5D1LB

Crystal structure of ubch5b in complex with the ring-u5br fragment of ao7 (y165a)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
127
structure length
111
Chain Sequence
NIPHGQCVICLYGFQEKEAFTKTPCYHYFHCHCLARAIQHMEQELKAQGVGVQCPVCREPLVYDLASLKAAPEPQQPMELYQPSAESLRQQEERKRLYQRQQERGGIIDLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords Ubiquitin-conjugating enzyme E2 D2
publication title Insights into Ubiquitination from the Unique Clamp-like Binding of the RING E3 AO7 to the E2 UbcH5B.
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 111
sequence length 127
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5d1lB01
4PPEA 2JRJA 5H1UA 2XEUA 5KH3A 1JM7B 2VJEB 3KV6A 2G43A 3O7AA 2CSZA 1E4UA 4UP0A 4AP4A 4L58A 1WE9A 2MT5A 3L1ZB 1MM3A 4XI1A 2EGPA 1DVPA 2ECNA 5D1MB 3PHDA 2E6SA 3DPLR 4X3GA 2G6QA 4GB0A 2BAYA 2VJFA 3N9QA 1LDKC 4AUQB 3GL6A 2YU4A 1WEWA 2KGGA 1ZBDB 3MHHA 5B76A 5FEYA 2ECTA 2YREA 3LQHA 5LKXA 4YAXA 3O37A 4LADB 2FUIA 4IC2A 5H1TA 1G25A 4MVTA 3O36A 4FO9A 2K17A 5LCWB 3NG2A 5B78A 5TBNA 3C5KA 1BORA 2LDRA 2MA6A 2ECJA 2JMDA 4LJNA 2MD8C 1WIMA 3T6RA 4UP5A 2QIZA 2ECWA 5DINA 2G45A 2DX8A 4QF3A 4WZ2A 4V3LC 1WEMA 3N9NA 4AVXA 5G0FA 3U5NA 5TRBA 4A4CA 4AYCA 3KQIA 5C13A 5H9MA 1K2FA 4I7BA 3SOWA 2RI7A 3ZYQA 3SOUA 3PUQA 1FBVA 2VPDA 4AYCB 1T1HA 2RSDA 3HCSA 2EODA 4GNEA 3GV4A 2Y1NA 3ZVZB 3HCTA 2ECVA 4F52B 5EYAF 1WILA 5C11A 2I50A 2VPBA 2VP7A 1V87A 4ZUXU 5DKAA 4FK5A 4B86C 5B8DA 1LDJB 3KNVA 2OXQC 2JMJA 2KYUA 5H1VA 4YBSA 2KREA 3ZVYA 5TDRA 1F62A 3V43A 1MM2A 3FL2A 2CKLA 4ZQLA 3O33A 2KWKA 2MUMA 2KU3A 2YQLA 2Y1MA 2CSYA 4A0CD 5I3LA 4I7CA 3RPGC 3EB5A 3RTRB 2F6JA 2IDAA 2LQ6A 1WEQA 2CKLB 4LKAA 2KGIA 3LRQA 2K16A 4R2YA 3N9OA 2ECGA 1XWHA 1Z2QA 2VJFB 5TABA 5LKUA 2KIZA 2NAAA 4FIPA 2HDPA 1WGMA 2C2VS 1IYMA 2KR4A 5J3XA 1VFYA 2MD7B 1N87A 4R8PK 4YADA 3I2DA 1WENA 4GNDA 4LLBA 3PURA 4GNGA 3VK6A 3SOXA 2YW8A 2QJ0A 3N9PA 2YSMA 4QF2A 3M62A 2KFTA 2L80A 4TKPB 2YUCA 4YBMA 4S3OB 4IC3A 5LKTA 3ASLA 1X4UA 2L43A 2LGVA 5AIUA 2YYRA 4PTBA 1U6GB 2UZGA 2L0BA 4WZ3B 3HTKC 1WEUA 2YHOA 4O64A 2KWNA 4UI9B 2VNFA 4CCGX 4R7EA 2LRIC 3N9MA 2D8SA 2PUYA 3QZVA 5TDWA 3O70A 3U5MA 2MNYA 2AN6A 2F6NA 5JG6A 2LGLA 4N4FA 4YBTA 4LK9A 2M1RA 1WEEA 1WFKA 2MIQA 2VJEA 2YQMA 2C2LA 2LN0A 4CA1A 5KH7A 4BBQA 4V3KC 4I7DA 5D1KB 3MHSA 4MSXA 1Z60A 2KE1A 5B77A 4WZ0A 3N9LA 4WA6A 3O35A 4A49A 2LXPC 3IHPA 1X4JA 3L1XA 4NN2A 5B75A 3ZNIA 2M85A 3LQJA 3LQIA 4ZDTA 2KWJA 4A4BA 3ZPV1 4GNFA 3T7LA 4C9ZA 2E6RA 3ZPVE 2K1JA 3M63A 5FB1A 4L7XA 2FUUA 2LV9A 5LKZA 3KV5A 2YHNA 3DQVR 1RMDA 2QICA 4YATA 3U5PA 5G05B 4W4UA 2XB1A 3C6WA 4Q6FA 1JOCA 2YT5A 1HYJA 3EB6A 2L75A 2MNZA 2FSAA 1HYIA 2VPEA 2YSJA 2M3HA 2ECIA 1VD4A 2LGGA 3U5OA 2LGKA 5FERA 2JMIA 2ZETC 3O34A 5AITA 1WEPA 1FP0A 1X4IA 2VPGA 2YURA 3HCUA 2CT2A 2PNXA 2M6MA 2HYED 4YC9A 2MA5A 4P5OB 2Y43A 5FB0A 5B79A 2KWOA 4FJCA 4BHWA 3M99A 2H0DA 1WEOA 2L5UA 3SHBA 1VYXA 1WEVA 5D1LB 2LXHC 4S3OC 3ZTGA 2H0DB 4YABA 4B7YC 4N3WA 2F42A 1WESA 2EA6A 1JM7A 5G04B 3L11A 1CHCA 5KH9A 1Z6UA 3RPGB 2K4DA
chains in the Genus database with same CATH superfamily
4PPEA 2JRJA 5H1UA 2XEUA 3PLWA 5KH3A 1JM7B 2VJEB 2XOYA 3DDTA 3KV6A 2G43A 3O7AA 2CSZA 1E4UA 4UP0A 4AP4A 4L58A 1WE9A 2MT5A 3L1ZB 2DSMA 1MM3A 4XI1A 2EGPA 1DVPA 2ECNA 5D1MB 3PHDA 3MDBC 2E6SA 3DPLR 4X3GA 2G6QA 4GB0A 2BAYA 2VJFA 3N9QA 1LDKC 4AUQB 3GL6A 2YU4A 1WEWA 2KGGA 1ZBDB 3MHHA 2KKYA 5B76A 5FEYA 2CRRA 2ECTA 3Q1DA 2YREA 3LQHA 5LKXA 2CONA 2JUNA 4YAXA 4LADB 3O37A 2FUIA 4IC2A 5H1TA 1G25A 4MVTA 3O36A 4FO9A 2K17A 5LCWB 3NG2A 5B78A 5TBNA 3C5KA 1BORA 2LDRA 2MA6A 2ECJA 2JMDA 4LJNA 2MD8C 1WIMA 3T6RA 4UP5A 2QIZA 2ECWA 5DINA 2G45A 2DX8A 4QF3A 4WZ2A 4V3LC 1WEMA 3N9NA 5SVIB 4AVXA 5G0FA 3U5NA 5TRBA 4A4CA 2M13A 4AYCA 3KQIA 5C13A 5H9MA 1K2FA 4I7BA 2CSVA 3SOWA 2RI7A 3ZYQA 4F1PA 3SOUA 4OGCA 3PUQA 1FBVA 2VPDA 4AYCB 1T1HA 2RSDA 3HCSA 2EODA 4GNEA 3GV4A 2B0OE 2Y1NA 3ZVZB 3HCTA 2ECVA 4F52B 5EYAF 2IQJA 2MKEA 1WILA 1DCQA 5C11A 2I50A 2VPBA 2VP7A 1V87A 4ZUXU 5DKAA 4FK5A 4B86C 5B8DA 1LDJB 3KNVA 2OXQC 2JMJA 2KYUA 5H1VA 4YBSA 2KREA 3ZVYA 3KDEC 5TDRA 1F62A 3FANA 3V43A 3LJUX 1MM2A 3FL2A 2CKLA 4ZQLA 4H9DA 3O33A 5SVXA 2KWKA 2MUMA 2KU3A 2KKXA 2YQLA 2Y1MA 2CSYA 4A0CD 3O47A 5I3LA 4I7CA 3DWDA 3RPGC 3EB5A 3RTRB 2F6JA 2IDAA 2LQ6A 1WEQA 2CKLB 4LKAA 2KGIA 2FD4A 3LRQA 2K16A 4R2YA 3N9OA 2ECGA 1XWHA 1Z2QA 2VJFB 5TABA 5LKUA 2KIZA 2NAAA 3LDYA 4FIPA 2HDPA 1WGMA 2C2VS 1IYMA 2KR4A 5J3XA 1VFYA 1MBMA 2MD7B 1N87A 4R8PK 4YADA 3I2DA 3LVQE 1WENA 4GNDA 4LLBA 3PURA 4GNGA 3VK6A 3SOXA 2YW8A 2QJ0A 3N9PA 2YSMA 4QF2A 3M62A 2KFTA 2L80A 4TKPB 2YUCA 4Z0RA 4YBMA 4S3OB 4IC3A 5LKTA 3ASLA 4Z0OA 1X4UA 2L43A 3E2DA 2LGVA 5AIUA 2YYRA 4PTBA 1U6GB 2UZGA 2L0BA 4QQ4A 4WZ3B 3FAOA 3HTKC 1WEUA 2YHOA 4O64A 2KWNA 4UI9B 2VNFA 4CCGX 4R7EA 2LRIC 3N9MA 2D8SA 2PUYA 2XOZA 3QZVA 5TDWA 3O70A 3U5MA 2LAUA 2MNYA 2AN6A 2F6NA 5JG6A 2P57A 2LGLA 4N4FA 4YBTA 4LK9A 2M1RA 1WEEA 1WFKA 2MIQA 2VJEA 2YQMA 3JUEA 2C2LA 2LN0A 4CA1A 5KH7A 4BBQA 4V3KC 4I7DA 5D1KB 3MHSA 4MSXA 1Z60A 2KE1A 5B77A 4WZ0A 5SVYA 3N9LA 4WA6A 3O35A 4A49A 2LXPC 3IHPA 1X4JA 3L1XA 4NN2A 5B75A 2D8UA 3LVRE 2L7PA 3ZNIA 2M85A 3LQJA 3LQIA 4ZDTA 2YVRA 2KWJA 4A4BA 3ZPV1 4GNFA 3T7LA 2OWAA 2FFWA 4C9ZA 2E6RA 3ZPVE 2K1JA 3M63A 2JM3A 5FB1A 4L7XA 2FUUA 2LV9A 5LKZA 3M7KA 3KV5A 2XOCA 2YHNA 3DQVR 1RMDA 2QICA 4YATA 3U5PA 2XP0A 5G05B 4O62A 4W4UA 2XB1A 3T9KA 3C6WA 4Q6FA 3SUBA 1JOCA 2YT5A 1HYJA 3EB6A 2L75A 2MNZA 2FSAA 1HYIA 2VPEA 2YSJA 2M3HA 2ECIA 5SVIA 1VD4A 2LGGA 3U5OA 2LGKA 5FERA 2JMIA 2E61A 2ZETC 3O34A 5AITA 1WEPA 2EGMA 1FP0A 1X4IA 2VPGA 2YURA 3HCUA 2CRWA 3H7HA 2CT2A 2PNXA 2M6MA 2HYED 4YC9A 2MA5A 4P5OB 2Y43A 5FB0A 5B79A 2KWOA 4FJCA 3FJUB 4BHWA 3M99A 2H0DA 1WEOA 2L5UA 3SHBA 2EXUA 1VYXA 1WEVA 5D1LB 3FEHA 2LXHC 4S3OC 3ZTGA 2H0DB 4YABA 4B7YC 4N3WA 2F42A 1WESA 2EA6A 2RR4A 1JM7A 5G04B 2DJAA 3L11A 5K3QA 4OGEA 3FM8C 1CHCA 5KH9A 1Z6UA 3RPGB 2K4DA
chains in the Genus database with same CATH topology
4PPEA 2JRJA 5H1UA 2XEUA 5KH3A 1JM7B 2VJEB 3KV6A 2G43A 3O7AA 2CSZA 1E4UA 4UP0A 4AP4A 4L58A 1WE9A 2MT5A 3L1ZB 1MM3A 4XI1A 2EGPA 1DVPA 2ECNA 5D1MB 3PHDA 2E6SA 3DPLR 4X3GA 2G6QA 4GB0A 2BAYA 2VJFA 3N9QA 1LDKC 4AUQB 3GL6A 2YU4A 1WEWA 2KGGA 1ZBDB 3MHHA 5B76A 5FEYA 2ECTA 2YREA 3LQHA 5LKXA 4YAXA 3O37A 4LADB 2FUIA 4IC2A 5H1TA 1G25A 4MVTA 3O36A 4FO9A 2K17A 5LCWB 3NG2A 5B78A 5TBNA 3C5KA 1BORA 2LDRA 2MA6A 2ECJA 2JMDA 4LJNA 2MD8C 1WIMA 3T6RA 4UP5A 2QIZA 2ECWA 5DINA 2G45A 2DX8A 4QF3A 4WZ2A 4V3LC 1WEMA 3N9NA 4AVXA 5G0FA 3U5NA 5TRBA 4A4CA 4AYCA 3KQIA 5C13A 5H9MA 1K2FA 4I7BA 3SOWA 2RI7A 3ZYQA 3SOUA 3PUQA 1FBVA 2VPDA 4AYCB 1T1HA 2RSDA 3HCSA 2EODA 4GNEA 3GV4A 2Y1NA 3ZVZB 3HCTA 2ECVA 4F52B 5EYAF 1WILA 5C11A 2I50A 2VPBA 2VP7A 1V87A 4ZUXU 5DKAA 4FK5A 4B86C 5B8DA 1LDJB 3KNVA 2OXQC 2JMJA 2KYUA 5H1VA 4YBSA 2KREA 3ZVYA 5TDRA 1F62A 3V43A 1MM2A 3FL2A 2CKLA 4ZQLA 3O33A 2KWKA 2MUMA 2KU3A 2YQLA 2Y1MA 2CSYA 4A0CD 5I3LA 4I7CA 3RPGC 3EB5A 3RTRB 2F6JA 2IDAA 2LQ6A 1WEQA 2CKLB 4LKAA 2KGIA 3LRQA 2K16A 4R2YA 3N9OA 2ECGA 1XWHA 1Z2QA 2VJFB 5TABA 5LKUA 2KIZA 2NAAA 4FIPA 2HDPA 1WGMA 2C2VS 1IYMA 2KR4A 5J3XA 1VFYA 2MD7B 1N87A 4R8PK 4YADA 3I2DA 1WENA 4GNDA 4LLBA 3PURA 4GNGA 3VK6A 3SOXA 2YW8A 2QJ0A 3N9PA 2YSMA 4QF2A 3M62A 2KFTA 2L80A 4TKPB 2YUCA 4YBMA 4S3OB 4IC3A 5LKTA 3ASLA 1X4UA 2L43A 2LGVA 5AIUA 2YYRA 4PTBA 1U6GB 2UZGA 2L0BA 4WZ3B 3HTKC 1WEUA 2YHOA 4O64A 2KWNA 4UI9B 2VNFA 4CCGX 4R7EA 2LRIC 3N9MA 2D8SA 2PUYA 3QZVA 5TDWA 3O70A 3U5MA 2MNYA 2AN6A 2F6NA 5JG6A 2LGLA 4N4FA 4YBTA 4LK9A 2M1RA 1WEEA 1WFKA 2MIQA 2VJEA 2YQMA 2C2LA 2LN0A 4CA1A 5KH7A 4BBQA 4V3KC 4I7DA 5D1KB 3MHSA 4MSXA 1Z60A 2KE1A 5B77A 4WZ0A 3N9LA 4WA6A 3O35A 4A49A 2LXPC 3IHPA 1X4JA 3L1XA 4NN2A 5B75A 3ZNIA 2M85A 3LQJA 3LQIA 4ZDTA 2KWJA 4A4BA 3ZPV1 4GNFA 3T7LA 4C9ZA 2E6RA 3ZPVE 2K1JA 3M63A 5FB1A 4L7XA 2FUUA 2LV9A 5LKZA 3KV5A 2YHNA 3DQVR 1RMDA 2QICA 4YATA 3U5PA 5G05B 4W4UA 2XB1A 3C6WA 4Q6FA 1JOCA 2YT5A 1HYJA 3EB6A 2L75A 2MNZA 2FSAA 1HYIA 2VPEA 2YSJA 2M3HA 2ECIA 1VD4A 2LGGA 3U5OA 2LGKA 5FERA 2JMIA 2ZETC 3O34A 5AITA 1WEPA 1FP0A 1X4IA 2VPGA 2YURA 3HCUA 2CT2A 2PNXA 2M6MA 2HYED 4YC9A 2MA5A 4P5OB 2Y43A 5FB0A 5B79A 2KWOA 4FJCA 4BHWA 3M99A 2H0DA 1WEOA 2L5UA 3SHBA 1VYXA 1WEVA 5D1LB 2LXHC 4S3OC 3ZTGA 2H0DB 4YABA 4B7YC 4N3WA 2F42A 1WESA 2EA6A 1JM7A 5G04B 3L11A 1CHCA 5KH9A 1Z6UA 3RPGB 2K4DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PPE A;  2JRJ A;  5H1U A;  2XEU A;  5KH3 A;  1JM7 B;  2VJE B;  3KV6 A;  2G43 A;  3O7A A;  2CSZ A;  1E4U A;  4UP0 A;  4AP4 A;  4L58 A;  1WE9 A;  2MT5 A;  3L1Z B;  1MM3 A;  4XI1 A;  2EGP A;  1DVP A;  2ECN A;  5D1M B;  3PHD A;  2E6S A;  3DPL R;  4X3G A;  2G6Q A;  4GB0 A;  2BAY A;  2VJF A;  3N9Q A;  1LDK C;  4AUQ B;  3GL6 A;  2YU4 A;  1WEW A;  2KGG A;  1ZBD B;  3MHH A;  5B76 A;  5FEY A;  2ECT A;  2YRE A;  3LQH A;  5LKX A;  4YAX A;  3O37 A;  4LAD B;  2FUI A;  4IC2 A;  5H1T A;  1G25 A;  4MVT A;  3O36 A;  4FO9 A;  2K17 A;  5LCW B;  3NG2 A;  5B78 A;  5TBN A;  3C5K A;  1BOR A;  2LDR A;  2MA6 A;  2ECJ A;  2JMD A;  4LJN A;  2MD8 C;  1WIM A;  3T6R A;  4UP5 A;  2QIZ A;  2ECW A;  5DIN A;  2G45 A;  2DX8 A;  4QF3 A;  4WZ2 A;  4V3L C;  1WEM A;  3N9N A;  4AVX A;  5G0F A;  3U5N A;  5TRB A;  4A4C A;  4AYC A;  3KQI A;  5C13 A;  5H9M A;  1K2F A;  4I7B A;  3SOW A;  2RI7 A;  3ZYQ A;  3SOU A;  3PUQ A;  1FBV A;  2VPD A;  4AYC B;  1T1H A;  2RSD A;  3HCS A;  2EOD A;  4GNE A;  3GV4 A;  2Y1N A;  3ZVZ B;  3HCT A;  2ECV A;  4F52 B;  5EYA F;  1WIL A;  5C11 A;  2I50 A;  2VPB A;  2VP7 A;  1V87 A;  4ZUX U;  5DKA A;  4FK5 A;  4B86 C;  5B8D A;  1LDJ B;  3KNV A;  2OXQ C;  2JMJ A;  2KYU A;  5H1V A;  4YBS A;  2KRE A;  3ZVY A;  5TDR A;  1F62 A;  3V43 A;  1MM2 A;  3FL2 A;  2CKL A;  4ZQL A;  3O33 A;  2KWK A;  2MUM A;  2KU3 A;  2YQL A;  2Y1M A;  2CSY A;  4A0C D;  5I3L A;  4I7C A;  3RPG C;  3EB5 A;  3RTR B;  2F6J A;  2IDA A;  2LQ6 A;  1WEQ A;  2CKL B;  4LKA A;  2KGI A;  3LRQ A;  2K16 A;  4R2Y A;  3N9O A;  2ECG A;  1XWH A;  1Z2Q A;  2VJF B;  5TAB A;  5LKU A;  2KIZ A;  2NAA A;  4FIP A;  2HDP A;  1WGM A;  2C2V S;  1IYM A;  2KR4 A;  5J3X A;  1VFY A;  2MD7 B;  1N87 A;  4R8P K;  4YAD A;  3I2D A;  1WEN A;  4GND A;  4LLB A;  3PUR A;  4GNG A;  3VK6 A;  3SOX A;  2YW8 A;  2QJ0 A;  3N9P A;  2YSM A;  4QF2 A;  3M62 A;  2KFT A;  2L80 A;  4TKP B;  2YUC A;  4YBM A;  4S3O B;  4IC3 A;  5LKT A;  3ASL A;  1X4U A;  2L43 A;  2LGV A;  5AIU A;  2YYR A;  4PTB A;  1U6G B;  2UZG A;  2L0B A;  4WZ3 B;  3HTK C;  1WEU A;  2YHO A;  4O64 A;  2KWN A;  4UI9 B;  2VNF A;  4CCG X;  4R7E A;  2LRI C;  3N9M A;  2D8S A;  2PUY A;  3QZV A;  5TDW A;  3O70 A;  3U5M A;  2MNY A;  2AN6 A;  2F6N A;  5JG6 A;  2LGL A;  4N4F A;  4YBT A;  4LK9 A;  2M1R A;  1WEE A;  1WFK A;  2MIQ A;  2VJE A;  2YQM A;  2C2L A;  2LN0 A;  4CA1 A;  5KH7 A;  4BBQ A;  4V3K C;  4I7D A;  5D1K B;  3MHS A;  4MSX A;  1Z60 A;  2KE1 A;  5B77 A;  4WZ0 A;  3N9L A;  4WA6 A;  3O35 A;  4A49 A;  2LXP C;  3IHP A;  1X4J A;  3L1X A;  4NN2 A;  5B75 A;  3ZNI A;  2M85 A;  3LQJ A;  3LQI A;  4ZDT A;  2KWJ A;  4A4B A;  3ZPV 1;  4GNF A;  3T7L A;  4C9Z A;  2E6R A;  3ZPV E;  2K1J A;  3M63 A;  5FB1 A;  4L7X A;  2FUU A;  2LV9 A;  5LKZ A;  3KV5 A;  2YHN A;  3DQV R;  1RMD A;  2QIC A;  4YAT A;  3U5P A;  5G05 B;  4W4U A;  2XB1 A;  3C6W A;  4Q6F A;  1JOC A;  2YT5 A;  1HYJ A;  3EB6 A;  2L75 A;  2MNZ A;  2FSA A;  1HYI A;  2VPE A;  2YSJ A;  2M3H A;  2ECI A;  1VD4 A;  2LGG A;  3U5O A;  2LGK A;  5FER A;  2JMI A;  2ZET C;  3O34 A;  5AIT A;  1WEP A;  1FP0 A;  1X4I A;  2VPG A;  2YUR A;  3HCU A;  2CT2 A;  2PNX A;  2M6M A;  2HYE D;  4YC9 A;  2MA5 A;  4P5O B;  2Y43 A;  5FB0 A;  5B79 A;  2KWO A;  4FJC A;  4BHW A;  3M99 A;  2H0D A;  1WEO A;  2L5U A;  3SHB A;  1VYX A;  1WEV A;  5D1L B;  2LXH C;  4S3O C;  3ZTG A;  2H0D B;  4YAB A;  4B7Y C;  4N3W A;  2F42 A;  1WES A;  2EA6 A;  1JM7 A;  5G04 B;  3L11 A;  1CHC A;  5KH9 A;  1Z6U A;  3RPG B;  2K4D A; 
#chains in the Genus database with same CATH topology
 4PPE A;  2JRJ A;  5H1U A;  2XEU A;  3PLW A;  5KH3 A;  1JM7 B;  2VJE B;  2XOY A;  3DDT A;  3KV6 A;  2G43 A;  3O7A A;  2CSZ A;  1E4U A;  4UP0 A;  4AP4 A;  4L58 A;  1WE9 A;  2MT5 A;  3L1Z B;  2DSM A;  1MM3 A;  4XI1 A;  2EGP A;  1DVP A;  2ECN A;  5D1M B;  3PHD A;  3MDB C;  2E6S A;  3DPL R;  4X3G A;  2G6Q A;  4GB0 A;  2BAY A;  2VJF A;  3N9Q A;  1LDK C;  4AUQ B;  3GL6 A;  2YU4 A;  1WEW A;  2KGG A;  1ZBD B;  3MHH A;  2KKY A;  5B76 A;  5FEY A;  2CRR A;  2ECT A;  3Q1D A;  2YRE A;  3LQH A;  5LKX A;  2CON A;  2JUN A;  4YAX A;  4LAD B;  3O37 A;  2FUI A;  4IC2 A;  5H1T A;  1G25 A;  4MVT A;  3O36 A;  4FO9 A;  2K17 A;  5LCW B;  3NG2 A;  5B78 A;  5TBN A;  3C5K A;  1BOR A;  2LDR A;  2MA6 A;  2ECJ A;  2JMD A;  4LJN A;  2MD8 C;  1WIM A;  3T6R A;  4UP5 A;  2QIZ A;  2ECW A;  5DIN A;  2G45 A;  2DX8 A;  4QF3 A;  4WZ2 A;  4V3L C;  1WEM A;  3N9N A;  5SVI B;  4AVX A;  5G0F A;  3U5N A;  5TRB A;  4A4C A;  2M13 A;  4AYC A;  3KQI A;  5C13 A;  5H9M A;  1K2F A;  4I7B A;  2CSV A;  3SOW A;  2RI7 A;  3ZYQ A;  4F1P A;  3SOU A;  4OGC A;  3PUQ A;  1FBV A;  2VPD A;  4AYC B;  1T1H A;  2RSD A;  3HCS A;  2EOD A;  4GNE A;  3GV4 A;  2B0O E;  2Y1N A;  3ZVZ B;  3HCT A;  2ECV A;  4F52 B;  5EYA F;  2IQJ A;  2MKE A;  1WIL A;  1DCQ A;  5C11 A;  2I50 A;  2VPB A;  2VP7 A;  1V87 A;  4ZUX U;  5DKA A;  4FK5 A;  4B86 C;  5B8D A;  1LDJ B;  3KNV A;  2OXQ C;  2JMJ A;  2KYU A;  5H1V A;  4YBS A;  2KRE A;  3ZVY A;  3KDE C;  5TDR A;  1F62 A;  3FAN A;  3V43 A;  3LJU X;  1MM2 A;  3FL2 A;  2CKL A;  4ZQL A;  4H9D A;  3O33 A;  5SVX A;  2KWK A;  2MUM A;  2KU3 A;  2KKX A;  2YQL A;  2Y1M A;  2CSY A;  4A0C D;  3O47 A;  5I3L A;  4I7C A;  3DWD A;  3RPG C;  3EB5 A;  3RTR B;  2F6J A;  2IDA A;  2LQ6 A;  1WEQ A;  2CKL B;  4LKA A;  2KGI A;  2FD4 A;  3LRQ A;  2K16 A;  4R2Y A;  3N9O A;  2ECG A;  1XWH A;  1Z2Q A;  2VJF B;  5TAB A;  5LKU A;  2KIZ A;  2NAA A;  3LDY A;  4FIP A;  2HDP A;  1WGM A;  2C2V S;  1IYM A;  2KR4 A;  5J3X A;  1VFY A;  1MBM A;  2MD7 B;  1N87 A;  4R8P K;  4YAD A;  3I2D A;  3LVQ E;  1WEN A;  4GND A;  4LLB A;  3PUR A;  4GNG A;  3VK6 A;  3SOX A;  2YW8 A;  2QJ0 A;  3N9P A;  2YSM A;  4QF2 A;  3M62 A;  2KFT A;  2L80 A;  4TKP B;  2YUC A;  4Z0R A;  4YBM A;  4S3O B;  4IC3 A;  5LKT A;  3ASL A;  4Z0O A;  1X4U A;  2L43 A;  3E2D A;  2LGV A;  5AIU A;  2YYR A;  4PTB A;  1U6G B;  2UZG A;  2L0B A;  4QQ4 A;  4WZ3 B;  3FAO A;  3HTK C;  1WEU A;  2YHO A;  4O64 A;  2KWN A;  4UI9 B;  2VNF A;  4CCG X;  4R7E A;  2LRI C;  3N9M A;  2D8S A;  2PUY A;  2XOZ A;  3QZV A;  5TDW A;  3O70 A;  3U5M A;  2LAU A;  2MNY A;  2AN6 A;  2F6N A;  5JG6 A;  2P57 A;  2LGL A;  4N4F A;  4YBT A;  4LK9 A;  2M1R A;  1WEE A;  1WFK A;  2MIQ A;  2VJE A;  2YQM A;  3JUE A;  2C2L A;  2LN0 A;  4CA1 A;  5KH7 A;  4BBQ A;  4V3K C;  4I7D A;  5D1K B;  3MHS A;  4MSX A;  1Z60 A;  2KE1 A;  5B77 A;  4WZ0 A;  5SVY A;  3N9L A;  4WA6 A;  3O35 A;  4A49 A;  2LXP C;  3IHP A;  1X4J A;  3L1X A;  4NN2 A;  5B75 A;  2D8U A;  3LVR E;  2L7P A;  3ZNI A;  2M85 A;  3LQJ A;  3LQI A;  4ZDT A;  2YVR A;  2KWJ A;  4A4B A;  3ZPV 1;  4GNF A;  3T7L A;  2OWA A;  2FFW A;  4C9Z A;  2E6R A;  3ZPV E;  2K1J A;  3M63 A;  2JM3 A;  5FB1 A;  4L7X A;  2FUU A;  2LV9 A;  5LKZ A;  3M7K A;  3KV5 A;  2XOC A;  2YHN A;  3DQV R;  1RMD A;  2QIC A;  4YAT A;  3U5P A;  2XP0 A;  5G05 B;  4O62 A;  4W4U A;  2XB1 A;  3T9K A;  3C6W A;  4Q6F A;  3SUB A;  1JOC A;  2YT5 A;  1HYJ A;  3EB6 A;  2L75 A;  2MNZ A;  2FSA A;  1HYI A;  2VPE A;  2YSJ A;  2M3H A;  2ECI A;  5SVI A;  1VD4 A;  2LGG A;  3U5O A;  2LGK A;  5FER A;  2JMI A;  2E61 A;  2ZET C;  3O34 A;  5AIT A;  1WEP A;  2EGM A;  1FP0 A;  1X4I A;  2VPG A;  2YUR A;  3HCU A;  2CRW A;  3H7H A;  2CT2 A;  2PNX A;  2M6M A;  2HYE D;  4YC9 A;  2MA5 A;  4P5O B;  2Y43 A;  5FB0 A;  5B79 A;  2KWO A;  4FJC A;  3FJU B;  4BHW A;  3M99 A;  2H0D A;  1WEO A;  2L5U A;  3SHB A;  2EXU A;  1VYX A;  1WEV A;  5D1L B;  3FEH A;  2LXH C;  4S3O C;  3ZTG A;  2H0D B;  4YAB A;  4B7Y C;  4N3W A;  2F42 A;  1WES A;  2EA6 A;  2RR4 A;  1JM7 A;  5G04 B;  2DJA A;  3L11 A;  5K3Q A;  4OGE A;  3FM8 C;  1CHC A;  5KH9 A;  1Z6U A;  3RPG B;  2K4D A; 
#chains in the Genus database with same CATH homology
 4PPE A;  2JRJ A;  5H1U A;  2XEU A;  5KH3 A;  1JM7 B;  2VJE B;  3KV6 A;  2G43 A;  3O7A A;  2CSZ A;  1E4U A;  4UP0 A;  4AP4 A;  4L58 A;  1WE9 A;  2MT5 A;  3L1Z B;  1MM3 A;  4XI1 A;  2EGP A;  1DVP A;  2ECN A;  5D1M B;  3PHD A;  2E6S A;  3DPL R;  4X3G A;  2G6Q A;  4GB0 A;  2BAY A;  2VJF A;  3N9Q A;  1LDK C;  4AUQ B;  3GL6 A;  2YU4 A;  1WEW A;  2KGG A;  1ZBD B;  3MHH A;  5B76 A;  5FEY A;  2ECT A;  2YRE A;  3LQH A;  5LKX A;  4YAX A;  3O37 A;  4LAD B;  2FUI A;  4IC2 A;  5H1T A;  1G25 A;  4MVT A;  3O36 A;  4FO9 A;  2K17 A;  5LCW B;  3NG2 A;  5B78 A;  5TBN A;  3C5K A;  1BOR A;  2LDR A;  2MA6 A;  2ECJ A;  2JMD A;  4LJN A;  2MD8 C;  1WIM A;  3T6R A;  4UP5 A;  2QIZ A;  2ECW A;  5DIN A;  2G45 A;  2DX8 A;  4QF3 A;  4WZ2 A;  4V3L C;  1WEM A;  3N9N A;  4AVX A;  5G0F A;  3U5N A;  5TRB A;  4A4C A;  4AYC A;  3KQI A;  5C13 A;  5H9M A;  1K2F A;  4I7B A;  3SOW A;  2RI7 A;  3ZYQ A;  3SOU A;  3PUQ A;  1FBV A;  2VPD A;  4AYC B;  1T1H A;  2RSD A;  3HCS A;  2EOD A;  4GNE A;  3GV4 A;  2Y1N A;  3ZVZ B;  3HCT A;  2ECV A;  4F52 B;  5EYA F;  1WIL A;  5C11 A;  2I50 A;  2VPB A;  2VP7 A;  1V87 A;  4ZUX U;  5DKA A;  4FK5 A;  4B86 C;  5B8D A;  1LDJ B;  3KNV A;  2OXQ C;  2JMJ A;  2KYU A;  5H1V A;  4YBS A;  2KRE A;  3ZVY A;  5TDR A;  1F62 A;  3V43 A;  1MM2 A;  3FL2 A;  2CKL A;  4ZQL A;  3O33 A;  2KWK A;  2MUM A;  2KU3 A;  2YQL A;  2Y1M A;  2CSY A;  4A0C D;  5I3L A;  4I7C A;  3RPG C;  3EB5 A;  3RTR B;  2F6J A;  2IDA A;  2LQ6 A;  1WEQ A;  2CKL B;  4LKA A;  2KGI A;  3LRQ A;  2K16 A;  4R2Y A;  3N9O A;  2ECG A;  1XWH A;  1Z2Q A;  2VJF B;  5TAB A;  5LKU A;  2KIZ A;  2NAA A;  4FIP A;  2HDP A;  1WGM A;  2C2V S;  1IYM A;  2KR4 A;  5J3X A;  1VFY A;  2MD7 B;  1N87 A;  4R8P K;  4YAD A;  3I2D A;  1WEN A;  4GND A;  4LLB A;  3PUR A;  4GNG A;  3VK6 A;  3SOX A;  2YW8 A;  2QJ0 A;  3N9P A;  2YSM A;  4QF2 A;  3M62 A;  2KFT A;  2L80 A;  4TKP B;  2YUC A;  4YBM A;  4S3O B;  4IC3 A;  5LKT A;  3ASL A;  1X4U A;  2L43 A;  2LGV A;  5AIU A;  2YYR A;  4PTB A;  1U6G B;  2UZG A;  2L0B A;  4WZ3 B;  3HTK C;  1WEU A;  2YHO A;  4O64 A;  2KWN A;  4UI9 B;  2VNF A;  4CCG X;  4R7E A;  2LRI C;  3N9M A;  2D8S A;  2PUY A;  3QZV A;  5TDW A;  3O70 A;  3U5M A;  2MNY A;  2AN6 A;  2F6N A;  5JG6 A;  2LGL A;  4N4F A;  4YBT A;  4LK9 A;  2M1R A;  1WEE A;  1WFK A;  2MIQ A;  2VJE A;  2YQM A;  2C2L A;  2LN0 A;  4CA1 A;  5KH7 A;  4BBQ A;  4V3K C;  4I7D A;  5D1K B;  3MHS A;  4MSX A;  1Z60 A;  2KE1 A;  5B77 A;  4WZ0 A;  3N9L A;  4WA6 A;  3O35 A;  4A49 A;  2LXP C;  3IHP A;  1X4J A;  3L1X A;  4NN2 A;  5B75 A;  3ZNI A;  2M85 A;  3LQJ A;  3LQI A;  4ZDT A;  2KWJ A;  4A4B A;  3ZPV 1;  4GNF A;  3T7L A;  4C9Z A;  2E6R A;  3ZPV E;  2K1J A;  3M63 A;  5FB1 A;  4L7X A;  2FUU A;  2LV9 A;  5LKZ A;  3KV5 A;  2YHN A;  3DQV R;  1RMD A;  2QIC A;  4YAT A;  3U5P A;  5G05 B;  4W4U A;  2XB1 A;  3C6W A;  4Q6F A;  1JOC A;  2YT5 A;  1HYJ A;  3EB6 A;  2L75 A;  2MNZ A;  2FSA A;  1HYI A;  2VPE A;  2YSJ A;  2M3H A;  2ECI A;  1VD4 A;  2LGG A;  3U5O A;  2LGK A;  5FER A;  2JMI A;  2ZET C;  3O34 A;  5AIT A;  1WEP A;  1FP0 A;  1X4I A;  2VPG A;  2YUR A;  3HCU A;  2CT2 A;  2PNX A;  2M6M A;  2HYE D;  4YC9 A;  2MA5 A;  4P5O B;  2Y43 A;  5FB0 A;  5B79 A;  2KWO A;  4FJC A;  4BHW A;  3M99 A;  2H0D A;  1WEO A;  2L5U A;  3SHB A;  1VYX A;  1WEV A;  5D1L B;  2LXH C;  4S3O C;  3ZTG A;  2H0D B;  4YAB A;  4B7Y C;  4N3W A;  2F42 A;  1WES A;  2EA6 A;  1JM7 A;  5G04 B;  3L11 A;  1CHC A;  5KH9 A;  1Z6U A;  3RPG B;  2K4D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...