4A 3J8F2 1NZIA 1RUI2 1WCDJ 3GALA 4RYDA 3K2OA 3SISA 5T50A 4CCMA 3M3EA 5JZGB 5LA2A 4KWUA 1LRHA 2KD7A 3R4DB 4XPVA 2CL2A 2D3PA 1Q8OA 1VAKA 2VMFA 3MF6A 4GXLA 2VMIA 3URFA 4CP9B 3ILNA 4P5YA 5DAPA 5EJZB 1LAJA 5TRBA 1R082 1V6OA 2VCMA 3JBG3 2GNDA 4NHMA 5FYYA 3WQBA 3PMEA 4HLTA 5FY4A 5KXEA 3NSTA 1YNAA 4FQZA 5FZIA 1CAUA 4LE3A 4AI2A 1FV3A 5DAQA 2W5FA 1JOBA 1QJX3 3CZJA 5SVIB 1W05A 1WEVA 1UY1A 1JYIA 1QXJA 4AFMA 1K5MC 2FUIA 2JG9A 2VZ3A 2RS52 4OHXA 1XJAA 3OUIA 3S0MA 4YM2A 3S7EA 1JM7B 2BJSA 2RS33 3VV1A 4CTEA 3ZYGA 1BBT3 3JD73 1O8PA 4ORFA 1MZ6A 3LGRA 2LALA 1IKPA 2VZPA 1TNFA 1V6LA 3M99A 5A6XA 4Q8KA 5FYVA 3SHBA 3A0KA 4IW3A 1IS6A 4IXLA 4MH0E 1LECA 3FC0A 2HWF3 3KVAA 3MHHA 1A34A 2UYAA 4QPIC 2F6JA 3MO4A 4A7YA 3TEZA 4XACA 1PVC1 5JR2A 3WF4A 4MADA 1S0FA 4FP3A 5GZGA 1O4YA 1EUUA 2J1UA 4E4DX 1OH3A 3OBZA 1RVF1 4HKLA 3ZFEA 2YG0A 3O36A 1DYKA 3KF3A 3FLPA 2ZAHA 3CNAA 2YC2A 3LIGA 3NQHA 1F31A 4R4XA 2Y38A 1GOGA 2A7AA 5FZ6A 4I30A 1EY2A 2VNVA 1V6KA 5E1RA 1YFWA 2XJTA 2C5DA 3WP5A 4JZRA 4HN0A 1XBFA 1RTVA 4BISA 2A1XA 4OHYA 2DWRA 3LPGA 4HETA 3U4XA 5HI0A 4M0HA 5JXGA 3EB7A 2BWCA 4UAPA 2FZ2A 3FWEA 4DY3A 1F15A 1XSRA 2X5IA 4R7EA 1HXS1 3WW4A 3S5QA 2BBVA 2WWSA 2RS13 2WAOA 4ASKA 3VN4A 4YW6A 3U10A 3T4VA 5LW9A 4BB3A 2DURA 1S2EA 1W99A 2HWB3 4ZY9A 1CR7A 1AYN3 1HV1A 1YWKA 1Q56A 2XB6C 3IN9A 4E9KA 3U07A 2FMDA 4GWIA 3QOPA 5FY9A 1JZ6A 5A3MA 1BXHA 3LFMA 4I7CA 4N8MA 4P9GA 1H8TC 5LY2A 3SNMA 1B09A 5DZFA 2ZHMA 1UY4A 1QEXA 1PK6C 4JHTA 1W8OA 2BFUS 2HYXA 1A3KA 3VD3A 4FIPA 4KMQA 1H6XA 3PVBB 3AL5A 3U4SA 3VZOA 4AI3A 1EV13 2QDNA 3SEPA 4XF9A 1YJKA 3GDBA 4Y20A 4CCLA 5DINA 1PGW1 4BPZA 3PUAA 2ECIA 1NCRB 5C5TA 1RMU3 4BLIA 3K3OA 1W8HA 3Q8FA 3ASLA 1FOD1 2ERFA 4TLGA 1A8MA 2VUCA 3PVEA 2FD8A 5T5OA 1PIV3 1PZ9A 2XHKA 5F5IA 1ST8A 2WO7A 4Q4Y2 1O3SA 1YFYA 4TYSA 1TMF3 2G9GA 4IEYA 5FZ1A 1MS9A 4HT1T 2D5FA 3AKPA 3O1SA 1E5SA 3SOXA 4XDPA 1WEQA 1PZ8A 1XRUA 2QQNA 1CPNA 4FSJA 3BU7A 5F9TA 1UAIA 3HQXA 1Q8VA 3FLTA 2BERA 4NIIA 4HFSA 4JV4A 4FI9A 2ECGA 1UZWA 1XYOA 3K4ZA 3VDDC 4ES8A 3TEYA 5C3PA 5FXWA 2VXJA 3IDEA 1W8FA 2PHFA 4O9GA 1WWYA 3AK0A 2CY6A 1GZCA 2JX9A 4EN6B 3LQHA 1RUC1 5I93A 2BNMA 4HN1A 1JYWA 5H9MA 1V00A 1V6NA 1M4WA 2VNRA 3JQWA 4MVTA 4YBSA 1NE6A 2GDFA 4LPLA 5JOYA 4XDQA 1KXGA 4FCAA 5FYUA 1HB4A 3LPFA 2K2SA 4Z82A 5DABA 1UIKA 3Q1DA 3N7JA 2BZDA 2D97A 4YGBA
chains in the Genus database with same CATH topology
2QQPA 1PIV2 5EJ3A 2KU3A 4QPYA 1H0BA 1KD7A 1ALYA 2GNBA 5JZGB 1RUH1 1ZM1A 3LOIA 3VBRB 2VQ0A 1JXNA 3D82A 1ZZ6A 4YGDA 1RC6A 4JGYB 2CWSA 5EYYA 4MZUA 4LT5A 3VHNA 3H1WA 5IK8A 5AVPA 5SV8A 3TN91 1NY71 1J58A 2BEOA 2VOWA 3ZSKA 3D8CA 2JG9B 1LU1A 3E6DA 1UZYA 4SBVA 4BH9A 2PHXA 1SFYA 1G25A 2WC2A 1QKQA 4AEDA 2D3RA 4W6YA 5GLWA 1PGSA 4HKOA 1ONAA 1W2UA 3MZHA 2G6QA 1YJLA 3VHRA 1SDWA 3JZVA 3O34A 2ZX2A 4AVCA 5JOWA 3TOJA 4WVVA 4PPEA 2BW8A 1FPN2 2Y0OA 3ECQA 3UKVA 1JUIA 2LGVA 3ZFEB 3ACLA 4AQTA 5F1RA 4XF1A 1S0JA 2AREA 3B01A 2GN7A 3WDUA 1LOAA 4MXWA 3PURA 5H1VA 1LEDA 2DV9A 4S3OB 3N3HA 3RTRB 1YUDA 3MEPA 4N53C 3WX5A 2QVSB 2AH2A 5H1TA 1AYM2 1DF0A 4JGZC 3MI8A 2QZ2A 3MFAA 4OI1A 4GNEA 4KG8A 2Z2SB 3T6RA 2X5IB 4LO4B 3WINE 1LOBA 2KXLA 1G6NA 4CCGX 1R1A3 4LHNA 2HYED 2EVXA 4L8QA 1AX1A 4A4BA 4RS5C 1G9BA 1UIJA 2L43A 1LB2A 4GWNA 2LQ6A 5K8SA 1S1AA 2NM1A 1IGOA 4Q4V3 1NOVA 1DQ0A 1U6GB 1R1ZA 1ZRCA 2Z5WA 4FPEA 4CEYB 4FPGA 1WESA 2A70A 4N9IA 4C0HA 1U12A 4O9EA 2DF7A 2K9ZA 5BNPA 5J48A 2DU1A 4CDUA 3M62A 3W58A 2DTYA 2HKXA 1U5IA 3JBG1 1YIPA 2VGDA 2VJFA 4C90A 5GZFA 5HCBA 1C8M3 4P9IA 3MPPG 2DCZA 2SBAA 4K40A 5D8AA 1WD4A 3LWCA 1YI7A 1FI2A 1XYNA 3WVJA 3I59A 4NO4A 2EA6A 4YRDA 1QJX1 5T5LA 4KWLA 4M00A 3ZVZB 1RUF2 1VRH3 3MLJA 2RS31 4LBOA 4M3CF 1BJQA 3RI9A 3R0RA 4FPOB 4EN7B 3JD71 3V0BB 1WLDA 2HJIA 4IEZA 2E6VA 4K20A 2X8KA 1ULGA 3I4IA 3KMHA 1QOTA 5AFBA 1H1IA 1LR5A 1YI9A 2NMNA 4Y24A 2ECVA 2ZHKA 2YUEA 1APNA 1ZBE3 4DRRA 1PK6B 1JBCA 2ZGRA 3RYRA 4BZ4A 2NAAA 1QNWA 1YCIA 1GSLA 2D7FA 3ETQA 4RR3C 1S0DA 2ARBA 4DMIA 4GB33 2LGGA 4XJAA 3R4SA 1W6QA 3O5SA 5FRAA 1LOGA 1QOOA 1VBE2 4CDXC 1JHNA 2VNGA 5LEKA 3JUUA 5LK5A 5ABJA 5SV5A 3MF9A 1RHI2 1COV3 3AJYA 3RPGB 1PNGA 2CGPA 3JB8A 4A7ZA 2VOKA 3LOBA 2YQLA 5ACA2 1IPJA 1FATA 4FPFA 3ZSMA 1DGWA 4BLJA 4N90A 2RS11 1WLTA 2TUNA 1XU2A 4FPKA 2GC1A 1NA1C 2WNUC 4NHKA 2PHLA 3AZZA 2HWB1 3SLIA 2D6KA 1RIRA 1AYN1 4P9YA 3NKTA 1WEUA 3NVCA 5TDRA 4AEDB 2BAYA 3AMQA 1ND2C 3BTAA 4OHZA 3VDDB 3CF6E 4Q0UA 3M70A 2ZMNA 2ZX3A 4META 2JMJA 2ETEA 1TME3 3N9LA 3FFZA 1WILA 1KFXL 5CFCA 3LKJA 1EV11 2KGIA 1DDLA 2IXCA 3I54A 4YVSA 2H0VA 5J09A 1RUJ2 3ZN5A 1NQJA 2ZX0A 4U2AA 1QNYA 4UW3A 3ZYRA 1X4IA 3P3PA 3VL8A 4IEWA 1RMU1 3NAPA 1G9AA 4F52B 3KQIA 2RHPA 4YM0A 4MXWB 5KH3A 4LR4A 1MEC3 1C5IA 2ZGUA 1QQP2 4FVVA 4D7YA 4Q1PA 4LO5B 1TMF1 2A6VA 2DCKA 3NO8A 5K0UC 4YZ4A 4NR1A 1DGRN 3RPQA 1CX4A 1FAYA 2WFF2 3PJYA 3VBHA 4GKXA 1RUG2 4N7IA 5C11A 4CEWC 2JECA 3D0JA 1HRV2 4K6BA 4Q4X3 4AHWA 4AVXA 5T5PA 2EIGA 3FFQA 2ZZQA 1J3RA 4H7LA 2VULA 3B02A 3GNEA 1OKQA 1RMDA 3N7MA 4IEVA 5GLUA 4XBLA 4R8HA 4AHXA 5LRSA 2Q5TA 5CA6A 1WEEA 1XNBA 1HKDA 1EAH2 5C9AA 2E51A 3VKFC 1JTZX 2D6LX 2ZBJA 5BNPB 3N9PA 2I50A 4CDUB 2HWD2 5BUVA 2XG3A 5DDJ3 4CZSA 1D4M3 4XILA 4ZU7A 2VJFB 1BK1A 3EJKA 2KYUA 3MIBA 1HX6A 2NP0A 1DBNA 2YPJA 1AX0A 1J1LA 1WMEA 2WZPP 3VBUC 2LM3A 5JOXA 4A49A 2HYKA 1MVQA 4JGZB 3T1LA 1KRIA 2PELA 4E2GA 1IS3A 3N35A 3FHIB 1N1YA 4MYEA 4R52A 3ZXGA 4QM9A 4LO7A 1OA3A 2A5ZA 3RZZA 1CAWB 2PHDA 3WDXA 2PAKA 4W65A 5K7PA 3AMNA 3PNAA 5JIAA 1VBA2 1HYJA 3PUQA 2DUOA 2XB1A 2MNYA 4RGGA 2PLV2 3PLQA 2Z69A 1V87A 5FFOC 1GKBA 5EZWA 3ZXLA 3OBTA 1ZX5A 4LBNA 4GWMA 5I0SA 2K16A 1H8VA 3BCWA 4YBMA 2I07B 4G3YC 1LHVA 3OGGA 1Z7S1 4X6QB 2D6PA 1T1HA 3AZVA 4B4QA 1OOPA 5BNNA 5FLIA 1PGL2 1W6QB 4NWWA 2RMU3 2WNVA 3ZXKA 3AM2A 3ZFFA 2ZGQA 4XBQA 2FUUA 5ABJB 5KWRA 2GU9A 1MZFA 5LEJA 1WGPA 1O3TA 1RL3A 4J1XA 1ZRDA 2OUJA 2HWC2 3JB4C 2OXQC 1G9DA 1R1A1 2D43A 3M63A 1LULA 2HEVF 1VFYA 2M6MA 3PHDA 1UPIA 2WT2A 5A3LA 2ZA9A 3QZVA 3AKQA 3DPRB 5B79A 3SHRA 4TWTA 2OVUA 3USUB 1LTEA 4YGEA 5L7OB 2FHRA 1PMIA 2WFPA 2B9UA 2H0DA 3V43A 3DKWA 4Q4V1 3TB0A 5FLJA 2CT2A 1SBFA 4QF2A 4F3JA 3DF0A 3WW2A 3A0NA 1MVEA 4NVPA 2QJVA 4RR3B 2A6XA 2W52A 4HVOA 1PO13 1GNZA 2YU4A 1CD3G 5F6KA 2NN8A 4I3GA 1K2FA 3KD4A 4YVSB 1RUD3 5C4WA 4IEUA 1TEIA 5JSOA 1C8M1 4QHBA 4I01A 1YLLA 1X82A 3H7JA 4FTBA 3NAPB 3OYWA 3RWNA 4EROA 3V65A 1VRH1 2ZAAA 3OCPA 3QACA 1VBD1 4GH4A 3H3ZA 1BMV1 4MGZE 1WMFA 2VNOA 1NXMA 1DU3D 4YNIA 2WZR2 3WG4A 4XFBA 1WEWA 4IESA 5FO8B 1ZZ7A 3QLQA 3VBHB 2ECWA 2ZMLA 2R043 4FXKB 1POV3 4N7UA 1VYXA 3EB5A 2ZX1A 1ND2B 5J3XA 4QF3A 1POV0 3VK6A 1VBB3 1ZBE1 1AL0G 1NCRC 5FB0A 3N9OA 4P9WA 2EXIA 1BORA 4NN0A 1YFUA 3ZYIB 4I3PA 4UW5A 2LXHC 5JCTA 2RR13 3WP4A 4GB31 2Y1NA 4OULA 1FMD3 3ZSJA 4AVAA 4YZ5A 5D1IA 2YYOA 5C9AB 3M1HA 4PBOA 2MD7B 1COV1 4OLLA 4BHPA 5CFDA 2KWKA 1U5ZA 4GQ7A 4PQ9A 4OFGA 3AP9A 3IIAA 4L2NA 1A8DA 3WP3A 1HQNA 1SBEA 2XBO2 1QJU2 4CDQA 2NYYA 5K0UB 1Y3TA 1DZTA 4AVVA 3EHKA 1LOFA 5C8WA 1IS4A 2PHWA 2KREA 3MICA 1R093 1QJZA 4CA1A 3ATGA 1OMIA 3M7AA 4BMBA 4LUMA 3IDBB 4AGRA 3KB5A 3P3NA 3J8F3 1MACA 1WLCA 3BB6A 1LHWA 1JH5A 1RUI3 3IMNA 3WW3A 5JZGC 1MS8A 1QJY2 2ZKNA 1TME1 2OUHA 2XJQA 3UK9A 3VBRC 1WENA 2M1RA 2VW1A 1LHNA 4R4ZA 1C57A 2MNGA 1I3HA 3B93A 1DGLA 4UBGA 5CADA 4KBBA 4RQPA 4Z92B 4OHVA 2MIQA 3IHPA 5D1KB 1SLAA 3O7AA 4MUVA 3SH4A 4BYYA 1ENSA 2HWE1 2JG9C 1OPMA 1ULDA 1ZA4A 4Q6FA 2AUYA 2RM22 2XLAA 3AZYA 4AQ2A 1HRI2 1OOPB 5BNNB 4OVEA 1CESA 2XVLA 1GQHA 4KWKA 2RS53 2VY0A 1O5LA 2WNVB 1LOCA 4XIOA 4MSXA 3ZFFB 3ZVXA 3CO2A 5JI9A 4K1ZA 2TBVA 5FEYA 4IETA 5AIUA 1N87A 3O70A 1NY72 5KHIA 3G6JB 1H4HA 4ATEA 3FX3A 4M3CA 4I02A 4B3NA 5GJ6A 4Z8BA 2CNAA 2CTVA 2NPIA 4IC2A 4AFAA 1CN1A 5JI7A 5KBFA 4JDNA 2PTMA 1H2MA 3ZFEC 3OPZA 2JICA 2FQPA 4Q4X1 2WLPA 4OUSA 2D40A 2BQPA 4G4FA 1V9U2 3U5OA 1E57A 1UX6A 3RJ2X 1DVPA 1AUYA 2H0DB 1G9FA 4S3OC 2LV9A 1XU1A 1LGCA 1WW5A 5T55A 2ZHLA 4SLIA 1QWRA 1NYWA 2X5IC 4JC1A 4IEQA 1CPMA 1OLQA 2R32A 2D3SA 4YYOA 2ET7A 1VAVA 3AB0A 1D4M1 5C4WB 2GMPA 1XNCA 2A3YA 3GBGA 2KIZA 2JMDA 3TYJA 3V0AA 1LGBA 1SFNA 1RITA 1W6NA 3W9AA 2MA6A 4URTA 2Q30A 1PHMA 1YHFA 4LHLA 2GH2A 5IK4A 3ZN4A 2BGCA 4CEYC 2XUMA 5I0RA 1CGPA 1VBC2 2VG9A 1ND3A 1RUOA 2GC0A 4S2HA 1Y7BA 3U5PA 2R062 1LJ7A 3VBSB 1H1MA 2WL1A 3ZFGA 1WEMA 3O33A 2Q1ZB 4FXGB 4WM7A 1OA2A 2XJSA 5I3LA 2RJLA 4Z1VA 1U5YA 5GZDA 3MIFA 4YFZA 2YHNA 4H14A 1DHKB 2B7YA 2P17A 2WA4A 2XVGA 2WQZC 4BOWA 4LKAA 3UJQA 4AXOA 1N1TA 2RMU1 4AF9A 4ISQA 4Q4Y3 3BODA 3CJXA 3S30A 5D1MB 5JLVA 2DVFA 1AJOA 3ZVYA 4Q29A 2A3WA 2YURA 5CFDB 4K7JA 1PZ7A 2VPBA 4DFSA 4HANA 4LLOA 5GALA 4CDQB 4I7DA 1ZRFA 4P5OB 1AR72 3E6CC 2ZACA 1CJDA 2JMIA 4JQRA 4C1WA 1ENQA 5G05B 2ENRA 2ZKLA 1SEFA 1AF9A 3MDPA 1X36A 3ES1A 4G9SB 3D0SA 2YMZA 4XQDA 2LN0A 4M0NA 3KCYA 1LENA 4A2UA 4S2GA 5EV7A 3AMHA 1S0GA 4HVQA 4HBNA 4QPIA 4LE4A 1VR3A 2A6YA 3RPGC 1AR62 2EAAA 5EWSA 4KH9A 2Q1MA 1PO11 2K17A 3A4UA 3QH7A 1O5UA 1RUD1 1JN2P 3N7LA 3KT1A 4RQPB 2DFBA 2MEV2 2WSUA 2A3XA 4MGIE 4IEXA 4FAHA 4HPKA 3KCXA 2NQYA 3TNQA 4WVMA 1BCXA 1QHDA 1DGRA 2W68A 3KCCA 4YSFA 2YZ4A 3THTA 3ZN6A 2R072 4LLFA 4RHV2 4AEDC 3EO6A 3WQ1A 3PHMA 3SITA 2UY8A 4YABA 4Q8LA 4RGAA 4XTMA 1VJ2A 2UWAA 2QNKA 1XNKA 1UW8A 4N43A 2RI7A 3N9MA 1UF2C 2IXJA 4A7KA 3AFGA 3J9SA 3VHOA 4YG6A 1QXRA 5JR7B 3G7DA 2ZCWA 2R16A 2VUJA 1X4JA 4YW2A 4GA9A 1POV1 2AGSA 4L9BA 4AVTA 1KJLA 3MFCA 2TEPA 1W6MA 2DFCA 3BOPA 3V64A 3DQVR 2P3KA 1S0EA 4PDWA 4XHBA 2A73B 2VJEA 5F5QA 1FPN3 3IT8A 2VUAA 2ET1A 3L2YA 4XFFA 4XTPA 2EODA 3WT3A 4Y1VA 3AP6A 5BNQA 2RR11 4Y5Z0 3ZXFA 1UKRA 1CAUB 4WVWA 5L36A 3O37A 4AUQB 1FMD1 4IL7A 4D7SA 3H3UA 2ECJA 4P9LA 3VBFA 4R8PK 5TBNA 4YG3A 4QGMA 4K9SA 1RUE2 5FO9B 3ZXAC 1AYM3 3R4UA 1GZWA 2FSAA 4O64A 1MQTA 2ZGOA 2DVGA 4JDOA 2BPA2 4X8PA 4XIKA 1B35A 2ZMKA 3LAGA 5FQ0A 1FXZA 5H9RA 1GQGA 1W6NB 3OTFA 1ZRRA 2M3HA 3GZUC 4WZ3B 4DOUA 3VUOA 1A78A 3MW3A 5DZEA 1IKQA 4Y22A 2D5HA 1R091 4WA6A 3ZTGA 1WCKA 3OJBA 1ND3B 1TE1B 1BEV2 3M3IA 4UP5A 5BNPC 4AYCA 3D5OA 5FDBA 1RUI1 4GMP3 4CDUC 3AP4A 5KH9A 1H30A 3I7DA 2ZOEB 2QUOA 2R49A 3HBZA 4GMP0 2PHUA 4Y4YA 4BWOA 2ZX4A 3GZTB 1DZQA 3O0WA 4L97A 1SACA 1R081 2E63A 4QQHA 4H3WA 2XJRA 4B8EA 3KNVA 2UWBA 2WNEA 4FK5A 1YXWA 3AXDA 4QQLA 3SCGA 1SLIA 2VPDA 4X3GA 4MGYE 3SMHA 1KS4A 1RUF3 2RS51 1O3RA 4AQSA 4Z2WA 2DCTA 3WHUA 3RMYA 2P34A 3IPVA 3IM0A 1MS1A 3WG1A 2UZGA 2V09A 3DL3A 3FE5A 4XMIA 2QCSB 3SCHA 2VXRA 1XQNA 1X8EA 4YVWA 1AR82 3WCSA 4AG4A 4D7TA 1M06G 4X8NA 2D6OX 4COYA 4Q4W2 3HR9A 3MPBA 1WEOA 5KXBA 1ZZ9A 4RSUA 4KQ7A 1FT9A 1ENXA 1N3OA 1I6XA 4Y20B 4OZXA 1LHOA 1OD5A 3UKTA 4BCUA 1MS3A 5CNAA 3HMYA 5E8AA 4IEPA 2ZGPA 5LKZA 5ABJC 4YW4A 2R0FA 1VBE3 2IFRA 2W08A 5TABA 3H50A 5KHHA 1Z7S2 1RJ7A 4FPYA 4V1PA 3USSA 4YC9A 1RHI3 1QF3A 1BQPA 1W39A 1BBT1 5JOZA 1C4RA 4X6RB 1S2KA 5ACA3 2Z79A 3DPRC 1F2NA 3WUCA 3U5MA 4QM8A 5CG9A 4BBQA 2VH9A 3H0OA 4YW3A 1O4TA 4FOVA 2YSJA 4YBSA 1BVVA 2FBEA 5L7OC 1CAXA 2BYVE 2HWF1 3CL1A 3L1ZB 4NPRA 3D6EA 5A32A 2VECA 1RINA 4LHKA 2OYZA 4N43B 3KS7A 4NN2A 3ZSLA 5JPNB 1WBFA 2Q8OA 2XWJB 2VPVA 2IWGB 2OIIA 2X29A 1CIWA 5FB1A 3ZSEA 4YVSC 3R6SA 4PCRA 3W59A 1GNHA 4XETA 4AFBA 4UI9B 1SCSA 1LOEA 2V5YA 2PUYA 5BV6A 1ASJ2 1DQ6A 2YDEA 1LHUA 4PDWB 2G43A 1QGLA 4C1XA 1RUJ3 1X4UA 3AXEA 3NV1A 3NAPC 3RYPA 5GKAC 2RE9A 2OPKA 5IUQA 1ZBA2 2IFWA 5BYNA 2K1JA 4YG0A 5B78A 4ZXKA 3ALQA 4K1YA 5CVRA 4EN8B 3L2HA 4GNDA 1G7YA </