5D1LB

Crystal structure of ubch5b in complex with the ring-u5br fragment of ao7 (y165a)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
127
structure length
111
Chain Sequence
b'NIPHGQCVICLYGFQEKEAFTKTPCYHYFHCHCLARAIQHMEQELKAQGVGVQCPVCREPLVYDLASLKAAPEPQQPMELYQPSAESLRQQEERKRLYQRQQERGGIIDLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquitin-conjugating enzyme E2 D2
publication title Insights into Ubiquitination from the Unique Clamp-like Binding of the RING E3 AO7 to the E2 UbcH5B.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 28
structure length 111
sequence length 127
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5d1lB01
4BHWA 2VJFA 2LDRA 2VJEB 3N9QA 1WEPA 2F42A 3O37A 4AYCA 5H1VA 4N4FA 1JM7A 2KFTA 2EODA 1HYJA 2H0DA 5TDWA 3SOUA 2LRIC 2ECJA 4I7BA 5KH3A 2HDPA 1Z2QA 2JMDA 4C9ZA 1WEQA 2M1RA 2LV9A 2MUMA 2PUYA 5B77A 2ZETC 4ZUXU 2L43A 3L11A 1G25A 5D1LB 2G45A 4A4CA 2D8SA 2H0DB 2KGGA 2YT5A 4AP4A 3U5NA 4YC9A 2OXQC 4YADA 2RI7A 4R8PK 5H1TA 5KH9A 1X4UA 1T1HA 5J3XA 2CT2A 5H1UA 2JRJA 3KV5A 4A49A 2CSZA 4V3LC 1CHCA 4YBMA 5AIUA 5AITA 2Y43A 2L5UA 5B8DA 2KREA 4YBSA 4LADB 4LKAA 5FB1A 5I3LA 3N9NA 2G6QA 1Z6UA 3PUQA 2KWOA 3T6RA 3I2DA 2LGKA 4TKPB 2ECVA 4GNGA 4LK9A 2ECNA 2MT5A 2YYRA 3GL6A 1VYXA 4XI1A 2F6JA 2VPDA 2CKLB 2VJEA 5DINA 5EYAF 5B75A 3DQVR 1MM2A 3PHDA 2YQLA 2LN0A 4A4BA 2VPGA 3RPGB 2ECGA 1Z60A 2QIZA 3QZVA 1U6GB 1X4IA 5G0FA 3ZVYA 1WEWA 3SOWA 3LQIA 2KGIA 2YSMA 3HCTA 2AN6A 2K1JA 4FO9A 2MD8C 3T7LA 2HYED 2KWNA 4UP5A 3PURA 3FL2A 2VNFA 3O70A 5JG6A 3L1ZB 3KNVA 2ECWA 4BBQA 2YHOA 4GB0A 2FUUA 5B76A 2KIZA 2LQ6A 4GNEA 4UI9B 2YURA 2LGVA 3ZYQA 5B78A 4GNDA 1WIMA 3N9OA 4CA1A 4F52B 1LDKC 2KWJA 3N9PA 2PNXA 2VPEA 2C2VS 4W4UA 4QF3A 4O64A 4A0CD 2F6NA 4YATA 2C2LA 3M62A 1WEOA 1WEVA 4QF2A 2M85A 4IC3A 3IHPA 4R2YA 4YABA 2IDAA 2KU3A 1MM3A 3HTKC 2CKLA 2E6SA 2KE1A 2L75A 2XEUA 5G05B 2JMIA 3DPLR 4YBTA 2I50A 1VD4A 2K4DA 3MHSA 3GV4A 3HCUA 2UZGA 2KWKA 5DKAA 5FERA 1K2FA 2NAAA 2M3HA 2YUCA 5D1MB 2E6RA 3U5OA 3KQIA 4WA6A 1FBVA 1WFKA 5H9MA 5C11A 3KV6A 4GNFA 1E4UA 3RPGC 4FK5A 2LXHC 2ECIA 4FJCA 3ZNIA 3ZPVE 2LGLA 5TABA 3LQJA 4X3GA 1F62A 4YAXA 2Y1MA 4B86C 2MNYA 2YSJA 3ZTGA 4P5OB 4CCGX 3O7AA 3U5PA 1FP0A 4LLBA 2DX8A 1WE9A 3O35A 3O36A 5LKTA 4PTBA 2YW8A 2K17A 4AVXA 4WZ2A 2XB1A 4V3KC 4S3OC 4S3OB 3N9LA 1WESA 5LCWB 4L58A 3O33A 3N9MA 2LGGA 4WZ3B 3EB6A 2LXPC 2EGPA 3V43A 2KYUA 5LKXA 2G43A 2KR4A 2MIQA 3C6WA 1WEMA 4R7EA 3ZVZB 1LDJB 1BORA 4B7YC 4MSXA 1VFYA 1WILA 3LRQA 1DVPA 2JMJA 2VJFB 5FB0A 2YREA 4I7CA 4UP0A 5FEYA 4N3WA 4Q6FA 5D1KB 3SOXA 4AYCB 1JM7B 3SHBA 1RMDA 3MHHA 2MNZA 4WZ0A 1X4JA 1N87A 3ASLA 1ZBDB 4ZDTA 3RTRB 4ZQLA 1XWHA 3C5KA 1V87A 4PPEA 1IYMA 5B79A 2MA5A 5TDRA 4LJNA 3U5MA 4NN2A 1HYIA 2YHNA 2QJ0A 2L0BA 3M63A 3NG2A 4MVTA 5TRBA 3L1XA 2QICA 3LQHA 1WEEA 2L80A 1WEUA 5G04B 1WENA 4IC2A 3O34A 5KH7A 5C13A 3VK6A 3HCSA 4FIPA 5LKUA 2MA6A 2FUIA 2Y1NA 2YU4A 2BAYA 1WGMA 2M6MA 2VP7A 2K16A 2FSAA 4AUQB 1JOCA 3M99A 2EA6A 3ZPV1 5LKZA 2ECTA 2MD7B 2VPBA 5TBNA 2YQMA 4I7DA 3EB5A 2RSDA 2CSYA 4L7XA
chains in the Genus database with same CATH superfamily
4BHWA 2VJFA 2LDRA 2VJEB 3N9QA 1WEPA 2MKEA 2F42A 2KKYA 3FJUB 3O37A 4AYCA 5H1VA 4N4FA 1JM7A 2KFTA 3LVQE 2XOCA 2EODA 1HYJA 2H0DA 3O47A 5TDWA 3SOUA 2LRIC 2ECJA 4I7BA 5KH3A 2HDPA 1Z2QA 3DWDA 2JMDA 4C9ZA 4F1PA 1WEQA 2M1RA 2E61A 2LV9A 2MUMA 3KDEC 2PUYA 5B77A 2ZETC 4ZUXU 2L43A 3L11A 1G25A 5D1LB 2G45A 4A4CA 2D8SA 2H0DB 2KGGA 2YT5A 4AP4A 3U5NA 2CSVA 4YC9A 2OXQC 4YADA 2RI7A 4R8PK 5H1TA 5KH9A 1X4UA 1T1HA 5J3XA 2CT2A 5H1UA 2JRJA 3KV5A 4A49A 2CSZA 4V3LC 1CHCA 4YBMA 5AIUA 5AITA 5SVIA 2Y43A 2L5UA 5B8DA 2KREA 4YBSA 4LADB 4LKAA 5FB1A 5I3LA 3N9NA 1Z6UA 2G6QA 2EXUA 3PUQA 2KWOA 3T6RA 2P57A 3I2DA 2LGKA 4TKPB 2ECVA 4O62A 1DCQA 4GNGA 4LK9A 2ECNA 2MT5A 2YYRA 3GL6A 1VYXA 4XI1A 2F6JA 2VPDA 5K3QA 2CKLB 2VJEA 5DINA 5EYAF 3E2DA 5B75A 3DQVR 3MDBC 3LDYA 1MM2A 3PHDA 2YQLA 2LN0A 2D8UA 4A4BA 2VPGA 2XP0A 3RPGB 2ECGA 1Z60A 2QIZA 3QZVA 1U6GB 1X4IA 5G0FA 3ZVYA 1WEWA 3SOWA 1MBMA 2KGIA 3LQIA 2YSMA 3HCTA 2EGMA 2FFWA 2AN6A 3FM8C 3T9KA 2K1JA 4FO9A 2MD8C 3FANA 3T7LA 2HYED 2KWNA 4UP5A 3PURA 3FL2A 2VNFA 3O70A 5JG6A 3L1ZB 3KNVA 2ECWA 2M13A 2XOYA 4BBQA 2YHOA 4GB0A 2FUUA 4QQ4A 5B76A 2KIZA 2LQ6A 3LVRE 4GNEA 4UI9B 2YURA 3DDTA 2LGVA 2IQJA 3ZYQA 5B78A 4GNDA 1WIMA 4H9DA 3N9OA 3LJUX 4CA1A 4F52B 1LDKC 2KWJA 3M7KA 3N9PA 2PNXA 2VPEA 2C2VS 4W4UA 2XOZA 4QF3A 4O64A 4A0CD 2F6NA 4YATA 2C2LA 3M62A 1WEOA 4OGEA 1WEVA 4QF2A 2M85A 4IC3A 3IHPA 4R2YA 4YABA 2LAUA 2IDAA 5SVXA 3JUEA 2KU3A 1MM3A 3HTKC 2CKLA 2E6SA 2KE1A 2L75A 2XEUA 5G05B 2JMIA 3DPLR 4YBTA 2I50A 1VD4A 2K4DA 3MHSA 3GV4A 3HCUA 2FD4A 2UZGA 2KWKA 5DKAA 5FERA 1K2FA 2NAAA 2M3HA 2YUCA 5D1MB 2E6RA 3U5OA 3KQIA 4WA6A 1FBVA 1WFKA 5H9MA 3H7HA 5C11A 3KV6A 2OWAA 2RR4A 4GNFA 1E4UA 3RPGC 4FK5A 2LXHC 3PLWA 2ECIA 4FJCA 3ZNIA 3SUBA 3ZPVE 2LGLA 5TABA 3LQJA 4X3GA 1F62A 4YAXA 2Y1MA 4B86C 2MNYA 2YVRA 2YSJA 2L7PA 3ZTGA 4P5OB 4CCGX 3O7AA 3U5PA 1FP0A 4LLBA 2DX8A 1WE9A 3O35A 3O36A 5LKTA 4PTBA 2YW8A 2K17A 4AVXA 4WZ2A 2XB1A 2CRWA 4V3KC 4S3OC 4S3OB 3N9LA 1WESA 5LCWB 4L58A 3O33A 3N9MA 2LGGA 4WZ3B 3EB6A 2LXPC 2EGPA 3V43A 2KYUA 5LKXA 2G43A 2KR4A 2MIQA 2JUNA 3C6WA 1WEMA 4R7EA 5SVYA 3ZVZB 1LDJB 2CONA 1BORA 4B7YC 2B0OE 4MSXA 1VFYA 1WILA 3LRQA 1DVPA 2JMJA 2VJFB 5FB0A 2YREA 4I7CA 4UP0A 5FEYA 4N3WA 4Q6FA 5D1KB 3SOXA 4AYCB 1JM7B 3SHBA 2DSMA 1RMDA 3MHHA 2MNZA 4WZ0A 1X4JA 4Z0OA 2KKXA 1N87A 3ASLA 1ZBDB 4ZDTA 3RTRB 4ZQLA 1XWHA 3C5KA 1V87A 4PPEA 1IYMA 5B79A 2MA5A 2JM3A 5TDRA 4LJNA 3U5MA 4NN2A 1HYIA 2YHNA 2DJAA 2QJ0A 2L0BA 3M63A 3NG2A 4MVTA 3FAOA 5TRBA 3L1XA 4OGCA 2QICA 3LQHA 1WEEA 2L80A 1WEUA 5G04B 1WENA 3FEHA 4IC2A 4Z0RA 3O34A 3Q1DA 5KH7A 5C13A 3VK6A 3HCSA 4FIPA 5LKUA 2MA6A 5SVIB 2CRRA 2FUIA 2Y1NA 2YU4A 2BAYA 1WGMA 2M6MA 2VP7A 2K16A 2FSAA 4AUQB 1JOCA 3M99A 2EA6A 3ZPV1 5LKZA 2ECTA 2MD7B 2VPBA 5TBNA 2YQMA 4I7DA 3EB5A 2RSDA 2CSYA 4L7XA
chains in the Genus database with same CATH topology
4BHWA 2VJFA 2LDRA 2VJEB 3N9QA 1WEPA 2F42A 3O37A 4AYCA 5H1VA 4N4FA 1JM7A 2KFTA 2EODA 1HYJA 2H0DA 5TDWA 3SOUA 2LRIC 2ECJA 4I7BA 5KH3A 2HDPA 1Z2QA 2JMDA 4C9ZA 1WEQA 2M1RA 2LV9A 2MUMA 2PUYA 5B77A 2ZETC 4ZUXU 2L43A 3L11A 1G25A 5D1LB 2G45A 4A4CA 2D8SA 2H0DB 2KGGA 2YT5A 4AP4A 3U5NA 4YC9A 2OXQC 4YADA 2RI7A 4R8PK 5H1TA 5KH9A 1X4UA 1T1HA 5J3XA 2CT2A 5H1UA 2JRJA 3KV5A 4A49A 2CSZA 4V3LC 1CHCA 4YBMA 5AIUA 5AITA 2Y43A 2L5UA 5B8DA 2KREA 4YBSA 4LADB 4LKAA 5FB1A 5I3LA 3N9NA 2G6QA 1Z6UA 3PUQA 2KWOA 3T6RA 3I2DA 2LGKA 4TKPB 2ECVA 4GNGA 4LK9A 2ECNA 2MT5A 2YYRA 3GL6A 1VYXA 4XI1A 2F6JA 2VPDA 2CKLB 2VJEA 5DINA 5EYAF 5B75A 3DQVR 1MM2A 3PHDA 2YQLA 2LN0A 4A4BA 2VPGA 3RPGB 2ECGA 1Z60A 2QIZA 3QZVA 1U6GB 1X4IA 5G0FA 3ZVYA 1WEWA 3SOWA 3LQIA 2KGIA 2YSMA 3HCTA 2AN6A 2K1JA 4FO9A 2MD8C 3T7LA 2HYED 2KWNA 4UP5A 3PURA 3FL2A 2VNFA 3O70A 5JG6A 3L1ZB 3KNVA 2ECWA 4BBQA 2YHOA 4GB0A 2FUUA 5B76A 2KIZA 2LQ6A 4GNEA 4UI9B 2YURA 2LGVA 3ZYQA 5B78A 4GNDA 1WIMA 3N9OA 4CA1A 4F52B 1LDKC 2KWJA 3N9PA 2PNXA 2VPEA 2C2VS 4W4UA 4QF3A 4O64A 4A0CD 2F6NA 4YATA 2C2LA 3M62A 1WEOA 1WEVA 4QF2A 2M85A 4IC3A 3IHPA 4R2YA 4YABA 2IDAA 2KU3A 1MM3A 3HTKC 2CKLA 2E6SA 2KE1A 2L75A 2XEUA 5G05B 2JMIA 3DPLR 4YBTA 2I50A 1VD4A 2K4DA 3MHSA 3GV4A 3HCUA 2UZGA 2KWKA 5DKAA 5FERA 1K2FA 2NAAA 2M3HA 2YUCA 5D1MB 2E6RA 3U5OA 3KQIA 4WA6A 1FBVA 1WFKA 5H9MA 5C11A 3KV6A 4GNFA 1E4UA 3RPGC 4FK5A 2LXHC 2ECIA 4FJCA 3ZNIA 3ZPVE 2LGLA 5TABA 3LQJA 4X3GA 1F62A 4YAXA 2Y1MA 4B86C 2MNYA 2YSJA 3ZTGA 4P5OB 4CCGX 3O7AA 3U5PA 1FP0A 4LLBA 2DX8A 1WE9A 3O35A 3O36A 5LKTA 4PTBA 2YW8A 2K17A 4AVXA 4WZ2A 2XB1A 4V3KC 4S3OC 4S3OB 3N9LA 1WESA 5LCWB 4L58A 3O33A 3N9MA 2LGGA 4WZ3B 3EB6A 2LXPC 2EGPA 3V43A 2KYUA 5LKXA 2G43A 2KR4A 2MIQA 3C6WA 1WEMA 4R7EA 3ZVZB 1LDJB 1BORA 4B7YC 4MSXA 1VFYA 1WILA 3LRQA 1DVPA 2JMJA 2VJFB 5FB0A 2YREA 4I7CA 4UP0A 5FEYA 4N3WA 4Q6FA 5D1KB 3SOXA 4AYCB 1JM7B 3SHBA 1RMDA 3MHHA 2MNZA 4WZ0A 1X4JA 1N87A 3ASLA 1ZBDB 4ZDTA 3RTRB 4ZQLA 1XWHA 3C5KA 1V87A 4PPEA 1IYMA 5B79A 2MA5A 5TDRA 4LJNA 3U5MA 4NN2A 1HYIA 2YHNA 2QJ0A 2L0BA 3M63A 3NG2A 4MVTA 5TRBA 3L1XA 2QICA 3LQHA 1WEEA 2L80A 1WEUA 5G04B 1WENA 4IC2A 3O34A 5KH7A 5C13A 3VK6A 3HCSA 4FIPA 5LKUA 2MA6A 2FUIA 2Y1NA 2YU4A 2BAYA 1WGMA 2M6MA 2VP7A 2K16A 2FSAA 4AUQB 1JOCA 3M99A 2EA6A 3ZPV1 5LKZA 2ECTA 2MD7B 2VPBA 5TBNA 2YQMA 4I7DA 3EB5A 2RSDA 2CSYA 4L7XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BHW A;  2VJF A;  2LDR A;  2VJE B;  3N9Q A;  1WEP A;  2F42 A;  3O37 A;  4AYC A;  5H1V A;  4N4F A;  1JM7 A;  2KFT A;  2EOD A;  1HYJ A;  2H0D A;  5TDW A;  3SOU A;  2LRI C;  2ECJ A;  4I7B A;  5KH3 A;  2HDP A;  1Z2Q A;  2JMD A;  4C9Z A;  1WEQ A;  2M1R A;  2LV9 A;  2MUM A;  2PUY A;  5B77 A;  2ZET C;  4ZUX U;  2L43 A;  3L11 A;  1G25 A;  5D1L B;  2G45 A;  4A4C A;  2D8S A;  2H0D B;  2KGG A;  2YT5 A;  4AP4 A;  3U5N A;  4YC9 A;  2OXQ C;  4YAD A;  2RI7 A;  4R8P K;  5H1T A;  5KH9 A;  1X4U A;  1T1H A;  5J3X A;  2CT2 A;  5H1U A;  2JRJ A;  3KV5 A;  4A49 A;  2CSZ A;  4V3L C;  1CHC A;  4YBM A;  5AIU A;  5AIT A;  2Y43 A;  2L5U A;  5B8D A;  2KRE A;  4YBS A;  4LAD B;  4LKA A;  5FB1 A;  5I3L A;  3N9N A;  2G6Q A;  1Z6U A;  3PUQ A;  2KWO A;  3T6R A;  3I2D A;  2LGK A;  4TKP B;  2ECV A;  4GNG A;  4LK9 A;  2ECN A;  2MT5 A;  2YYR A;  3GL6 A;  1VYX A;  4XI1 A;  2F6J A;  2VPD A;  2CKL B;  2VJE A;  5DIN A;  5EYA F;  5B75 A;  3DQV R;  1MM2 A;  3PHD A;  2YQL A;  2LN0 A;  4A4B A;  2VPG A;  3RPG B;  2ECG A;  1Z60 A;  2QIZ A;  3QZV A;  1U6G B;  1X4I A;  5G0F A;  3ZVY A;  1WEW A;  3SOW A;  3LQI A;  2KGI A;  2YSM A;  3HCT A;  2AN6 A;  2K1J A;  4FO9 A;  2MD8 C;  3T7L A;  2HYE D;  2KWN A;  4UP5 A;  3PUR A;  3FL2 A;  2VNF A;  3O70 A;  5JG6 A;  3L1Z B;  3KNV A;  2ECW A;  4BBQ A;  2YHO A;  4GB0 A;  2FUU A;  5B76 A;  2KIZ A;  2LQ6 A;  4GNE A;  4UI9 B;  2YUR A;  2LGV A;  3ZYQ A;  5B78 A;  4GND A;  1WIM A;  3N9O A;  4CA1 A;  4F52 B;  1LDK C;  2KWJ A;  3N9P A;  2PNX A;  2VPE A;  2C2V S;  4W4U A;  4QF3 A;  4O64 A;  4A0C D;  2F6N A;  4YAT A;  2C2L A;  3M62 A;  1WEO A;  1WEV A;  4QF2 A;  2M85 A;  4IC3 A;  3IHP A;  4R2Y A;  4YAB A;  2IDA A;  2KU3 A;  1MM3 A;  3HTK C;  2CKL A;  2E6S A;  2KE1 A;  2L75 A;  2XEU A;  5G05 B;  2JMI A;  3DPL R;  4YBT A;  2I50 A;  1VD4 A;  2K4D A;  3MHS A;  3GV4 A;  3HCU A;  2UZG A;  2KWK A;  5DKA A;  5FER A;  1K2F A;  2NAA A;  2M3H A;  2YUC A;  5D1M B;  2E6R A;  3U5O A;  3KQI A;  4WA6 A;  1FBV A;  1WFK A;  5H9M A;  5C11 A;  3KV6 A;  4GNF A;  1E4U A;  3RPG C;  4FK5 A;  2LXH C;  2ECI A;  4FJC A;  3ZNI A;  3ZPV E;  2LGL A;  5TAB A;  3LQJ A;  4X3G A;  1F62 A;  4YAX A;  2Y1M A;  4B86 C;  2MNY A;  2YSJ A;  3ZTG A;  4P5O B;  4CCG X;  3O7A A;  3U5P A;  1FP0 A;  4LLB A;  2DX8 A;  1WE9 A;  3O35 A;  3O36 A;  5LKT A;  4PTB A;  2YW8 A;  2K17 A;  4AVX A;  4WZ2 A;  2XB1 A;  4V3K C;  4S3O C;  4S3O B;  3N9L A;  1WES A;  5LCW B;  4L58 A;  3O33 A;  3N9M A;  2LGG A;  4WZ3 B;  3EB6 A;  2LXP C;  2EGP A;  3V43 A;  2KYU A;  5LKX A;  2G43 A;  2KR4 A;  2MIQ A;  3C6W A;  1WEM A;  4R7E A;  3ZVZ B;  1LDJ B;  1BOR A;  4B7Y C;  4MSX A;  1VFY A;  1WIL A;  3LRQ A;  1DVP A;  2JMJ A;  2VJF B;  5FB0 A;  2YRE A;  4I7C A;  4UP0 A;  5FEY A;  4N3W A;  4Q6F A;  5D1K B;  3SOX A;  4AYC B;  1JM7 B;  3SHB A;  1RMD A;  3MHH A;  2MNZ A;  4WZ0 A;  1X4J A;  1N87 A;  3ASL A;  1ZBD B;  4ZDT A;  3RTR B;  4ZQL A;  1XWH A;  3C5K A;  1V87 A;  4PPE A;  1IYM A;  5B79 A;  2MA5 A;  5TDR A;  4LJN A;  3U5M A;  4NN2 A;  1HYI A;  2YHN A;  2QJ0 A;  2L0B A;  3M63 A;  3NG2 A;  4MVT A;  5TRB A;  3L1X A;  2QIC A;  3LQH A;  1WEE A;  2L80 A;  1WEU A;  5G04 B;  1WEN A;  4IC2 A;  3O34 A;  5KH7 A;  5C13 A;  3VK6 A;  3HCS A;  4FIP A;  5LKU A;  2MA6 A;  2FUI A;  2Y1N A;  2YU4 A;  2BAY A;  1WGM A;  2M6M A;  2VP7 A;  2K16 A;  2FSA A;  4AUQ B;  1JOC A;  3M99 A;  2EA6 A;  3ZPV 1;  5LKZ A;  2ECT A;  2MD7 B;  2VPB A;  5TBN A;  2YQM A;  4I7D A;  3EB5 A;  2RSD A;  2CSY A;  4L7X A; 
#chains in the Genus database with same CATH topology
 4BHW A;  2VJF A;  2LDR A;  2VJE B;  3N9Q A;  1WEP A;  2MKE A;  2F42 A;  2KKY A;  3FJU B;  3O37 A;  4AYC A;  5H1V A;  4N4F A;  1JM7 A;  2KFT A;  3LVQ E;  2XOC A;  2EOD A;  1HYJ A;  2H0D A;  3O47 A;  5TDW A;  3SOU A;  2LRI C;  2ECJ A;  4I7B A;  5KH3 A;  2HDP A;  1Z2Q A;  3DWD A;  2JMD A;  4C9Z A;  4F1P A;  1WEQ A;  2M1R A;  2E61 A;  2LV9 A;  2MUM A;  3KDE C;  2PUY A;  5B77 A;  2ZET C;  4ZUX U;  2L43 A;  3L11 A;  1G25 A;  5D1L B;  2G45 A;  4A4C A;  2D8S A;  2H0D B;  2KGG A;  2YT5 A;  4AP4 A;  3U5N A;  2CSV A;  4YC9 A;  2OXQ C;  4YAD A;  2RI7 A;  4R8P K;  5H1T A;  5KH9 A;  1X4U A;  1T1H A;  5J3X A;  2CT2 A;  5H1U A;  2JRJ A;  3KV5 A;  4A49 A;  2CSZ A;  4V3L C;  1CHC A;  4YBM A;  5AIU A;  5AIT A;  5SVI A;  2Y43 A;  2L5U A;  5B8D A;  2KRE A;  4YBS A;  4LAD B;  4LKA A;  5FB1 A;  5I3L A;  3N9N A;  1Z6U A;  2G6Q A;  2EXU A;  3PUQ A;  2KWO A;  3T6R A;  2P57 A;  3I2D A;  2LGK A;  4TKP B;  2ECV A;  4O62 A;  1DCQ A;  4GNG A;  4LK9 A;  2ECN A;  2MT5 A;  2YYR A;  3GL6 A;  1VYX A;  4XI1 A;  2F6J A;  2VPD A;  5K3Q A;  2CKL B;  2VJE A;  5DIN A;  5EYA F;  3E2D A;  5B75 A;  3DQV R;  3MDB C;  3LDY A;  1MM2 A;  3PHD A;  2YQL A;  2LN0 A;  2D8U A;  4A4B A;  2VPG A;  2XP0 A;  3RPG B;  2ECG A;  1Z60 A;  2QIZ A;  3QZV A;  1U6G B;  1X4I A;  5G0F A;  3ZVY A;  1WEW A;  3SOW A;  1MBM A;  2KGI A;  3LQI A;  2YSM A;  3HCT A;  2EGM A;  2FFW A;  2AN6 A;  3FM8 C;  3T9K A;  2K1J A;  4FO9 A;  2MD8 C;  3FAN A;  3T7L A;  2HYE D;  2KWN A;  4UP5 A;  3PUR A;  3FL2 A;  2VNF A;  3O70 A;  5JG6 A;  3L1Z B;  3KNV A;  2ECW A;  2M13 A;  2XOY A;  4BBQ A;  2YHO A;  4GB0 A;  2FUU A;  4QQ4 A;  5B76 A;  2KIZ A;  2LQ6 A;  3LVR E;  4GNE A;  4UI9 B;  2YUR A;  3DDT A;  2LGV A;  2IQJ A;  3ZYQ A;  5B78 A;  4GND A;  1WIM A;  4H9D A;  3N9O A;  3LJU X;  4CA1 A;  4F52 B;  1LDK C;  2KWJ A;  3M7K A;  3N9P A;  2PNX A;  2VPE A;  2C2V S;  4W4U A;  2XOZ A;  4QF3 A;  4O64 A;  4A0C D;  2F6N A;  4YAT A;  2C2L A;  3M62 A;  1WEO A;  4OGE A;  1WEV A;  4QF2 A;  2M85 A;  4IC3 A;  3IHP A;  4R2Y A;  4YAB A;  2LAU A;  2IDA A;  5SVX A;  3JUE A;  2KU3 A;  1MM3 A;  3HTK C;  2CKL A;  2E6S A;  2KE1 A;  2L75 A;  2XEU A;  5G05 B;  2JMI A;  3DPL R;  4YBT A;  2I50 A;  1VD4 A;  2K4D A;  3MHS A;  3GV4 A;  3HCU A;  2FD4 A;  2UZG A;  2KWK A;  5DKA A;  5FER A;  1K2F A;  2NAA A;  2M3H A;  2YUC A;  5D1M B;  2E6R A;  3U5O A;  3KQI A;  4WA6 A;  1FBV A;  1WFK A;  5H9M A;  3H7H A;  5C11 A;  3KV6 A;  2OWA A;  2RR4 A;  4GNF A;  1E4U A;  3RPG C;  4FK5 A;  2LXH C;  3PLW A;  2ECI A;  4FJC A;  3ZNI A;  3SUB A;  3ZPV E;  2LGL A;  5TAB A;  3LQJ A;  4X3G A;  1F62 A;  4YAX A;  2Y1M A;  4B86 C;  2MNY A;  2YVR A;  2YSJ A;  2L7P A;  3ZTG A;  4P5O B;  4CCG X;  3O7A A;  3U5P A;  1FP0 A;  4LLB A;  2DX8 A;  1WE9 A;  3O35 A;  3O36 A;  5LKT A;  4PTB A;  2YW8 A;  2K17 A;  4AVX A;  4WZ2 A;  2XB1 A;  2CRW A;  4V3K C;  4S3O C;  4S3O B;  3N9L A;  1WES A;  5LCW B;  4L58 A;  3O33 A;  3N9M A;  2LGG A;  4WZ3 B;  3EB6 A;  2LXP C;  2EGP A;  3V43 A;  2KYU A;  5LKX A;  2G43 A;  2KR4 A;  2MIQ A;  2JUN A;  3C6W A;  1WEM A;  4R7E A;  5SVY A;  3ZVZ B;  1LDJ B;  2CON A;  1BOR A;  4B7Y C;  2B0O E;  4MSX A;  1VFY A;  1WIL A;  3LRQ A;  1DVP A;  2JMJ A;  2VJF B;  5FB0 A;  2YRE A;  4I7C A;  4UP0 A;  5FEY A;  4N3W A;  4Q6F A;  5D1K B;  3SOX A;  4AYC B;  1JM7 B;  3SHB A;  2DSM A;  1RMD A;  3MHH A;  2MNZ A;  4WZ0 A;  1X4J A;  4Z0O A;  2KKX A;  1N87 A;  3ASL A;  1ZBD B;  4ZDT A;  3RTR B;  4ZQL A;  1XWH A;  3C5K A;  1V87 A;  4PPE A;  1IYM A;  5B79 A;  2MA5 A;  2JM3 A;  5TDR A;  4LJN A;  3U5M A;  4NN2 A;  1HYI A;  2YHN A;  2DJA A;  2QJ0 A;  2L0B A;  3M63 A;  3NG2 A;  4MVT A;  3FAO A;  5TRB A;  3L1X A;  4OGC A;  2QIC A;  3LQH A;  1WEE A;  2L80 A;  1WEU A;  5G04 B;  1WEN A;  3FEH A;  4IC2 A;  4Z0R A;  3O34 A;  3Q1D A;  5KH7 A;  5C13 A;  3VK6 A;  3HCS A;  4FIP A;  5LKU A;  2MA6 A;  5SVI B;  2CRR A;  2FUI A;  2Y1N A;  2YU4 A;  2BAY A;  1WGM A;  2M6M A;  2VP7 A;  2K16 A;  2FSA A;  4AUQ B;  1JOC A;  3M99 A;  2EA6 A;  3ZPV 1;  5LKZ A;  2ECT A;  2MD7 B;  2VPB A;  5TBN A;  2YQM A;  4I7D A;  3EB5 A;  2RSD A;  2CSY A;  4L7X A; 
#chains in the Genus database with same CATH homology
 4BHW A;  2VJF A;  2LDR A;  2VJE B;  3N9Q A;  1WEP A;  2F42 A;  3O37 A;  4AYC A;  5H1V A;  4N4F A;  1JM7 A;  2KFT A;  2EOD A;  1HYJ A;  2H0D A;  5TDW A;  3SOU A;  2LRI C;  2ECJ A;  4I7B A;  5KH3 A;  2HDP A;  1Z2Q A;  2JMD A;  4C9Z A;  1WEQ A;  2M1R A;  2LV9 A;  2MUM A;  2PUY A;  5B77 A;  2ZET C;  4ZUX U;  2L43 A;  3L11 A;  1G25 A;  5D1L B;  2G45 A;  4A4C A;  2D8S A;  2H0D B;  2KGG A;  2YT5 A;  4AP4 A;  3U5N A;  4YC9 A;  2OXQ C;  4YAD A;  2RI7 A;  4R8P K;  5H1T A;  5KH9 A;  1X4U A;  1T1H A;  5J3X A;  2CT2 A;  5H1U A;  2JRJ A;  3KV5 A;  4A49 A;  2CSZ A;  4V3L C;  1CHC A;  4YBM A;  5AIU A;  5AIT A;  2Y43 A;  2L5U A;  5B8D A;  2KRE A;  4YBS A;  4LAD B;  4LKA A;  5FB1 A;  5I3L A;  3N9N A;  2G6Q A;  1Z6U A;  3PUQ A;  2KWO A;  3T6R A;  3I2D A;  2LGK A;  4TKP B;  2ECV A;  4GNG A;  4LK9 A;  2ECN A;  2MT5 A;  2YYR A;  3GL6 A;  1VYX A;  4XI1 A;  2F6J A;  2VPD A;  2CKL B;  2VJE A;  5DIN A;  5EYA F;  5B75 A;  3DQV R;  1MM2 A;  3PHD A;  2YQL A;  2LN0 A;  4A4B A;  2VPG A;  3RPG B;  2ECG A;  1Z60 A;  2QIZ A;  3QZV A;  1U6G B;  1X4I A;  5G0F A;  3ZVY A;  1WEW A;  3SOW A;  3LQI A;  2KGI A;  2YSM A;  3HCT A;  2AN6 A;  2K1J A;  4FO9 A;  2MD8 C;  3T7L A;  2HYE D;  2KWN A;  4UP5 A;  3PUR A;  3FL2 A;  2VNF A;  3O70 A;  5JG6 A;  3L1Z B;  3KNV A;  2ECW A;  4BBQ A;  2YHO A;  4GB0 A;  2FUU A;  5B76 A;  2KIZ A;  2LQ6 A;  4GNE A;  4UI9 B;  2YUR A;  2LGV A;  3ZYQ A;  5B78 A;  4GND A;  1WIM A;  3N9O A;  4CA1 A;  4F52 B;  1LDK C;  2KWJ A;  3N9P A;  2PNX A;  2VPE A;  2C2V S;  4W4U A;  4QF3 A;  4O64 A;  4A0C D;  2F6N A;  4YAT A;  2C2L A;  3M62 A;  1WEO A;  1WEV A;  4QF2 A;  2M85 A;  4IC3 A;  3IHP A;  4R2Y A;  4YAB A;  2IDA A;  2KU3 A;  1MM3 A;  3HTK C;  2CKL A;  2E6S A;  2KE1 A;  2L75 A;  2XEU A;  5G05 B;  2JMI A;  3DPL R;  4YBT A;  2I50 A;  1VD4 A;  2K4D A;  3MHS A;  3GV4 A;  3HCU A;  2UZG A;  2KWK A;  5DKA A;  5FER A;  1K2F A;  2NAA A;  2M3H A;  2YUC A;  5D1M B;  2E6R A;  3U5O A;  3KQI A;  4WA6 A;  1FBV A;  1WFK A;  5H9M A;  5C11 A;  3KV6 A;  4GNF A;  1E4U A;  3RPG C;  4FK5 A;  2LXH C;  2ECI A;  4FJC A;  3ZNI A;  3ZPV E;  2LGL A;  5TAB A;  3LQJ A;  4X3G A;  1F62 A;  4YAX A;  2Y1M A;  4B86 C;  2MNY A;  2YSJ A;  3ZTG A;  4P5O B;  4CCG X;  3O7A A;  3U5P A;  1FP0 A;  4LLB A;  2DX8 A;  1WE9 A;  3O35 A;  3O36 A;  5LKT A;  4PTB A;  2YW8 A;  2K17 A;  4AVX A;  4WZ2 A;  2XB1 A;  4V3K C;  4S3O C;  4S3O B;  3N9L A;  1WES A;  5LCW B;  4L58 A;  3O33 A;  3N9M A;  2LGG A;  4WZ3 B;  3EB6 A;  2LXP C;  2EGP A;  3V43 A;  2KYU A;  5LKX A;  2G43 A;  2KR4 A;  2MIQ A;  3C6W A;  1WEM A;  4R7E A;  3ZVZ B;  1LDJ B;  1BOR A;  4B7Y C;  4MSX A;  1VFY A;  1WIL A;  3LRQ A;  1DVP A;  2JMJ A;  2VJF B;  5FB0 A;  2YRE A;  4I7C A;  4UP0 A;  5FEY A;  4N3W A;  4Q6F A;  5D1K B;  3SOX A;  4AYC B;  1JM7 B;  3SHB A;  1RMD A;  3MHH A;  2MNZ A;  4WZ0 A;  1X4J A;  1N87 A;  3ASL A;  1ZBD B;  4ZDT A;  3RTR B;  4ZQL A;  1XWH A;  3C5K A;  1V87 A;  4PPE A;  1IYM A;  5B79 A;  2MA5 A;  5TDR A;  4LJN A;  3U5M A;  4NN2 A;  1HYI A;  2YHN A;  2QJ0 A;  2L0B A;  3M63 A;  3NG2 A;  4MVT A;  5TRB A;  3L1X A;  2QIC A;  3LQH A;  1WEE A;  2L80 A;  1WEU A;  5G04 B;  1WEN A;  4IC2 A;  3O34 A;  5KH7 A;  5C13 A;  3VK6 A;  3HCS A;  4FIP A;  5LKU A;  2MA6 A;  2FUI A;  2Y1N A;  2YU4 A;  2BAY A;  1WGM A;  2M6M A;  2VP7 A;  2K16 A;  2FSA A;  4AUQ B;  1JOC A;  3M99 A;  2EA6 A;  3ZPV 1;  5LKZ A;  2ECT A;  2MD7 B;  2VPB A;  5TBN A;  2YQM A;  4I7D A;  3EB5 A;  2RSD A;  2CSY A;  4L7X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...