3FANA

Crystal structure of chymotrypsin-like protease/proteinase (3clsp/nsp4) of porcine reproductive and respiratory syndrome virus (prrsv)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
197
structure length
192
Chain Sequence
FRTQKPSLNTVNVVGSSMGSGGVFTIDGKIKCVTAAHVLTGNSARVSGVGFNQMLDFDVKGDFAIADCPNWQGVAPKAQFCEDGWTGRAYWLTSSGVEPGVIGNGFAFCFTACGDSGSPVITEAGELVGVHTGGGIVTRPSGQFCNVKPIKLSELSEFFAGPKVPLGDVKIGSHIIKDTCEVPSDLCALLAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-structural protein
publication title Structure and cleavage specificity of the chymotrypsin-like serine protease (3CLSP/nsp4) of Porcine Reproductive and Respiratory Syndrome Virus (PRRSV).
pubmed doi rcsb
source organism Porcine respiratory and reproductive syndrome virus
molecule tags Hydrolase
total genus 45
structure length 192
sequence length 197
ec nomenclature ec 3.4.21.114: Equine arterivirus serine peptidase.
pdb deposition date 2008-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3fanA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3fanA02
3.30.40.20 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Chymotrypsin-like serine protease; domain 3 3fanA03
3ZV8A 1O2MA 1WQVH 1C5VA 2BLOA 2QIQA 1LHCH 1Q2WA 2VWOA 2XCNA 5JBCS 2OBOA 3UIRA 1NS3A 2BDBA 2RDLA 1IQGA 3VXFH 2V35A 1JMOH 5T6FA 2C90B 3GY5A 3T2NA 4H42U 1GI2A 3ZVDA 3SGQE 2P8OC 4NGAH 3LJOA 5A8ZA 1BTXA 1D9IA 3GDUA 5FCRA 2PWXA 1MTNB 3CP7A 2JH5D 4ZUHA 1F5LA 1CSOE 2OCVB 1E36B 1BRAA 3B9FH 2VIVA 1GHAF 4IW4E 2OUAA 3TK5A 5EXMA 1MZDA 1F0UA 2ILNA 1EATA 2Z9LA 2VVUA 3QX5H 4IC6A 1BHXB 1ZSKA 4KTCA 2P3FH 2NU2E 1HLTH 1C2GA 4YZUA 3QGNB 1T32A 4O97A 4UFGH 1F5RA 3F9FA 1O38A 1H9IE 2PGQB 4TYDA 2CHAC 1F2SE 4AX9H 4X6NA 1C5SA 2FYQA 1HXFH 1VGCC 2C93B 2FWWA 1AHTH 1ABIH 1G9IE 2ZHDA 2FOCA 1SGPE 1UVOA 1XUJA 1BTYA 4GPGA 1RJXB 3MOCA 2A4GA 1QY6A 3PTNA 2UUFB 1EPTB 1QRWA 1BTZA 1L1JA 2SGQE 3P92A 1TABE 1P9UA 2V6NA 3MO9A 1P06A 3CENA 1UTMA 2NWNA 1O3CA 1EKBB 3MHWU 1MUEB 2D26C 4ESTE 4MLFB 1XVOA 3RLWH 2J4IA 4O9VA 1C4Y2 3BTEE 2WPHS 1FJSA 4JCNA 2QAAA 1NFYA 3TGIE 2THFB 5T6GA 1L4DA 3D62A 4I8GA 1CHGA 1OP0A 1WAYB 1EJMA 1HGTH 1FDPA 2CXVA 3GDSA 3QLPH 2VWLA 4DW2U 1W10U 4TWWA 1Q31A 5F8TA 2FTMA 5GJ4B 2Z3DA 1ZMLA 1CGJE 3A7TA 4X0WU 1MZAA 3QUMP 2TBSA 1TPPA 1V2UT 1GL0E 1SGCA 1Z6EA 1SGQE 7GCHG 3U1JB 5C1UA 2AFQB 3P8GA 5TCAA 2WPLS 4Q7ZA 3O8BA 1O2XA 2A31A 2P3TB 3A8CA 1CO7E 1G3CA 4NFFA 3GCTG 2GKVE 2Z9GA 4Y6DA 1KTTB 1KXCA 4I32A 4NWKA 4BOHA 1NN6A 1CT4E 1O34A 1S0RA 1H9LB 3BV9B 3FZZA 3RM2H 4WY3A 3ZZDA 4MNYA 1QJ6B 1GJ7B 1GDUA 1TGBA 2P8OB 1FY8E 3DFJA 3RXFA 1BA8B 2WYGA 3C27B 1LHGH 2GD4B 1LCYA 1AE8H 1ZGIA 1A0LA 3M3VA 4JYUH 2SGEE 1THPB 1T8MA 3PM3A 1P2QA 3M7UA 4AFQA 2PR3A 2Y7XA 1RD3B 1BTPA 5A09A 1T31A 4K5ZA 5BPEA 3AASA 5DK1A 1UTNA 2BLVA 4JYTA 4SGAE 1OKXA 3GYLB 1IHSH 6LPRA 2XW9A 3M3TA 4MNWA 4XFQA 4ABIA 1LPGB 3LGIA 3RXOA 2B7DH 3RXUA 2ZECA 5EGMA 1TA2A 1O2IA 3L3TA 3BTKE 2FOBA 3RC4A 2CHAB 3LGTA 2G4TA 1VGCB 2H6MA 1SI5H 3MNSA 2WUCA 1TPOA 3UREA 3M5OA 4CR5A 2BOKA 1QB9A 2XBVA 3ZZBA 1UJ1A 1SGYE 5DP5A 1TNJA 3SU6A 1TNIA 3A81A 2ZQ1A 4JZ1A 2O8UA 1GVLA 1DXPA 2QN5T 2G81E 1ZSLA 2UWLA 4CRCA 4ISHH 3AW1A 4YESB 1SOTA 4ABFA 3IITA 1K9OE 1P3CA 3WY8A 4BAHB 4MPUA 3RP2A 1P3EA 4AORA 1TB6H 1V2JT 4B2AA 4OS4A 2J38A 4IS5A 2PW8H 2ZGJA 2PV9B 4OS6A 1P2NA 5EG4A 1BZXE 1VITG 1GVKB 1WBGB 1Z8JB 4JZDH 3OY5U 5E2PA 2XTTB 3F9HA 3F6UH 3A8AA 1GBHA 1B0FA 1YPJH 3ZZ3A 2AGEX 2EI6A 4UEHH 3FP6E 2GCTC 5TJXA 1ZHRA 1OXGA 2QF3A 1LQEA 4OS5A 1Z8GA 4DG4A 4H4FA 1Y3VA 1O2OA 4TWYA 1TRNA 1AFQC 2G51A 2WINI 3QO6A 1JRSA 1N6YA 4ZKNU 3RXKA 1EB1H 1TGTA 3KQEA 2QCYA 2C8XB 4A1XA 1ESBA 2WYJA 2OINA 5DP4A 3U8RH 8GCHF 3VXEH 1GBFA 3N7OA 4YOIA 3BEUA 1P03A 1DANH 4X8TH 1ORFA 1V2WT 2ULLA 5C2ZA 4CREA 2A5IA 3ATIA 3SI4H 5LPRA 1HAZB 1BMMH 2XWAA 3MH5A 1QTFA 1PQ7A 3O8RA 3UNSA 3TPIZ 5A0BA 5L6NH 2A0QB 1C5MD 1QRZA 4DURA 5HXFA 3PO1C 1AFEH 2BB4A 1UCYH 3GY4A 1D6RA 5DP6A 2A32A 1GBCA 1DY8A 2DE8A 4K60A 1P2KA 3HKJB 1XMNB 3QWCH 1ELEE 3SU3A 3ZZ5A 4ZHAA 4O3TA 3SUFA 4WMFA 2FOAA 1IQKA 1PPBH 1C2JA 1MD8A 3KQBA 1B0EA 1ID5H 4K8BA 4X1QU 1W14U 4X1NU 2Z7FE 4MDSA 2A2XH 3TGJE 2O8WA 4MPVA 1FONA 2HGTH 3RXTA 3BG8A 1G2MA 1SFIA 2NU1E 2J2UA 1HIAB 1G3BA 1K21H 1LVMA 5A0CA 4KGAA 3ZZAA 4ZAEA 3L6PA 4NG9H 2QXGA 1NY22 4HFPB 2GP9B 4JK6A 3FZDA 7LPRA 1HJ8A 3S9CA 1C5QA 3MWIU 2C4FH 1VITH 1J17T 2ZU4A 3M37A 1G3EA 5DP7A 2TRMA 5ETXA 1SGTA 5FHTA 2ZO3H 3E90B 3RXBA 3TK9A 1ELBA 2H9HA 1Z1IA 1ANBA 1CVWH 1FMGA 3ZZCA 1EJNA 2F9PA 3ZYEA 2FOGA 1GHVH 1PPCE 3SQHE 3R0FA 4Y71A 3UR9A 4X8SH 1KXEA 3RXPA 4Q80A 1YPEH 1K1OA 1V6DA 2GCTB 1DSTA 4DIIH 1P12E 1V2PT 3A89A 4AFZA 5LH8A 2ANMH 3VGCC 2GTBA 1F0TA 3MH7A 4MPWA 4INKA 3UTUH 1AFQB 1QL7A 1S5SA 1DM4B 4NZLA 1O5CB 1NM6A 3RXDA 2ODPA 1UK4A 1C2KA 2FEQH 5DKMA 2ZP0H 3KQCA 3RC5A 3LONA 1SQTA 2WPJS 1XUHA 2BDCA 2BXTH 2PFEA 1GG6C 9LPRA 1EXFA 2FI3E 5DO4H 3QTOH 1SGFA 4AYYB 1ZJDA 1WCZA 3LH3A 1AN1E 3BEFB 2J92A 4Y0ZE 4JZEH 4U30A 3SV8A 3O8CA 2BHGA 1SOZA 2STAE 1SQOA 2ANYA 4Y7AA 1EZQA 1AUJA 3MMGA 1KXFA 1MCTA 4RN6A 1LDTT 1C5WB 1C9TA 3VB7A 1LHFH 1O3EA 2HWLB 4ISLA 2AMPA 2HOBA 1WV7H 1YLCA 1O3JA 3PO1B 1TGCA 1KDQA 2OXSA 1OOKB 1OPHB 4ABGA 2H2ZA 5FPSA 2ZGBH 1F92A 1MTNC 3M7TA 1LQDB 2FM2A 1GI1A 3L33A 1O2VA 1YCPH 1HAOH 1SSXA 1EPTA 1QB6A 3RC6A 2BY8X 4WF8A 4OS2A 2FXRA 2ANWA 1YPHC 4H6SB 4CH8B 1W2KH 4DCDA 3U98H 5AHGH 1YP9A 1MD7A 2ZNKH 4DIHH 4XBBA 3SNDA 2B5TB 3SV6A 1BBRE 1PPGE 1Y3YA 1HB0B 4I8KA 4NIWA 1GMDF 2AMQA 1ELDE 4NSYA 2Z6BD 1TOCB 2OC7A 3ITIA 3TGKE 1DLEA 1JBUH 1O5DH 4HGCA 3TJUA 3RUOA 1FN6A 1GMHG 1ZPZA 2AIQA 3MI4A 1TE0A 1O3PB 2ZTZA 1TX8A 1UHBB 2ZDLA 1KY9A 2OLGA 4F4OC 2BD2A 4KTUA 1AUTC 4DJZB 2BY5X 1AMHA 3M5MA 2FOEA 3VPKA 1GBTA 1S85A 1YPKH 5DJ7A 1YLDA 2HNTE 1GBAA 3A83A 1V3XA 2PKAB 5E2OA 3GDVA 3LC3A 1SLWB 4FVBA 1VJ9U 5F8XA 3RMNH 1LPZB 2ZQ2A 2FPZA 4CHAC 4Q7XA 2F9BH 3GICB 1CA0B 4IBLH 1GWAA 2QXJA 3VGCB 1CT0E 5ABWA 3TLOA 2W26A 4WJG2 3RU4T 4FUCA 5C3NA 2QXHA 5EXNA 1BQYA 1EAXA 4J2YB 2Z9JA 4FUDA 2VIDA 3CS7A 4RKJB 4Y11E 1A0HB 4M7GA 1PPHE 1GJ6A 1QRXA 1ZHPA 4J1YA 1GG6B 1O2KA 2VNTA 2BDAA 3RXAA 1FAKH 4AYVB 1HCGA 2BDHA 3T5FH 4Z6AH 2BD7A 2J94A 3F68H 1SR5C 2IN2A 5DP8A 1SHHB 1YCPK 2Z94A 3MU8A 2FESH 2Q6DA 1BHXF 2BX4A 3DT0H 1FPHH 1O3IA 3RXEA 2KAIA 2BQWB 1TWXB 3AW0A 1EB2A 3A7VA 1NU7B 1SLUB 1NZQH 5FX5A 5T6DA 5I25A 3STJA 1TBQH 4NZQA 4WVPE 1LPKB 2CV3A 1YCPM 1O2JA 1PQAA 1YBWA 2O8TA 2FTLE 4QT8C 3F1SB 2BD5A 2QY0B 4MG3A 1ANEA 4H6TA 3U9AH 4FXGH 1KLJH 1AD8H 1ELAA 2H5CA 1H4WA 3B8JA 4TY7A 1TIOA 2QXIA 1WU1A 1GBMA 4FUJA 1RXPA 3TK6A 4VGCC 5BRRE 2SNVA 5F8ZA 1VR1H 5J4QA 1OYTH 3UOUA 3O8DA 3V13A 2FYRA 3OU0A 1F0RA 2A7CA 3PWBA 3GY8A 3MH4A 1MKWH 2PHBA 2TGDA 1SL3A 3LGWA 1SGIB 1GCTC 3LT3A 1UTQA 2BZAA 4OS1A 2GT7A 3KNXA 1NRPH 3OTJE 3KN2A 1HXEH 2BMGB 4GLYA 3U8OH 1ZSJA 3ZVGA 1EZXC 5DG6A 1SG8B 3OY6U 1GBKA 5I46H 1GJ5H 1DVAH 1HAXB 1J9CH 1MQ5A 3T27A 2Q6GA 4BTIB 1C1PA 1QJ1B 3E6PH 2I6SA 3A8BA 1TGSZ 2GMTC 1ETSH 1PPZA 1O3MA 2YNBA 3HKIB 3RXJA 1ACBE 2ZHQH 3NWUA 2Y82A 2ZTYA 1OYQA 1TBRH 2FDAA 1TQ7B 1E37B 1PQ8A 1HJ9A 1RFNA 2IOTA 1AQ7A 2GDEH 1RTLA 1MU8B 3I29A 4CHAB 1A7SA 3ATWA 4R0IA 2QYIA 3MNBA 3SUEA 1W7XH 3SJ9A 3BIUH 1XUIA 2BVXH 4MPXA 2ZU2A 1FY3A 1NRRH 4BANB 5IYTA 1TMUH 1D3DB 2EEKA 4CRAA 1GHWH 4K1TA 2BOHB 1WYKA 1DY9A 3SU5A 4GUXA 4ZHMU 4I31A 1GI9B 1CA8B 3RMLH 3ATKA 1H8IH 3LH1A 2PSYA 1ANDA 3C1KA 4IN2A 1Y8TA 1BITA 2QGRA 1Y5AT 2XC0A 3DA9B 4ZXXH 3E91A 3NXPA 1TMTH 3SZNA 3A80A 1ELCA 3RXQA 1GBEA 3STIA 3RXMA 5LPEA 3H7TA 1C9PA 1ELFA 1J16A 3JZ2B 4F49A 1V2VT 1LHEH 1DX5M 1TX6A 1FPCH 2HALA 5AFZH 1UMAH 4B71A 1O2WA 1J8AA 1HFDA 3ZYDA 1BCUH 3PMAB 2EA3A 3U1IB 1DLKB 2VB0A 1EJAA 5C5OA 1S83A 3P8OA 1SGNE 2FS9A 1LVOA 1ELVA 3W94A 2F9NA 3GY3A 1GVZA 1MKWK 3BTWE 1Y3UA 3P6ZB 5L2ZH 5JBBS 4X2VA 3MNCA 1B5GH 1S82A 1C2MA 1O5BB 1HAHH 1SB1H 2PUQH 1T8OA 1RTKA 3PB1E 2ZG0H 4INHA 5DPAA 3I77A 7KMEH 1FY5A 2A4OA 1N8OC 2C8ZB 2BX3A 2JH0D 3HGNA 1G37A 1SBWA 2TIOA 4NA9H 4XBDA 1Z7KA 1W8BH 5HGGA 1S81A 1ELGA 4VGCB 2FIRH 1FZZA 4XSKU 1QGFA 4ZH8A 5EQQA 5A0AE 3SU1A 2ZHWH 2SGPE 3E0PB 4ABDA 1CGHA 1GCTB 1TALA 1T8LA 1W3CA 4LOYH 5E0JA 4GVUA 1TA6A 2ZHFH 2JH6D 4UE7H 2UUYA 1YM0A 3OYPA 1MTUA 1LTOA 2ZTXA 5GCHG 5HM9A 1BJUA 1BUIA 1LKAA 1AKSB 3RM0H 1CQQA 1HRTH 4DY7B 2C3SA 3HGPA 1GBLA 1DWEH 2OQUA 3PYHA 3A7ZA 4E06H 3RMOH 1PFXC 1ZOMA 2GZ8A 2R9PA 2FS8A 1YPLH 1O2TA 2GMTB 4MVNA 1LMWB 2JETC 2PTNA 1TONA 1C1RA 1QB1A 1UTOA 1ZGVA 4K1EA 2BLWA 4AG2A 5K0HA 1MQ6A 1NFXA 1UK2A 4K1SA 1GHBG 4CBOA 1KIGH 4GCHF 2OD3B 1KYNA 1QJ7B 1Z8IB 3SI3H 2G8TA 1V2QT 2GDDA 4AN7A 2W3KA 2FO9A 1GJCB 1E0FD 1S84A 2ZDKA 2GCHG 3GCHC 2F9VA 4XE4A 2A1DB 2G5NA 2H1UA 5C67A 3VB3A 4AFSA 3KF2A 1LVBA 4NA8A 3A84A 4WH6A 1EAWA 1XXDA 1AVGH 1BDAA 3ZVFA 1XUKA 2OC1A 1KTSB 3UNQA 3PMHB 3MFJA 1BB0B 2BM2A 1LHDH 1GHAG 1VCPA 5HMAA 2XNIA 2OQ5A 5AVDA 1Z71A 2B9LA 5JYIA 2AIPA 2Z9IA 3LGYA 3MU0A 3S7KB 1F0SA 1H8DH 2VINA 3ZVEA 2VGCC 1NT1A 5DP9A 3UWJH 2CGAA 4X6MA 1L1GA 4YTAA 4D7GA 1FN8A 1GPZA 2G52A 5AFYH 3Q76A 3M3SA 1XKBC 4GHQA 3SU4A 3E16B 3PV4A 3LC5A 4CRGA 1UTJA 4PROA 1S0QA 1GMHF 1HUTH 4Z0KA 1CBWC 5GPIB 1AIXH 1OWEA 3SJIA 2Y7ZA 1MAYA 2A2QH 1XUGA 2ODYB 1PYTC 5EODA 5DP3A 4Y8ZA 4X6OA 3GYMA 1O3NA 1TNLA 1TYNA 3MO3A 2CF9H 4Y79A 1A2CH 1N8OB 4UFEH 2ZFPH 4THNH 3MU5A 4Y76A 1K1PA 1BRBE 1FLEE 1C1UH 1UHBA 1JOUB 4CRBA 5G4BA 1QQ4A 1VZQH 1Y3WA 2ZDNA 3RXHA 5JB9S 3SGBE 4RKOB 3UQVA 2PKAA 2O8MA 3QDZB 3ZZ4A 3E0NB 2CF8H 1TPSA 2ZFTA 1FIWA 5JBAS 2AYWA 4AB8A 2YOLA 4TY6A 4I8JA 1P02A 1F7ZA 2XXLA 2W7UA 2FP7B 4X1PU 2JETB 2BDGA 1IQMA 1QCPA 2PSXA 4JYVH 1CGIE 4HI3A 1IQLA 1Z8RA 1HNEE 2ZFQH 4X1SU 1AO5A 4ABBA 2QA9E 8LPRA 6ESTA 1O2GH 3ZZ8A 3VFEA 3ATLA 2EI8A 1NESE 2FLRH 1WOFA 3ELAH 1L2EA 3A87A 5E0GA 1SGRE 4ISNA 3A82A 2UUKB 3URCA 2PKSC 3EAJA 1O2ZA 1C1NA 2HPQH 3Q3KA 1MKXH 2AEIH 3HK6B 1C2HA 3GCHB 1A3EH 3QK1A 1EUFA 1YC0A 1P10A 3PMBB 4KTSA 1BIOA 1O5AB 1GL1A 1HAVA 2TGAA 1C1OA 1BTUA 2VVCA 1CA0C 2ESTE 1BTWA 3NUMA 5PTPA 1NRSH 1O3LA 3JZ1B 5EOKA 4FUIA 1IQHA 1E35B 6CHAC 1DWDH 1B7XB 1WQSA 4WH8A 1ZYOA 5EW2H 4ZXYH 3SV2H 2PTCE 1HAYB 2AH4X 1W7GH 3G01A 2DE9A 1T4VH 2F9OA 5ESBA 4UD9H 1UCYK 2VGCB 4DT7B 3LDXH 1A5HA 5DGJA 2GX4A 5FPYA 1V2RT 4NSVA 1BJVA 3KCGH 1YPMH 2FMJA 4BAKB 2STBE 2FI5E 4X2WA 1CBWB 5GXPA 3RMMH 5FCKA 1C2DA 1GHZA 1W11U 2TGPZ 1FXYA 1K1MA 4WWYA 1HV7A 1OWHA 1C5YB 4NWLA 1NROH 3F9EA 1K28D 4IMZA 1NRQH 3SQEE 1OWKA 3MH6A 4BAOB 2ZHEH 2P3UB 1KLTA 4X1RU 3A7WA 2A4RA 1NRNH 5CMXH 5F6MA 4Q7YA 5B6OA 1PPEE 3KGPA 3PTBA 2LPRA 4E7NA 2CN0H 1GI3A 1L1NA 4IMQA 1SQAA 3GOVB 2GZ7A 2VIOA 1DOJA 3ZZ6A 1O35A 1VCWA 3SV7A 1P57B 4WMDA 1TBZH 1K1NA 3EA9A 1O2SA 2H9EH 2VU8E 3A8DA 2Y80A 3TVJB 4BTTB 3IWMA 4Q2KA 5LPFA 3H7OA 1C5XB 4JMYA 4IGDA 4AG1A 3DFLA 7GCHF 1G3DA 3TIUA 1C1MA 2F3CE 1HJAC 7ESTE 2VJ1A 1UO6A 3FAOA 4KP0A 3SHAH 1O0DH 1AY6H 1AVXA 3SOSA 3F9GA 3SNCA 1SMFE 2SGFE 1N6XA 8GCHG 3GCTF 5SGAE 1VCQA 1INCA 2PKSB 1O37A 2VH6A 5A8YA 1CT2E 2WPMS 1SPJA 1O2QA 3S69A 1NTPA 4NIVA 1ZTJA 4IC5A 1JIRA 1EOJA 3BSQA 3TNTA 1X7AC 2Y5HA 2C8WB 1DPOA 2F91A 4CRFA 2HPPH 2V3HH 3B23B 4X2XA 3NCLA 4HTCH 4Y10E 2XRCA 1K2I1 4YM9A 3BG4C 5HM2A 1C5UA 1BMLA 4MQAA 4OS7A 1ABJH 6CHAB 4B2CA 1GJAB 1RTFB 2Q6FA 3LKWA 1P09A 2BD8A 3M36A 2R0KA 1C4U2 1D4PB 5GIBA 3M7QA 1GGDC 3A85A 2VIPA 5FPTA 4BNRA 4ABHA 4XOJA 1V2ST 1O3AA 4GAWA 3T26A 1D3PB 4FU9A 2BYAX 3EE0B 1QL8A 1OWJA 4YO9A 2Y6TA 4K3JA 2D8WA 1FI8A 2BDYA 1ETTH 1Z1JA 1UTPA 3AAVA 5GCHF 1MMJN 1KXDA 2Z3EA 4KELA 3V7TA 2BY9X 1GCDA 1DSUA 1SGEE 3QGJA 4B1TA 1ZRBA 1PPFE 1JWTA 1ZRKA 5IDKA 1Y59T 3SUGA 1GI6A 3ODFA 2W3IA 3RXSA 4CR9A 1FAXA 1GHBF 3GCOA 3TJNA 1AKSA 1SFQB 1W0ZU 1ZPCA 2JKHA 1HPGA 1RS0A 1EP6A 2BY7X 4DVAU 4FU8A 1TGNA 1JXPA 1NO9H 3MO6A 4LZ1H 1DS2E 1GJBB 4D9RA 3NK8A 3GY2A 5CHAB 3DHKH 1JRTA 1FY4A 1O3DA 1VITF 2GCHF 2VWMA 1DXWA 2QV1A 1XKAC 1O33A 1EZUC 1MH0A 2GV6A 1C5NH 1ESTA 2B8OH 1C1TA 1ARCA 4ZKSU 1U6QA 1G2LA 3D23A 3RXGA 3VEQB 2ALVA 3BTDE 1P11E 5EQRA 5GWZA 3MU4A 3UFAA 3ZVAA 3T29A 1FNIA 1O30A 1TNKA 2W5EA 1VJAU 1HJAB 4NA7A 1YYY1 3RXRA 1O2LA 4U32A 5A8XA 1V2KT 2AERH 2XBWA 1E38B 1EX3A 4Y0YE 1CE5A 3P95A 4AGJA 2EC9H 2O8LA 1G32B 2V0BA 4NIYA 4E05H 1P2OA 1PQ5A 2CMYA 1DITH 2F9UA 4A1VA 1KDQB 1OP2A 3NPSA 1TQ0B 5C1XA 1HYLA 3QN7A 1MTWA 2P94A 4AZ2B 1N1LA 2ZF0H 2ZFFH 1DUEA 5F03A 1CHOG 5EW1H 3BG4B 3NKKA 3LGVA 3KHVA 1HAPH 3PLPA 1BRCE 1HAIH 1XXFA 4ZKOU 2VIWA 2P95A 3TH2H 2Q1JA 2FODA 3DD2H 2WV5A 2HNTC 1C2IA 5CE1A 1THSH 3RXIA 2Z3CA 3K6YA 4O3UA 2FOFA 2XC5A 1G36A 1P0SH 1GGDB 1A5IA 3UQOA 3ATMA 4XDEA 3V12A 1C5ZB 2Y5FA 1ESAA 3Q3XA 1MU6B 3URDA 4MNVA 2HLCA 1Y5BT 1QNJA 1O36A 1A1RA 1OX1A 2XBXA 3OSYA 2J9NA 2B0FA 3SNAA 1V2TT 5TCCA 1ETRH 2H9TH 2O9QA 1YPGH 3AAUA 4UDWH 1C5TA 1IOEA 1TPAE 1UK3A 4YLUA 1G30B 3Q3YA 4GSOA 1LKBA 1GMDG 1S6HA 1C1SA 3SJKA 5A2MH 8ESTE 1O3OA 4YT7H 4X6PA 4UFDH 4ZROA 3LOXA 2ZCKP 1QA7A 2OTVA 1GBBA 3EA7A 3AVZA 4UFFH 3RXCA 3SU2A 3LPRA 1D3TB 8KME2 4D76A 1M9UA 2ZC9H 3P17H 3UY9A 1Y3XA 6GCHG 3SV9A 1DDJA 2GVFA 3KQDA 1HIAA 4WXIA 1IQJA 4B76A 1UVSH 2GT8A 1KXAA 4WXVA 1WTGH 2GV7A 3V0XA 1XM1A 2PGBB 3RU4E 1O3FA 5L2YH 2ZPRA 2ODQA 1GBJA 1TAWA 5E0HA 3RDZA 2A4QA 4O03A 1ANCA 1EASA 1O31A 1O5EH 1QFKH 2F83A 1TOMH 3HK3B 3ODDA 5L30H 1RIWC 4OGYA 2SNWA 4GHTA 4DGJA 1AB9C 2VVVA 3LIWA 2WUBA 1AGJA 1O5FH 1GJ4H 1ZHMA 3PLBA 4NIXA 4ABEA 4D9QA 1O39A 1K1LA 1P01A 2HNTF 4YOJA 1EP5A 3ZZ7A 1K1JA 4FUGA 2UWOA 2FX6A 2ALPA 2ZA5A 1AWHB 1MBMA 1NPMA 3SNEA 4ISOA 3SU0A 1DICA 2KAIB 1AZ8A 4FVDA 4BAMB 4I8HA 3BTQE 4FUHA 1SGFG 5JBTA 1GMCG 1V2NT 4K69A 3LGUA 1RRKA 1GI7B 3BF6H 2ZCLP 2ZDMA 5LGOA 1GHYH 1IHTH 1C2FA 1OWIA 1O3HA 2EI7A 2QF0A 4ZMAH 1O3GA 3IG6B 2IPHA 4LZ4B 4B2BA 1C5PA 2K1QA 2IJOB 3E1XB 1GBDA 2ZKSA 3EQ0H 1C2LA 1OP8A 2AGGX 2ZFSA 4K2YA 2A7HA 1WUNH 3ZZ9A 1UVPA 3HPTB 1L0ZA 3Q77A 1FV9A 3M35A 2ZGCA 4E7RG 3SNBA 5H4IB 1PJPA 2NU4E 4A92A 3TH3H 4YT6H 2PLXA 4YLQH 2A5KA 3KEEA 2H5DA 5HYOA 1P2JA 4YOGA 2TGTA 2SGDE 2AS9A 3RXLA 1SVPA 3VB5A 3A86A 1FIZA 2R3YA 1NFUA 3UNRA 3MYWA 1O2HA 1TRMA 3QZRA 4AFUA 4A1TA 4Y7BA 3SN8A 3SJOA 1XVMA 3VB6A 1AE5A 3K2UA 3V3MA 1GDQA 1QBOA 4Y8YA 1C5RA 2UUJB 2V3OH 5EXLA 1GI5A 3T28A 1WTHD 1LO6A 1Z6JH 3K9XB 3MTYA 1KXBA 3FP8E 3VB4A 4FU7A 1QR3E 1QL9A 2J34A 1O2PA 3SHCH 1O2YA 1J15A 4A6LA 4B73A 5ESTE 1ARBA 3UWIA 1L4ZA 4BXSA 3QZQA 1C1VH 2ZWLH 4BXWA 2WPKS 1P9SA 1YF4A 4LXBH 1KSNA 3K65B 2A5AA 4NCYA 5T3HA 1OSSA 4U01A 4RSPA 2ZPQA 4MTBA 5C5NA 3SUDA 4BTUB 2BQ7B 1UTLM 4Y8XA 3TITA 2CJIA 1P04A 3U8TH 3T62A 1EZSC 1IAUA 2VWNA 1QIXB 1LVYA 3E8LA 2HVXA 3CS0A 1W13U 2XBYA 1RIWB 3M5NA 3S0NA 4XBCA 1AB9B 2A7JA 2BQ6B 3DUXH 5C20A 2OC0A 1NU9A 2WV4A 1OWDA 2QC2A 1UCYE 1YPHE 3TNSA 4ASHA 4DOQA 5GDSH 1FUJA 3HATH 1ZTKA 1O2NA 2VH0A 5C1YA 1EQ9A 2BLQA 4CH2B 4X2YA 1GI0A 3PLKA 2UWPA 4ZHLU 1IQFA 1KLIH 2BTCE 1BT7A 3A7YA 3W95A 1DFPA 2FZZA 5JPMH 4A5TS 2D1JA 1V2LT 1O32A 2OBQA 5K7RA 1NFWA 2A45B 3ESTA 1DWCH 3ZVBA 3S7HB 4I33A 1GJ8B 2BY6X 3BTHE 2BVSH 1T7CA 9ESTA 1PYTD 1AI8H 1TMBH 3M5LA 5JDUB 2AMDA 1F5KU 2OC8A 5FBEA 2PUXB 1XX9A 1C1QA 3A88A 1IQEA 2FLBH 2RA0A 1P8VC 2FOHA 1ZJKA 1EAIA 1W0YH 2Y81A 3ZVCA 1TLDA 1ELTA 1K1IA 3Q00A 1P05A 3S9AA 1D6WA 2WPIS 3RU4D 3R3GB 2ZPSA 2LNCA 1ZMJA 1GI8B 4AOQA 1BTHH 3D65E 2P59A 1MCVA 3KIDU 3FP7E 1YKTA 1UVUH 3FANA 2G00A 2XC4A 2XCFA 1O3BA 2ZGXH 2BD4A 1MTVA 5FXLA 2Z9KA 3TJVA 1HAGE 3BIVH 4U2WA 1O2UA 4TPYA 3SW2B 3BTFE 1A0JA 1RGQA 1HBTH 3P8FA 4SGBE 1XUFA 3PMJA 1A61H 4X8VH 2P16A 3A7XA 1H1BA 2ASUB 3P8NA 1C2EA 1BOQA 3K6ZA 4X8UH 2AGIX 4CRDA 1SLXB 4I7YH 4B75A 2SGAA 3EDXB 4ABAA 1E34B 4ISIH 1EAUA 1BMNH 4MNXA 1NC6A 1THRH 2DUCA 3MNXA 4OGXA 3E3TA 1T8NA 1TRYA 1V2MT 3GY7A 4K8YA 4INLA 1FQ3A 2FI4E 1ZLRA 2ZFRH 1SC8U 1P2IA 3EGKH 2GGVB 1QQUA 1T4UH 3NZIA 5EU8A 1K22H 3RLYH 2TPIZ 1CHOF 3SJ8A 4GCHG 1ZPBA 1TFXA 2VIQA 2Y5GA 3SORA 4KKDA 3BTME 2C8YB 1DWBH 5AF9H 3BEIB 5EPYA 1SHYA 1QBVH 1YGCH 5CHAC 1QBNA 2RCEA 2RA3A 2BVRH 1CU1A 4D8NA 2W7SA 4FUFA 1C1WH 1MKXK 3PROA 2ZU1A 4NFEA 2ZCHP 5EQSA 2BZ6H 2XWBI 2ZZUH 3GISB 4JZFH 3T25A 2D2DA 1MAXA 1BRUP 5FBIA 4AB9A 1BBRH 1TNHA 4ZKRU 3M61U 3TU7H 1SLVB 3GY6A 2R2MB 4ABJA 1A46H 1A5GH 4LK4A 2HRVA 3H5CB 2OP9A 1GBIA 1AWFH 2BD3A 1C5OH 2NU0E 2NU3E 1A3BH 1S6FA 3UOPA 1QHRB 3UPEA 3UUZA 1Q3XA 4IN1A 1P2MA 1ZZZA 2RG3A 2SFAA 1TX7A 3SO3A 3EA8A 1C5LH 2BD9A 1GDNA 1JIMA 1O2RA 3KL6A 2GZ9A 4R8TB 1Y5UT 3TJOA 1DT2A 1MBQA 4JZIA 1O5GH 1AVWA 2ANKH 2FX4A 1ZMNA 3U69H 4UONA 2ZDVH 4FUBA 2R0LA 3ENSB 3BTTE 4B74A 2G5VA 1UTKA 3MU1A 4TPIZ 3SGAE 2R2WU 6GCHF 3ZV9A 3I78A 1AU8A 2I6QA 3RXVA 4D7FA 3LU9B 1EPTC 2G4UA 1GHXH 2XYAA 3QTVH 2ZU3A 5E8EH 1MTSA 1C4V2 1QA0A 1ZTLA 4HZHA 1V2OT 2G55A 3P70B 4AGKA 5FAHA 1DE7H 2P93A 2R3UA 1DUAA 2J95A 3S9BA 3FVFB 1SGDE 2ZDAH 1GJ9B 1ZR0A 1D3QB 1GJDB 3GCNA 1A4WH 4WMEA 1GI4A 1EOLA 2ZI2H 1WSSH 5JB8S 3BN9A 3D49H 2BXUH 2FOMB 4CBNA 3PWCA 3SBKA 2ZGHA 3OX7U 4BAQB 5J4SA 1AZZA 4FUEA 1HDTH 1IQIA 3LJJA 1H9HE 3EYDA 1IQNA 4A7IB 1GMCF 5EPNA 2ZEBA 3TH4H 3FFGA 1J14A 2ZU5A 3BTGE 4JK5A 3UR6A 5FX6A 4I8LA 1BBRK 1BMAA 1UVTH 1W12U 2ZIQH 1TNGA 2YNAA 1HAVB 2M5TA 1O3KA 1OS8A 1FY1A 2BDIA 1QURH
chains in the Genus database with same CATH superfamily
3ZV8A 1O2MA 1WQVH 2CKLA 1C5VA 2BLOA 1V87A 2QIQA 1LHCH 1Q2WA 2VWOA 5FL7D 2XCNA 5JBCS 2OBOA 4O64A 3UIRA 1NS3A 2BDBA 2RDLA 1IQGA 3VXFH 2V35A 1JMOH 3OEED 5T6FA 2C90B 3GY5A 3WWFA 3T2NA 4H42U 1GI2A 3ZVDA 3SGQE 2P8OC 4NGAH 2EXUA 3LJOA 5A8ZA 1BTXA 1D9IA 3GDUA 5FCRA 2PWXA 1MTNB 3CP7A 2JH5D 4ZUHA 1F5LA 1CSOE 2OCVB 1E36B 1BRAA 3B9FH 1WEPA 2VIVA 1GHAF 4IW4E 2OUAA 3TK5A 5EXMA 1MZDA 1F0UA 3FOAA 2ILNA 1EATA 2Z9LA 2VVUA 3QX5H 4OGCA 4IC6A 1BHXB 1ZSKA 4KTCA 2P3FH 2NU2E 1HLTH 1C2GA 4YZUA 3QGNB 1T32A 4O97A 3GV4A 4UFGH 1F5RA 3F9FA 1O38A 1H9IE 4ASUD 2PGQB 4TYDA 2CHAC 1F2SE 4AX9H 4X6NA 2HVYB 1C5SA 2FYQA 1HXFH 1VGCC 2C93B 2FWWA 2RSDA 1AHTH 1KMHB 3OEHD 1ABIH 1G9IE 2ZHDA 2FOCA 1SGPE 1UVOA 1XUJA 1BTYA 4RI0A 4GPGA 1RJXB 3MOCA 2A4GA 1QY6A 3PTNA 2UUFB 1EPTB 1QRWA 1BTZA 1L1JA 2SGQE 3P92A 2XOYA 4L58A 1TABE 5B8DA 1P9UA 2W6JD 2H0DA 2P57A 2V6NA 3MO9A 1P06A 3CENA 1UTMA 2NWNA 1O3CA 1EKBB 3MHWU 1E4UA 1MUEB 2D26C 4ESTE 4MLFB 4LK9A 2JDID 1XVOA 3RLWH 2J4IA 4O9VA 1C4Y2 4R7EA 3BTEE 2WPHS 1FJSA 5TDRA 4JCNA 2QAAA 1NFYA 3TGIE 2THFB 5T6GA 4UP5A 1L4DA 3D62A 4I8GA 1CHGA 1OP0A 1WAYB 1EJMA 1HGTH 1FDPA 2CXVA 3GDSA 3QLPH 2J97A 3N9LA 2VWLA 4DW2U 1W10U 4AYCB 4TWWA 1Q31A 5F8TA 2FTMA 4H9DA 5GJ4B 2Z3DA 3T7LA 2PNXA 3FEHA 1ZMLA 1CGJE 3A7TA 4X0WU 1MZAA 3QUMP 2TBSA 1TPPA 1V2UT 1GL0E 3H09A 2YHNA 1SGCA 1Z6EA 1SGQE 7GCHG 5KECA 3U1JB 5C1UA 3O70A 2AFQB 3ZTGA 3P8GA 5TCAA 4ACBA 2M3HA 2WPLS 3LQHA 5G0FA 4Q7ZA 3O8BA 3C5KA 1O2XA 2A31A 2P3TB 3A8CA 1CO7E 1G3CA 2KIZA 2VJEA 4NFFA 3GCTG 2GKVE 2ECJA 2Z9GA 4Y6DA 1KTTB 1KXCA 4I32A 4NWKA 4BOHA 1NN6A 1CT4E 1O34A 3OFND 1S0RA 3PV5A 1H9LB 3BV9B 3FZZA 3RM2H 4WY3A 3ZZDA 4MNYA 4ZCNA 3PHDA 1QJ6B 1GJ7B 1GDUA 1NBMD 1TGBA 2P8OB 1FY8E 3DFJA 3RXFA 1BA8B 2WYGA 3C27B 1LHGH 1VKYA 2GD4B 1LCYA 1AE8H 1ZGIA 1A0LA 3M3VA 4JYUH 2SGEE 1THPB 1T8MA 3PM3A 1P2QA 3M7UA 2DX8A 4I7BA 2C2LA 4AFQA 2PR3A 2Y7XA 1RD3B 5T1VA 3N9QA 2VPGA 1BTPA 5A09A 1T31A 1RMDA 4K5ZA 5BPEA 3AASA 5DK1A 1UTNA 1WEVA 2BLVA 4JYTA 4SGAE 1OKXA 3GYLB 1IHSH 6LPRA 2XW9A 3M3TA 4MNWA 4XFQA 4ABIA 1LPGB 2KWKA 2J98A 3LGIA 3RXOA 2B7DH 3RXUA 2ZECA 5EGMA 1TA2A 1O2IA 2NAAA 3L3TA 1WDIA 3BTKE 2FOBA 3RC4A 2CHAB 3LGTA 2G4TA 4AVXA 1VGCB 2H6MA 1SI5H 3MNSA 2WUCA 1TPOA 3UREA 3M5OA 3KDEC 4CR5A 2BOKA 1QB9A 4AC9A 2XBVA 5TABA 3ZZBA 5KH9A 5C94A 1UJ1A 1SGYE 5DP5A 1TNJA 1E79D 2F6JA 3SU6A 1TNIA 2LXPC 3A81A 2ZQ1A 4JZ1A 2O8UA 1GVLA 1DXPA 2QN5T 2G81E 1ZSLA 2UWLA 4CRCA 4YAXA 2JIZD 2M2AA 4ISHH 3AW1A 4YESB 1SOTA 1YLNA 4ABFA 3IITA 1K9OE 1P3CA 4Z0RA 3WY8A 4BAHB 4MPUA 3KV5A 4FK5A 3RP2A 1P3EA 3DSPA 2LRIC 4AORA 1TB6H 1V2JT 3DDTA 4B2AA 4OS4A 2J38A 4IS5A 2PW8H 2ZGJA 4FOUC 2PV9B 4OS6A 1P2NA 5EG4A 1BZXE 1VITG 2CT2A 1GVKB 1WBGB 1Z8JB 2FFWA 3PRDA 4JZDH 3OY5U 5E2PA 2XTTB 3F9HA 3F6UH 3A8AA 1GBHA 1B0FA 1YPJH 3ZZ3A 2AGEX 2EI6A 4UEHH 3FP6E 2GCTC 1SQRA 5TJXA 1ZHRA 2KWOA 1OXGA 2QF3A 1LQEA 3L11A 4OS5A 1Z8GA 4DG4A 5D1LB 4H4FA 1Y3VA 2XOKD 2XNDD 1O2OA 4TWYA 1TRNA 5JG6A 3SUBA 4QQ4A 2MIQA 1AFQC 2G51A 3MDBC 2WINI 2IQJA 3QO6A 1JRSA 1N6YA 4ZKNU 3RXKA 3DPLR 1EB1H 1TGTA 3KQEA 2QCYA 2C8XB 4A1XA 1ESBA 2WYJA 2OINA 5DP4A 3U8RH 8GCHF 3VXEH 1GBFA 3N7OA 4YOIA 3BEUA 1P03A 1DANH 3LDYA 4X8TH 1ORFA 3KV6A 5DSFA 1V2WT 2MNYA 2ULLA 5C2ZA 2MD8C 4CREA 2A5IA 3ATIA 1FX0B 2YREA 3SI4H 5LPRA 4HG6A 1HAZB 1BMMH 4P5OB 3ZVZB 2XWAA 3MH5A 1QTFA 1PQ7A 3O8RA 5B79A 1SKYE 3UNSA 3TPIZ 5A0BA 3T6RA 5L6NH 2A0QB 1C5MD 1QRZA 4DURA 2K0QA 5HXFA 3PO1C 1AFEH 2BB4A 1UCYH 3GY4A 1D6RA 5DP6A 2A32A 1GBCA 1DY8A 2DE8A 4K60A 4YADA 1P2KA 3HKJB 1XMNB 3QWCH 1ELEE 3SU3A 3ZZ5A 4ZHAA 4O3TA 3SUFA 4WMFA 3PRBA 2FOAA 1IQKA 1PPBH 1C2JA 1MD8A 3KQBA 1B0EA 4O62A 1ID5H 4K8BA 4X1QU 1W14U 4X1NU 2Z7FE 4MDSA 4DT4A 2A2XH 5DN6D 3TGJE 2O8WA 4MPVA 1WEOA 1FONA 3WW7A 2HGTH 3RXTA 3BG8A 1G2MA 1SFIA 2NU1E 2J2UA 1HIAB 1G3BA 1K21H 1LVMA 5A0CA 4KGAA 3ZZAA 2KREA 1IYMA 4ZAEA 3L6PA 3M99A 4NG9H 2QXGA 1NY22 4HFPB 2GP9B 4JK6A 3FZDA 7LPRA 1HJ8A 3U5NA 3S9CA 1C5QA 1OHHD 3MWIU 2C4FH 1VITH 2XOZA 1J17T 2QF4A 2ZU4A 3M37A 1G3EA 5DP7A 2TRMA 5ETXA 4UI9B 2YMSD 1SGTA 5FHTA 2ZO3H 3E90B 3PV2A 3L1ZB 3RXBA 3TK9A 1DVPA 1ELBA 2H9HA 1Z1IA 1ANBA 1CVWH 1FMGA 3ZZCA 1EJNA 2F9PA 3ZYEA 2FOGA 1GHVH 2KR4A 1PPCE 3SQHE 2OWAA 3R0FA 4Y71A 2YURA 4TT3D 3UR9A 3E2DA 4X8SH 2FD4A 1KXEA 3RXPA 4Q80A 1YPEH 1K1OA 1V6DA 2GCTB 1DSTA 4DIIH 1P12E 1V2PT 3A89A 4AFZA 5LH8A 2ANMH 3VGCC 2GTBA 1F0TA 3MH7A 4MPWA 4MVTA 4INKA 2KKYA 3UTUH 1AFQB 1QL7A 1S5SA 4Z1MD 2FUIA 1DM4B 4NZLA 1O5CB 4BHWA 1NM6A 3RXDA 2ODPA 1UK4A 1C2KA 2FEQH 5DKMA 2ZP0H 3KQCA 3RC5A 3LONA 1SQTA 2WPJS 1XUHA 2BDCA 2EA6A 2BXTH 2AHME 1GG6C 2PFEA 1EXFA 9LPRA 2FI3E 5DO4H 5KH3A 3OE7D 3AK5A 3QTOH 1SGFA 2L74A 4AYYB 1ZJDA 1WCZA 3LH3A 2CK3D 1AN1E 3BEFB 2J92A 4Y0ZE 4JZEH 3EB5A 3IHPA 4U30A 3SV8A 3O8CA 2BHGA 1SOZA 2STAE 1SQOA 2ANYA 4Y7AA 1EZQA 1AUJA 3MMGA 1KXFA 1MCTA 3ASLA 4RN6A 1LDTT 1C5WB 1C9TA 3VB7A 1LHFH 1O3EA 3SOUA 2HWLB 4ISLA 2AMPA 2HOBA 1WV7H 3GL6A 1YLCA 1O3JA 3PO1B 2KWJA 1TGCA 5KH7A 1KDQA 2OXSA 1OOKB 1OPHB 4ABGA 2H2ZA 2L75A 2F42A 5FPSA 2ZGBH 1F92A 1MTNC 3M7TA 1LQDB 2FM2A 2HDPA 1GI1A 3L33A 1O2VA 1YCPH 1HAOH 1SSXA 1EPTA 1QB6A 3RC6A 2BY8X 4WF8A 4YBSA 4OS2A 2FXRA 2ANWA 1YPHC 4H6SB 4CH8B 1W2KH 4DCDA 3U98H 5AHGH 1YP9A 1MD7A 2ZNKH 2MT5A 4DIHH 4XBBA 3SNDA 2B5TB 3SV6A 3ZYQA 1BBRE 1PPGE 1Y3YA 1HB0B 2KZ4A 4I8KA 5G05B 4NIWA 1GMDF 2AMQA 4QF3A 1ELDE 4NSYA 3SZEA 2Z6BD 1TOCB 2OC7A 3ITIA 3TGKE 1DLEA 1JBUH 1O5DH 4HGCA 3TJUA 3RUOA 1FN6A 1GMHG 1ZPZA 2AIQA 3MI4A 1TE0A 3SHBA 3N9PA 1O3PB 2ZTZA 1TX8A 1UHBB 2JMJA 2ZDLA 4AYCA 1KY9A 2OLGA 4F4OC 2BD2A 4KTUA 5H1TA 3HTKC 1AUTC 2VPEA 4DJZB 2BY5X 1AMHA 4FO9A 3M5MA 3O47A 2FOEA 3VPKA 1GBTA 1S85A 1YPKH 5DJ7A 5EJZA 1YLDA 2HNTE 1GBAA 3A83A 1V3XA 2PKAB 1NBME 5E2OA 3GDVA 3LC3A 1SLWB 4FVBA 1VJ9U 5F8XA 3RMNH 1LPZB 2ZQ2A 2BAYA 1K0HA 2FPZA 4CHAC 4Q7XA 2F9BH 3GICB 1CA0B 5D1KB 4IC2A 4IBLH 1GWAA 2QXJA 3VGCB 1CT0E 5ABWA 3TLOA 2W26A 4WJG2 3RU4T 4FUCA 5C3NA 2QXHA 3UAIC 4Z0OA 5EXNA 1BQYA 1EAXA 3O35A 4J2YB 2Z9JA 4FUDA 2VIDA 3CS7A 4RKJB 4Y11E 1A0HB 2WV9A 4M7GA 2E6SA 5FB1A 1PPHE 1GJ6A 1QRXA 1ZHPA 4J1YA 2F6NA 1GG6B 2IDAA 4FIPA 1O2KA 2VNTA 2BDAA 3RXAA 4GB0A 1FAKH 4AYVB 1HCGA 2BDHA 3T5FH 4Z6AH 2BD7A 5C17A 2J94A 3F68H 1SR5C 2IN2A 5DP8A 1SHHB 1YCPK 2Z94A 3MU8A 2FESH 5H1VA 3VG8A 2Q6DA 1BHXF 2BX4A 3DT0H 4AUQB 1FPHH 1E1RD 1O3IA 3RXEA 2KAIA 2BQWB 1TWXB 3AW0A 2JM3A 1EB2A 3A7VA 2M85A 1NU7B 1SLUB 1NZQH 5FX5A 2L80A 5T6DA 5I25A 5SVIB 3STJA 1TBQH 4NZQA 4WVPE 1LPKB 2CV3A 1YCPM 1O2JA 1PQAA 2JRJA 1YBWA 2O8TA 2FTLE 2LAUA 4Q6FA 4QT8C 3F1SB 2BD5A 2QY0B 4MG3A 1ANEA 4H6TA 3V43A 3UB0A 3U9AH 4FXGH 1KLJH 1AD8H 1ELAA 2H5CA 1H4WA 3B8JA 4TY7A 3U5MA 1TIOA 3NG2A 2QXIA 1WIMA 1WU1A 1GBMA 1WXRA 2YT5A 2L43A 4B7YC 4FUJA 4ZQLA 1RXPA 4V3LC 3TK6A 4VGCC 5BRRE 2SNVA 5F8ZA 1VR1H 5J4QA 1OYTH 3UOUA 3O8DA 3V13A 2FYRA 3OU0A 1F0RA 2A7CA 3PWBA 2KU3A 3GY8A 3MH4A 1MKWH 2PHBA 2TGDA 1SL3A 3LGWA 1SGIB 1GCTC 3LT3A 1UTQA 2BZAA 4OS1A 2GT7A 3KNXA 4GNEA 1NRPH 3OTJE 3KN2A 1HXEH 2BMGB 4GLYA 3U8OH 1ZSJA 3ZVGA 1EZXC 2WPDD 5DG6A 1SG8B 3OY6U 1GBKA 5I46H 1GJ5H 1DVAH 1HAXB 2VPBA 1J9CH 1MQ5A 3T27A 2Q6GA 4BTIB 2LGLA 2C2VS 1C1PA 1QJ1B 3E6PH 2I6SA 3A8BA 1TGSZ 2GMTC 1MABB 2EODA 2V3MA 1ETSH 1PPZA 1O3MA 2YNBA 3HKIB 3RXJA 2LQ6A 1ACBE 2ZHQH 3NWUA 2Y82A 2ZTYA 1OYQA 1TBRH 2FDAA 1TQ7B 1E37B 1PQ8A 2EGMA 5K3QA 5B75A 1HJ9A 1RFNA 2IOTA 1H8HD 1AQ7A 2GDEH 1RTLA 1MU8B 1WGMA 3I29A 4CHAB 1A7SA 3DSGA 3ATWA 4R0IA 2XB1A 2QYIA 3MNBA 3SUEA 1W7XH 3SJ9A 2KCAA 4F55A 3BIUH 1XUIA 2LP6A 2BVXH 4MPXA 2ZU2A 1FY3A 1NRRH 4BANB 5IYTA 1TMUH 3KYGA 1D3DB 2EEKA 4CRAA 1GHWH 4K1TA 2BOHB 5AIUA 1WYKA 1DY9A 3SU5A 4GUXA 4ZHMU 4I31A 2YU4A 5C11A 1GI9B 1CA8B 3RMLH 3ATKA 1H8IH 3LH1A 2PSYA 1ANDA 3C1KA 4IN2A 3L1XA 2VJFA 1Y8TA 1BITA 2QGRA 1Y5AT 2XC0A 3DA9B 4ZXXH 3E91A 3NXPA 2HYED 1TMTH 4M9FA 3SZNA 3A80A 1ELCA 3RXQA 1GBEA 2RI7A 3STIA 3RXMA 5LPEA 3H7TA 4LLBA 4FETA 1C9PA 1ELFA 1J16A 2CSYA 3JZ2B 4F49A 1V2VT 1LHEH 2Y1NA 1DX5M 1TX6A 1FPCH 2HALA 5AFZH 1UMAH 3PLWA 4B71A 1O2WA 1J8AA 1HFDA 3ZYDA 1BCUH 3PMAB 2EA3A 3U1IB 1DLKB 2VB0A 1EJAA 5C5OA 1S83A 3P8OA 1SGNE 1X4JA 2FS9A 1VFYA 1LVOA 1ELVA 3W94A 2F9NA 3GY3A 1GVZA 1MKWK 2PP6A 5LKUA 3BTWE 1Y3UA 3P6ZB 5L2ZH 5JBBS 2JMDA 4X2VA 3MNCA 1B5GH 1S82A 1C2MA 1O5BB 1HAHH 1SB1H 2PUQH 1T8OA 1RTKA 3PB1E 2ZG0H 4INHA 5DPAA 3I77A 7KMEH 1FY5A 5FERA 2A4OA 1N8OC 2C8ZB 2BX3A 2L5UA 2JH0D 3HGNA 1G37A 1SBWA 2TIOA 4NA9H 4XBDA 1Z7KA 1W8BH 3LRQA 5HGGA 1S81A 1ELGA 3F0PA 3KYFA 4VGCB 5B76A 3F2GA 5GNDA 2FIRH 1FZZA 4XSKU 1QGFA 4ZH8A 2G43A 5EQQA 5A0AE 3SU1A 2ZHWH 2SGPE 3HCSA 3E0PB 4ABDA 1CGHA 1GCTB 1TALA 1T8LA 1W3CA 4LOYH 5E0JA 2FSAA 2YHOA 3KQIA 4GVUA 1TA6A 2ZHFH 2JH6D 4UE7H 2UUYA 3FKSD 2KCYA 1YM0A 3OYPA 2M13A 1JM7B 1MTUA 1LTOA 2ZTXA 5GCHG 5HM9A 1BJUA 1BUIA 1LKAA 1AKSB 3RM0H 1CQQA 1HRTH 4V3KC 4DY7B 3PURA 2C3SA 3HGPA 1GBLA 1DWEH 2HLDD 2OQUA 3PYHA 3A7ZA 4E06H 3RMOH 1PFXC 1ZOMA 2GZ8A 2R9PA 2FS8A 1YPLH 1O2TA 1JOCA 2GMTB 2KCPA 4MVNA 1LMWB 2JETC 2PTNA 1TONA 1C1RA 1QB1A 3VK6A 4R2YA 1UTOA 1ZGVA 4K1EA 2BLWA 4AG2A 5K0HA 3DSOA 3C6WA 4LJNA 5AITA 1MQ6A 1NFXA 5B78A 1UK2A 2QIZA 4K1SA 1GHBG 4CBOA 2B0OE 2ECVA 1KIGH 4GCHF 2OD3B 2XP0A 4A4CA 1KYNA 1QJ7B 1Z8IB 3SI3H 2G8TA 3LQJA 1V2QT 2GDDA 4AN7A 2W3KA 2FO9A 3O34A 1GJCB 1E0FD 1S84A 2ZDKA 2GCHG 3GCHC 2KFWA 2F9VA 4XE4A 2ECIA 2A1DB 2G5NA 2H1UA 5C67A 3VB3A 4AFSA 3KF2A 1LVBA 4NA8A 2WHXA 3A84A 4WH6A 2OXQC 1EAWA 1XXDA 1AVGH 1BDAA 3ZVFA 1XUKA 2OC1A 5I3LA 1WEMA 1KTSB 4YATA 2LGVA 3UNQA 3PMHB 3MFJA 1BB0B 2BM2A 1LHDH 5FB0A 1GHAG 1VCPA 2M6MA 5HMAA 2XNIA 2OQ5A 5AVDA 1Z71A 5B77A 3MHSA 2B9LA 5JYIA 2AIPA 2Z9IA 5F53A 3LGYA 2V7QD 3MU0A 1K2FA 3S7KB 1F0SA 1H8DH 2VINA 3ZVEA 2VGCC 1NT1A 3OAAD 5DP9A 3UWJH 2CGAA 4X6MA 1L1GA 4YTAA 4D7GA 1WFKA 4WA6A 1FN8A 1GPZA 2G52A 4RT0A 3Q76A 5AFYH 3M3SA 3OTPA 1XKBC 4GHQA 3SU4A 3E16B 3PV4A 3LC5A 4CRGA 2ECNA 5TRBA 1UTJA 4PROA 1S0QA 1GMHF 4XRNA 4Z0KA 1CBWC 1HUTH 2CSZA 5GPIB 1AIXH 1OWEA 2YQMA 3SJIA 2Y7ZA 1MAYA 2A2QH 1XUGA 1PYTC 2ODYB 5EODA 5DP3A 4Y8ZA 4X6OA 3GYMA 1O3NA 1TNLA 1TYNA 3MO3A 2CF9H 4Y79A 3WWBA 1A2CH 1N8OB 4GNFA 4UFEH 2ZFPH 4THNH 2CRRA 3MU5A 4Y76A 1K1PA 1BRBE 1FLEE 2K17A 1C1UH 1UHBA 1JOUB 3N7DA 4F48B 2YW8A 4CRBA 2L0BA 5G4BA 2YMSC 4WZ2A 1QQ4A 1VZQH 1Y3WA 2ZDNA 3PUQA 4YABA 4ZUXU 3HCUA 3RXHA 5JB9S 3SGBE 4RKOB 3UQVA 5D1MB 2PKAA 2O8MA 3QDZB 3ZZ4A 2Y1MA 3E0NB 2CF8H 1TPSA 2ZFTA 1FIWA 5JBAS 2AYWA 4AB8A 4MSXA 2YOLA 4TY6A 4R8PK 2YYRA 4I8JA 4YBMA 2VJEB 1P02A 1ZBDB 1F7ZA 2XXLA 2W7UA 2FP7B 4X1PU 2JETB 2BDGA 2G45A 1IQMA 4X3GA 1QCPA 2PSXA 4F1PA 4JYVH 1CGIE 1YWUA 2LGKA 4HI3A 1IQLA 1Z8RA 1HNEE 2ZFQH 4LADB 4X1SU 1AO5A 4ABBA 2QA9E 8LPRA 6ESTA 1O2GH 3ZZ8A 3VFEA 3ATLA 2RR4A 2EI8A 1NESE 2FLRH 1WOFA 3ELAH 1L2EA 3A87A 5E0GA 2VP7A 1SGRE 4ISNA 3A82A 2UUKB 3URCA 2PKSC 3EAJA 1O2ZA 1C1NA 2HPQH 3Q3KA 1MKXH 2AEIH 3HK6B 1C2HA 3GCHB 1A3EH 3QK1A 1EUFA 2YUCA 1YC0A 1P10A 3PMBB 4KTSA 1BIOA 1O5AB 5EJ1A 1GL1A 3RPGC 1HAVA 2QJ0A 2TGAA 1C1OA 1BTUA 2VVCA 1CA0C 1UW7A 2ESTE 1BTWA 3NUMA 5PTPA 1NRSH 1O3LA 3JZ1B 5EOKA 4FUIA 1IQHA 3N9MA 1E35B 6CHAC 1DWDH 1B7XB 1WQSA 4WH8A 1ZYOA 5EW2H 5SVIA 4ZXYH 3SV2H 2PTCE 2ZETC 2XOCA 1HAYB 2AH4X 1W7GH 3G01A 2DE9A 1T4VH 2F9OA 5ESBA 4A0CD 4UD9H 1UCYK 2VGCB 4DT7B 3LDXH 1A5HA 5DGJA 2GX4A 5FPYA 1V2RT 4NSVA 1BJVA 3KCGH 3ZVYA 4Q4LA 1YPMH 2FMJA 4BAKB 2STBE 2FI5E 4X2WA 1CBWB 5GXPA 3RMMH 5FCKA 2EY4C 1C2DA 1GHZA 1W11U 2TGPZ 2VPDA 1FXYA 2DSMA 1K1MA 4WWYA 1HV7A 1OWHA 1C5YB 4NWLA 2LELA 1NROH 3NRLA 3F9EA 1K28D 4IMZA 4I7DA 1NRQH 4XD7D 4I7CA 3SQEE 1OWKA 1MM2A 3MH6A 1XWHA 4BAOB 2ZHEH 2ECGA 2P3UB 1KLTA 4X1RU 3A7WA 2A4RA 2L7PA 1NRNH 5CMXH 5F6MA 4Q7YA 5B6OA 4W4UA 1PPEE 3KGPA 3PTBA 2LPRA 2YMSB 4E7NA 2CN0H 1GI3A 2JMIA 1L1NA 4IMQA 1SQAA 3GOVB 2GZ7A 2VIOA 1DOJA 3ZZ6A 1O35A 1VCWA 3SV7A 3O33A 1P57B 1N87A 4WMDA 1TBZH 1K1NA 3EA9A 1O2SA 2H9EH 2VU8E 3A8DA 2Y80A 3TVJB 4BTTB 3IWMA 3MHHA 4Q2KA 5LPFA 3H7OA 1C5XB 4JMYA 4IGDA 4AG1A 3DFLA 7GCHF 1G3DA 3TIUA 4PTBA 5KGOA 1C1MA 2F3CE 1HJAC 5C0UA 2KR7A 7ESTE 2VJ1A 1UO6A 3FAOA 4KP0A 3SHAH 1O0DH 1AY6H 1AVXA 3SOSA 3SOWA 3F9GA 3SNCA 1SMFE 2SGFE 1N6XA 2QF5A 8GCHG 3GCTF 5SGAE 1VCQA 1INCA 1O37A 2PKSB 2VH6A 5C0TA 5A8YA 1CT2E 2WPMS 1SPJA 1O2QA 3S69A 1NTPA 4NIVA 3ZPVE 1ZTJA 4IC5A 1JIRA 1EOJA 3BSQA 3TNTA 1X7AC 4FJCA 2Y5HA 2C8WB 1DPOA 2F91A 4CRFA 2HPPH 2V3HH 3B23B 4X2XA 3NCLA 4HTCH 4Y10E 3M63A 3RPGB 3O36A 2XRCA 1K2I1 4YM9A 3BG4C 3QZVA 5HM2A 1C5UA 3F2HA 1BMLA 4MQAA 4OS7A 2YVRA 5EJLA 1ABJH 6CHAB 1WE9A 4B2CA 1GJAB 1RTFB 1WESA 4YC9A 2Q6FA 3LKWA 1P09A 5KEDA 2BD8A 3M36A 1HYJA 2R0KA 1C4U2 1D4PB 5GIBA 3M7QA 1GGDC 3A85A 2VIPA 5FPTA 4BNRA 1FBVA 4F52B 4ABHA 1FP0A 4XOJA 1V2ST 1O3AA 4GAWA 3T26A 1D3PB 4FU9A 2BYAX 3EE0B 1QL8A 1OWJA 4YO9A 2Y6TA 4K3JA 2D8WA 1FI8A 3ZNIA 2BDYA 1ETTH 1Z1JA 1UTPA 3AAVA 5GCHF 1MMJN 1KXDA 2Z3EA 4KELA 3V7TA 2BY9X 1GCDA 4OM9A 1DSUA 1SGEE 3QGJA 4B1TA 1W0KD 2K4DA 1ZRBA 1PPFE 1JWTA 1ZRKA 1COWD 5IDKA 1Y59T 3SUGA 4ACAA 1GI6A 3ODFA 2W3IA 3RXSA 4CR9A 1JM7A 1FAXA 1GHBF 1E1QD 3GCOA 3TJNA 1AKSA 1SFQB 1W0ZU 1ZPCA 2JKHA 2E6RA 3N9OA 1HPGA 1RS0A 3HCTA 1EP6A 2BY7X 4DVAU 5H1UA 3SOXA 4FU8A 1TGNA 1JXPA 1NO9H 3MO6A 4LZ1H 1DS2E 1GJBB 4D9RA 3NK8A 3GY2A 2KE1A 5CHAB 3DHKH 1JRTA 1FY4A 1O3DA 5HIYA 5SVXA 1VITF 2GCHF 2VWMA 1DXWA 2QV1A 2K16A 1XKAC 1O33A 2DJAA 1EZUC 1MH0A 5CHBA 2GV6A 1C5NH 2KGIA 1ESTA 2B8OH 2YSMA 1C1TA 1ARCA 4ZKSU 1U6QA 1G2LA 2D8SA 3D23A 3RXGA 3VEQB 2ALVA 3BTDE 3FJUB 1P11E 5EQRA 5GWZA 3MU4A 3UFAA 3ZVAA 3T29A 1FNIA 1O30A 1TNKA 2W5EA 1VJAU 1HJAB 4NA7A 2RFKC 2YQLA 1X4IA 1YYY1 3RXRA 1LDKC 1O2LA 4U32A 5A8XA 1V2KT 2AERH 2XBWA 1E38B 1EX3A 5TDWA 3H7HA 4Y0YE 1CE5A 3P95A 4AGJA 2EC9H 2O8LA 1G32B 2V0BA 2KX4A 3CNRA 3U5OA 4NIYA 4E05H 1P2OA 1PQ5A 2CMYA 3FL2A 1DITH 2F9UA 3KNVA 4A1VA 1KDQB 1OP2A 2LDRA 3NPSA 1TQ0B 5C1XA 1HYLA 3QN7A 1MTWA 3DWDA 2P94A 4AZ2B 1N1LA 2ZF0H 2ZFFH 1DUEA 5F03A 1CHOG 5EW1H 3BG4B 3NKKA 3LGVA 3KHVA 1HAPH 3PLPA 2KCOA 1BRCE 1HAIH 1XXFA 4ZKOU 4B6EA 4GNDA 2VIWA 2P95A 3TH2H 2Q1JA 1BORA 2FODA 3DD2H 2WV5A 3U5PA 2HNTC 4CCGX 1C2IA 5CE1A 1THSH 2MA5A 3RXIA 2Z3CA 3K6YA 4O3UA 2FOFA 2LXHC 2XC5A 1G36A 1P0SH 1GGDB 1A5IA 3UQOA 3ATMA 2F43B 4XDEA 3V12A 1C5ZB 3F2FA 2Y5FA 1ESAA 2LGGA 3Q3XA 1MU6B 3URDA 3N9NA 4MNVA 2HLCA 1DCQA 1Y5BT 1QNJA 1O36A 1A1RA 1WILA 3GS9A 1OX1A 2GJGA 2XBXA 3OSYA 2J9NA 2B0FA 2YSJA 3SNAA 1V2TT 5TCCA 1ETRH 2H9TH 2O9QA 1YPGH 3AAUA 4UDWH 1C5TA 1IOEA 1TPAE 1UK3A 4YLUA 3SYJA 1G30B 3Q3YA 4GSOA 1LKBA 1GMDG 3I2DA 3LVQE 1S6HA 1C1SA 3SJKA 5A2MH 8ESTE 1BMFD 1O3OA 4YT7H 1WENA 4X6PA 4UFDH 4ZROA 3LOXA 2ZCKP 1QA7A 2OTVA 2D8UA 1GBBA 3EA7A 3AVZA 4UFFH 3RXCA 5C13A 3SU2A 3LPRA 1D3TB 4LKAA 8KME2 4D76A 1M9UA 2IPQX 2ZC9H 3P17H 3UY9A 1Y3XA 6GCHG 2KGGA 3SV9A 1DDJA 2GVFA 5LKZA 3KQDA 1HIAA 4WXIA 1IQJA 4B76A 1UVSH 3EB6A 1U6GB 2GT8A 1KXAA 4WXVA 3T9KA 1WTGH 2GV7A 3V0XA 1XM1A 2PGBB 1H8ED 3RU4E 1O3FA 2QE7D 5L2YH 2ZPRA 2ODQA 1GBJA 1TAWA 5E0HA 1WEQA 3RDZA 1T1HA 2A4QA 4O03A 1WEWA 1ANCA 1EASA 1O31A 1O5EH 1QFKH 2F83A 2RDEA 4Q63A 1TOMH 3HK3B 3ODDA 5L30H 1RIWC 4OGYA 2SNWA 3N7EA 4GHTA 4DGJA 1AB9C 2XEUA 2VVVA 3LIWA 2WUBA 1AGJA 1O5FH 1GJ4H 1ZHMA 3PLBA 4NIXA 4ABEA 4D9QA 1O39A 1K1LA 1P01A 2HNTF 2WZQA 1EP5A 4YOJA 3ZZ7A 1K1JA 4FUGA 2UWOA 2FX6A 2ALPA 2ZA5A 1AWHB 1MBMA 2ECWA 1NPMA 3SNEA 4ISOA 2JUNA 3SU0A 2CKLB 1DICA 2KAIB 4ZDTA 1AZ8A 4TKPB 4FVDA 4BAMB 4I8HA 3DCLA 3BTQE 4FUHA 2Y43A 1SGFG 5JBTA 1GMCG 1V2NT 4K69A 3JUEA 3LGUA 1RRKA 1GI7B 3BF6H 2ZCLP 2ZDMA 5LGOA 2MUMA 1GHYH 2IJD1 1IHTH 1C2FA 4L7XA 1OWIA 1O3HA 2EI7A 2QF0A 4ZMAH 1O3GA 3IG6B 2IPHA 4LZ4B 4B2BA 1C5PA 5EYAF 4P00A 2K1QA 2IJOB 3E1XB 1GBDA 2ZKSA 3EQ0H 4A4BA 1C2LA 1OP8A 2AGGX 1QZ8A 2ZFSA 2A7HA 4K2YA 1WUNH 3ZZ9A 1UVPA 3HPTB 1L0ZA 3Q77A 1FV9A 3M35A 2ZGCA 4E7RG 4P02A 3SNBA 4CA1A 5H4IB 1PJPA 2NU4E 4A92A 3TH3H 2AN6A 4YT6H 2PLXA 3N99A 1VD4A 4YLQH 4GNGA 2A5KA 3KEEA 2H5DA 5HYOA 1P2JA 4YOGA 2TGTA 2SGDE 2AS9A 3RXLA 1SVPA 3VB5A 5SVYA 2JJ2D 1CHCA 4OGEA 4WZ3B 3A86A 4S3OC 1FIZA 2R3YA 2MA6A 1NFUA 3UNRA 4I86A 3MYWA 1O2HA 2CONA 1TRMA 3QZRA 4AFUA 4A1TA 4Y7BA 3SN8A 3SJOA 1XVMA 2F4LA 3VB6A 1AE5A 4N3WA 2WSSD 4WZ0A 3K2UA 3V3MA 2MD7B 1GDQA 1QBOA 4TSFD 4Y8YA 4AP4A 1C5RA 2UUJB 2V3OH 5EXLA 1X4UA 1GI5A 3T28A 1WTHD 1LO6A 1Z6JH 3K9XB 3MTYA 1KXBA 3FP8E 3VB4A 2H0DB 4FU7A 1QR3E 2I50A 1QL9A 2E61A 2J34A 1O2PA 3SHCH 1O2YA 2CSVA 1J15A 4A6LA 4B73A 5ESTE 1ARBA 3UWIA 4PPEA 1L4ZA 4BXSA 1EFRD 3QZQA 1C1VH 2ZWLH 4BXWA 2KYUA 2WPKS 1P9SA 1YF4A 4LXBH 1KSNA 3K65B 2A5AA 4NCYA 5T3HA 1OSSA 4U01A 4RSPA 2ZPQA 4MTBA 5C5NA 3SUDA 4BTUB 2G6QA 2BQ7B 1MM3A 5TBNA 1UTLM 4Y8XA 3TITA 2CJIA 1P04A 3LQIA 3U8TH 3T62A 1EZSC 1IAUA 2VWNA 1QIXB 1LVYA 3E8LA 2HVXA 3CS0A 3M7KA 1W13U 2MNZA 2XBYA 2VJFB 3Q1DA 1RIWB 3M5NA 3S0NA 4N4FA 4IC3A 2KKXA 4XBCA 1AB9B 2A7JA 2BQ6B 3DUXH 5C20A 4B6FA 2OC0A 2K1JA 1NU9A 2WV4A 1OWDA 2QC2A 2CRWA 2JJ1D 1UCYE 1YPHE 3TNSA 5LKTA 3O37A 4ASHA 4DOQA 4YXWD 5GDSH 1FUJA 3HATH 1ZTKA 1O2NA 2VH0A 5C1YA 1EQ9A 2BLQA 4CH2B 4X2YA 1GI0A 3PLKA 2UWPA 4ZHLU 2QICA 1IQFA 1KLIH 2ECTA 2BTCE 2KM0A 3RTRB 1BT7A 3A7YA 3W95A 1DFPA 2FZZA 5JPMH 4A5TS 2D1JA 1V2LT 1O32A 2OBQA 5K7RA 2VBCA 1NFWA 2A45B 3ESTA 1DWCH 3ZVBA 3S7HB 4I33A 1GJ8B 2BY6X 3BTHE 2BVSH 1T7CA 9ESTA 1PYTD 1AI8H 1TMBH 3M5LA 5JDUB 2AMDA 1F5KU 2OC8A 5FBEA 4C9ZA 2PUXB 1XX9A 1C1QA 3A88A 1IQEA 2FLBH 2RA0A 1P8VC 2EQNA 2FOHA 1ZJKA 5CDFE 1EAIA 1W0YH 2Y81A 5LKXA 3ZVCA 1TLDA 1ELTA 1K1IA 3Q00A 1P05A 3S9AA 1D6WA 2WPIS 3RU4D 3R3GB 1VYXA 2PUYA 2ZPSA 2LNCA 1ZMJA 1GI8B 4AOQA 1BTHH 3D65E 2J98B 1MCVA 2P59A 1Z60A 3KIDU 3ZIAD 3FP7E 1YKTA 1UVUH 3FANA 4S3OB 2G00A 2XC4A 2XCFA 1O3BA 2ZGXH 2BD4A 1MTVA 5FXLA 3LVRE 2Z9KA 3TJVA 1HAGE 3BIVH 4U2WA 1O2UA 4TPYA 3SW2B 3BTFE 1A0JA 1S6LA 1RGQA 1HBTH 3P8FA 4SGBE 1Z2QA 1XUFA 3PMJA 1A61H 3EE7A 4X8VH 2LN0A 1HYIA 2P16A 5H9MA 3FO8D 3A7XA 1H1BA 2ASUB 3P8NA 1WEEA 1C2EA 1BOQA 3K6ZA 4X8UH 2AGIX 4CRDA 1SLXB 4NN2A 4I7YH 4B75A 4QF2A 2SGAA 3EDXB 4ABAA 1E34B 4ISIH 1EAUA 1BMNH 4MNXA 2W6ID 1F62A 1NC6A 1THRH 2DUCA 3MNXA 1LDJB 4OGXA 3E3TA 1T8NA 1TRYA 1V2MT 3GY7A 5B6LA 4K8YA 3DQVR 4INLA 1FQ3A 2FI4E 1ZLRA 2ZFRH 1SC8U 1P2IA 3EGKH 2GGVB 1Z6UA 1WEUA 1QQUA 1T4UH 3NZIA 5EU8A 1K22H 3RLYH 2TPIZ 1CHOF 5LCWB 3SJ8A 4GCHG 1YY3A 1ZPBA 1TFXA 2VIQA 2Y5GA 3SORA 4KKDA 3BTME 2C8YB 1DWBH 5AF9H 3BEIB 5EPYA 1SHYA 1QBVH 1YGCH 5CHAC 1QBNA 2RCEA 2RA3A 2BVRH 1CU1A 4D8NA 3MQKC 2W7SA 4FUFA 2L6OA 1C1WH 2VNFA 1MKXK 3PROA 4XI1A 2K8IA 2ZU1A 4NFEA 2ZCHP 5EQSA 2BZ6H 2XWBI 4UP0A 2ZZUH 3GISB 4JZFH 3T25A 2D2DA 4B86C 1MAXA 1BRUP 5FBIA 4AB9A 1BBRH 1TNHA 4ZKRU 3M61U 3TU7H 1SLVB 3GY6A 2MKEA 2R2MB 4ABJA 3F0OA 1A46H 1A5GH 4LK4A 2HRVA 2LV9A 2KFTA 3H5CB 2OP9A 1GBIA 1AWFH 2BD3A 1C5OH 5EIYA 2FUUA 2NU0E 5DINA 4A49A 2NU3E 1A3BH 1S6FA 3UOPA 1QHRB 3UPEA 3UUZA 4YBTA 1Q3XA 4IN1A 1P2MA 1ZZZA 2RG3A 2SFAA 1TX7A 3SO3A 3EA8A 1C5LH 2BD9A 1GDNA 1JIMA 1O2RA 3KL6A 2GZ9A 4R8TB 1Y5UT 3TJOA 1DT2A 1MBQA 4JZIA 2EGPA 1O5GH 1AVWA 5DKAA 1G25A 2ANKH 2FX4A 1ZMNA 3U69H 4UONA 2ZDVH 4FUBA 5IK2D 2R0LA 3ENSB 3BTTE 4B74A 2G5VA 3O7AA 1UTKA 3M62A 3FN8A 3MU1A 4TPIZ 3SGAE 2R2WU 6GCHF 3ZV9A 3I78A 2M1RA 1AU8A 2I6QA 3RXVA 4D7FA 3LU9B 1EPTC 2G4UA 1GHXH 2XYAA 3QTVH 2ZU3A 5E8EH 1MTSA 1C4V2 1QA0A 2J5UA 1ZTLA 4HZHA 3F3BA 1V2OT 2G55A 3P70B 4AGKA 5FAHA 1DE7H 2P93A 2R3UA 1DUAA 2J95A 3S9BA 3FVFB 1SGDE 2ZDAH 3LJUX 3ZPV1 1GJ9B 1ZR0A 1D3QB 1GJDB 3GCNA 4BBQA 1A4WH 1W0JD 4WMEA 1GI4A 1EOLA 2ZI2H 1WSSH 5HIZA 3FM8C 5JB8S 3BN9A 3D49H 2BXUH 2FOMB 4CBNA 3PWCA 3SBKA 2ZGHA 4RT1A 5HKKD 5J3XA 5FEYA 2OK5A 3OX7U 4BAQB 5J4SA 2UZGA 1AZZA 4FUEA 1HDTH 1IQIA 3LJJA 1H9HE 5G04B 3EYDA 1IQNA 3W1EA 4A7IB 3KQ5A 1GMCF 5EPNA 2ZEBA 3TH4H 3FFGA 1J14A 2ZU5A 3BTGE 4JK5A 3UR6A 5FX6A 4I8LA 1BBRK 1BMAA 1UVTH 1W12U 2ZIQH 1TNGA 2YNAA 1HAVB 2M5TA 1O3KA 1OS8A 1FY1A 2BDIA 1QURH 3U28C 2KWNA
chains in the Genus database with same CATH topology
3ZV8A 1O2MA 1WQVH 1C5VA 2BLOA 2QIQA 1LHCH 1Q2WA 2VWOA 2XCNA 5JBCS 2OBOA 3UIRA 1NS3A 2BDBA 2RDLA 1IQGA 3VXFH 2V35A 1JMOH 5T6FA 2C90B 3GY5A 3T2NA 4H42U 1GI2A 3ZVDA 3SGQE 2P8OC 4NGAH 3LJOA 5A8ZA 1BTXA 1D9IA 3GDUA 5FCRA 2PWXA 1MTNB 3CP7A 2JH5D 4ZUHA 1F5LA 1CSOE 2OCVB 1E36B 1BRAA 3B9FH 2VIVA 1GHAF 4IW4E 2OUAA 3TK5A 5EXMA 1MZDA 1F0UA 2ILNA 1EATA 2Z9LA 2VVUA 3QX5H 4IC6A 1BHXB 1ZSKA 4KTCA 2P3FH 2NU2E 1HLTH 1C2GA 4YZUA 3QGNB 1T32A 4O97A 4UFGH 1F5RA 3F9FA 1O38A 1H9IE 2PGQB 4TYDA 2CHAC 1F2SE 4AX9H 4X6NA 1C5SA 2FYQA 1HXFH 1VGCC 2C93B 2FWWA 1AHTH 1ABIH 1G9IE 2ZHDA 2FOCA 1SGPE 1UVOA 1XUJA 1BTYA 4GPGA 1RJXB 3MOCA 2A4GA 1QY6A 3PTNA 2UUFB 1EPTB 1QRWA 1BTZA 1L1JA 2SGQE 3P92A 1TABE 1P9UA 2V6NA 3MO9A 1P06A 3CENA 1UTMA 2NWNA 1O3CA 1EKBB 3MHWU 1MUEB 2D26C 4ESTE 4MLFB 1XVOA 3RLWH 2J4IA 4O9VA 1C4Y2 3BTEE 2WPHS 1FJSA 4JCNA 2QAAA 1NFYA 3TGIE 2THFB 5T6GA 1L4DA 3D62A 4I8GA 1CHGA 1OP0A 1WAYB 1EJMA 1HGTH 1FDPA 2CXVA 3GDSA 3QLPH 2VWLA 4DW2U 1W10U 4TWWA 1Q31A 5F8TA 2FTMA 5GJ4B 2Z3DA 1ZMLA 1CGJE 3A7TA 4X0WU 1MZAA 3QUMP 2TBSA 1TPPA 1V2UT 1GL0E 1SGCA 1Z6EA 1SGQE 7GCHG 3U1JB 5C1UA 2AFQB 3P8GA 5TCAA 2WPLS 4Q7ZA 3O8BA 1O2XA 2A31A 2P3TB 3A8CA 1CO7E 1G3CA 4NFFA 3GCTG 2GKVE 2Z9GA 4Y6DA 1KTTB 1KXCA 4I32A 4NWKA 4BOHA 1NN6A 1CT4E 1O34A 1S0RA 1H9LB 3BV9B 3FZZA 3RM2H 4WY3A 3ZZDA 4MNYA 1QJ6B 1GJ7B 1GDUA 1TGBA 2P8OB 1FY8E 3DFJA 3RXFA 1BA8B 2WYGA 3C27B 1LHGH 2GD4B 1LCYA 1AE8H 1ZGIA 1A0LA 3M3VA 4JYUH 2SGEE 1THPB 1T8MA 3PM3A 1P2QA 3M7UA 4AFQA 2PR3A 2Y7XA 1RD3B 1BTPA 5A09A 1T31A 4K5ZA 5BPEA 3AASA 5DK1A 1UTNA 2BLVA 4JYTA 4SGAE 1OKXA 3GYLB 1IHSH 6LPRA 2XW9A 3M3TA 4MNWA 4XFQA 4ABIA 1LPGB 3LGIA 3RXOA 2B7DH 3RXUA 2ZECA 5EGMA 1TA2A 1O2IA 3L3TA 3BTKE 2FOBA 3RC4A 2CHAB 3LGTA 2G4TA 1VGCB 2H6MA 1SI5H 3MNSA 2WUCA 1TPOA 3UREA 3M5OA 4CR5A 2BOKA 1QB9A 2XBVA 3ZZBA 1UJ1A 1SGYE 5DP5A 1TNJA 3SU6A 1TNIA 3A81A 2ZQ1A 4JZ1A 2O8UA 1GVLA 1DXPA 2QN5T 2G81E 1ZSLA 2UWLA 4CRCA 4ISHH 3AW1A 4YESB 1SOTA 4ABFA 3IITA 1K9OE 1P3CA 3WY8A 4BAHB 4MPUA 3RP2A 1P3EA 4AORA 1TB6H 1V2JT 4B2AA 4OS4A 2J38A 4IS5A 2PW8H 2ZGJA 2PV9B 4OS6A 1P2NA 5EG4A 1BZXE 1VITG 1GVKB 1WBGB 1Z8JB 4JZDH 3OY5U 5E2PA 2XTTB 3F9HA 3F6UH 3A8AA 1GBHA 1B0FA 1YPJH 3ZZ3A 2AGEX 2EI6A 4UEHH 3FP6E 2GCTC 5TJXA 1ZHRA 1OXGA 2QF3A 1LQEA 4OS5A 1Z8GA 4DG4A 4H4FA 1Y3VA 1O2OA 4TWYA 1TRNA 1AFQC 2G51A 2WINI 3QO6A 1JRSA 1N6YA 4ZKNU 3RXKA 1EB1H 1TGTA 3KQEA 2QCYA 2C8XB 4A1XA 1ESBA 2WYJA 2OINA 5DP4A 3U8RH 8GCHF 3VXEH 1GBFA 3N7OA 4YOIA 3BEUA 1P03A 1DANH 4X8TH 1ORFA 1V2WT 2ULLA 5C2ZA 4CREA 2A5IA 3ATIA 3SI4H 5LPRA 1HAZB 1BMMH 2XWAA 3MH5A 1QTFA 1PQ7A 3O8RA 3UNSA 3TPIZ 5A0BA 5L6NH 2A0QB 1C5MD 1QRZA 4DURA 5HXFA 3PO1C 1AFEH 2BB4A 1UCYH 3GY4A 1D6RA 5DP6A 2A32A 1GBCA 1DY8A 2DE8A 4K60A 1P2KA 3HKJB 1XMNB 3QWCH 1ELEE 3SU3A 3ZZ5A 4ZHAA 4O3TA 3SUFA 4WMFA 2FOAA 1IQKA 1PPBH 1C2JA 1MD8A 3KQBA 1B0EA 1ID5H 4K8BA 4X1QU 1W14U 4X1NU 2Z7FE 4MDSA 2A2XH 3TGJE 2O8WA 4MPVA 1FONA 2HGTH 3RXTA 3BG8A 1G2MA 1SFIA 2NU1E 2J2UA 1HIAB 1G3BA 1K21H 1LVMA 5A0CA 4KGAA 3ZZAA 4ZAEA 3L6PA 4NG9H 2QXGA 1NY22 4HFPB 2GP9B 4JK6A 3FZDA 7LPRA 1HJ8A 3S9CA 1C5QA 3MWIU 2C4FH 1VITH 1J17T 2ZU4A 3M37A 1G3EA 5DP7A 2TRMA 5ETXA 1SGTA 5FHTA 2ZO3H 3E90B 3RXBA 3TK9A 1ELBA 2H9HA 1Z1IA 1ANBA 1CVWH 1FMGA 3ZZCA 1EJNA 2F9PA 3ZYEA 2FOGA 1GHVH 1PPCE 3SQHE 3R0FA 4Y71A 3UR9A 4X8SH 1KXEA 3RXPA 4Q80A 1YPEH 1K1OA 1V6DA 2GCTB 1DSTA 4DIIH 1P12E 1V2PT 3A89A 4AFZA 5LH8A 2ANMH 3VGCC 2GTBA 1F0TA 3MH7A 4MPWA 4INKA 3UTUH 1AFQB 1QL7A 1S5SA 1DM4B 4NZLA 1O5CB 1NM6A 3RXDA 2ODPA 1UK4A 1C2KA 2FEQH 5DKMA 2ZP0H 3KQCA 3RC5A 3LONA 1SQTA 2WPJS 1XUHA 2BDCA 2BXTH 2PFEA 1GG6C 9LPRA 1EXFA 2FI3E 5DO4H 3QTOH 1SGFA 4AYYB 1ZJDA 1WCZA 3LH3A 1AN1E 3BEFB 2J92A 4Y0ZE 4JZEH 4U30A 3SV8A 3O8CA 2BHGA 1SOZA 2STAE 1SQOA 2ANYA 4Y7AA 1EZQA 1AUJA 3MMGA 1KXFA 1MCTA 4RN6A 1LDTT 1C5WB 1C9TA 3VB7A 1LHFH 1O3EA 2HWLB 4ISLA 2AMPA 2HOBA 1WV7H 1YLCA 1O3JA 3PO1B 1TGCA 1KDQA 2OXSA 1OOKB 1OPHB 4ABGA 2H2ZA 5FPSA 2ZGBH 1F92A 1MTNC 3M7TA 1LQDB 2FM2A 1GI1A 3L33A 1O2VA 1YCPH 1HAOH 1SSXA 1EPTA 1QB6A 3RC6A 2BY8X 4WF8A 4OS2A 2FXRA 2ANWA 1YPHC 4H6SB 4CH8B 1W2KH 4DCDA 3U98H 5AHGH 1YP9A 1MD7A 2ZNKH 4DIHH 4XBBA 3SNDA 2B5TB 3SV6A 1BBRE 1PPGE 1Y3YA 1HB0B 4I8KA 4NIWA 1GMDF 2AMQA 1ELDE 4NSYA 2Z6BD 1TOCB 2OC7A 3ITIA 3TGKE 1DLEA 1JBUH 1O5DH 4HGCA 3TJUA 3RUOA 1FN6A 1GMHG 1ZPZA 2AIQA 3MI4A 1TE0A 1O3PB 2ZTZA 1TX8A 1UHBB 2ZDLA 1KY9A 2OLGA 4F4OC 2BD2A 4KTUA 1AUTC 4DJZB 2BY5X 1AMHA 3M5MA 2FOEA 3VPKA 1GBTA 1S85A 1YPKH 5DJ7A 1YLDA 2HNTE 1GBAA 3A83A 1V3XA 2PKAB 5E2OA 3GDVA 3LC3A 1SLWB 4FVBA 1VJ9U 5F8XA 3RMNH 1LPZB 2ZQ2A 2FPZA 4CHAC 4Q7XA 2F9BH 3GICB 1CA0B 4IBLH 1GWAA 2QXJA 3VGCB 1CT0E 5ABWA 3TLOA 2W26A 4WJG2 3RU4T 4FUCA 5C3NA 2QXHA 5EXNA 1BQYA 1EAXA 4J2YB 2Z9JA 4FUDA 2VIDA 3CS7A 4RKJB 4Y11E 1A0HB 4M7GA 1PPHE 1GJ6A 1QRXA 1ZHPA 4J1YA 1GG6B 1O2KA 2VNTA 2BDAA 3RXAA 1FAKH 4AYVB 1HCGA 2BDHA 3T5FH 4Z6AH 2BD7A 2J94A 3F68H 1SR5C 2IN2A 5DP8A 1SHHB 1YCPK 2Z94A 3MU8A 2FESH 2Q6DA 1BHXF 2BX4A 3DT0H 1FPHH 1O3IA 3RXEA 2KAIA 2BQWB 1TWXB 3AW0A 1EB2A 3A7VA 1NU7B 1SLUB 1NZQH 5FX5A 5T6DA 5I25A 3STJA 1TBQH 4NZQA 4WVPE 1LPKB 2CV3A 1YCPM 1O2JA 1PQAA 1YBWA 2O8TA 2FTLE 4QT8C 3F1SB 2BD5A 2QY0B 4MG3A 1ANEA 4H6TA <