3FANA

Crystal structure of chymotrypsin-like protease/proteinase (3clsp/nsp4) of porcine reproductive and respiratory syndrome virus (prrsv)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
197
structure length
192
Chain Sequence
b'FRTQKPSLNTVNVVGSSMGSGGVFTIDGKIKCVTAAHVLTGNSARVSGVGFNQMLDFDVKGDFAIADCPNWQGVAPKAQFCEDGWTGRAYWLTSSGVEPGVIGNGFAFCFTACGDSGSPVITEAGELVGVHTGGGIVTRPSGQFCNVKPIKLSELSEFFAGPKVPLGDVKIGSHIIKDTCEVPSDLCALLAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-structural protein
publication title Structure and cleavage specificity of the chymotrypsin-like serine protease (3CLSP/nsp4) of Porcine Reproductive and Respiratory Syndrome Virus (PRRSV).
pubmed doi rcsb
source organism Porcine respiratory and reproductive syndrome virus
molecule tags Hydrolase
total genus 45
structure length 192
sequence length 197
ec nomenclature ec 3.4.21.114: Equine arterivirus serine peptidase.
pdb deposition date 2008-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3fanA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3fanA02
3.30.40.20 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Chymotrypsin-like serine protease; domain 3 3fanA03
4BANB 5L30H 1O2QA 2HNTE 1EP5A 1TX7A 1FY4A 1Z1JA 2FS8A 2V0BA 3DD2H 5JBTA 3P17H 3RXPA 3ZVFA 4ABAA 2B7DH 2CF9H 3SNCA 3S9BA 1TNGA 3MNCA 1KXAA 5F03A 1N1LA 4XBDA 1YKTA 2QGRA 1QL8A 1SOZA 1KLJH 3QK1A 2NU2E 1LTOA 4JMYA 1V2OT 1RTKA 2VGCC 3G01A 1G2MA 3TJUA 1Z8GA 2ZTYA 3FANA 4E06H 3E6PH 1EJAA 2V6NA 1F7ZA 1BBRE 5ETXA 1XXFA 4IGDA 4AGJA 4IS5A 4WXVA 3U9AH 2BDHA 1QURH 1HAXB 3F9GA 3U8TH 4FU9A 1E34B 2THFB 1ESBA 1A7SA 1FY8E 2A0QB 4O03A 4MPUA 1EZUC 5E2OA 3QLPH 1QGFA 3MHWU 3A8AA 1UHBA 3A86A 1O39A 3JZ2B 4B75A 1PQ7A 2ZWLH 1IQEA 1RD3B 4NWKA 4DVAU 1OS8A 1DX5M 5GPIB 2KAIB 1IQGA 1CBWB 3RXHA 1T8OA 1WOFA 5J4QA 1CBWC 1QQUA 1IQJA 1ZHPA 3CENA 4HFPB 1HAIH 1IHSH 1ZJDA 1K1PA 4NWLA 1A61H 3B23B 1V2KT 2FMJA 3KF2A 4WH8A 3MU4A 1NM6A 3PMJA 3RXCA 4LZ4B 1L4ZA 5FCRA 4AORA 1UK4A 2PSYA 3OY6U 2ZGJA 1SGRE 3PTNA 1VCPA 1ZOMA 2GP9B 1LKAA 1TB6H 2WINI 4IMZA 2OUAA 3GCNA 4Y7AA 5L6NH 1ELAA 1SPJA 2FLRH 1ELEE 1AZZA 2GMTC 1AU8A 1ELFA 2R3UA 2QF3A 1DUAA 1SGTA 4B71A 1SSXA 1W2KH 1QHRB 1A4WH 1MTVA 1C1SA 2TGPZ 3HGNA 3RXGA 1LHCH 4XSKU 2BLQA 4YM9A 1FONA 3SJ8A 4ZH8A 2FOGA 2VWLA 2FEQH 1HRTH 1O3HA 3MOCA 1J15A 1L1NA 1O2XA 1GHWH 4ABDA 1ZHRA 1ZSJA 2SGAA 3RXBA 5LPFA 3NK8A 5JBAS 3KN2A 1EAXA 2BX4A 1GL0E 3RLWH 1KDQA 1Y5BT 1XM1A 1GI7B 5HGGA 3SO3A 3TGKE 1O36A 3UY9A 2ZG0H 4TPYA 2A5KA 4O9VA 1G3BA 1L2EA 1SFQB 1GBLA 3MFJA 3V13A 3Q3XA 4UD9H 2BQ6B 1F5LA 3MU1A 1GVLA 3M37A 2FX4A 4E7NA 4A1TA 1O3FA 2QAAA 5DP7A 1TE0A 2V35A 2FO9A 1C2JA 2PR3A 2ZTXA 4M7GA 4ZUHA 1ZSKA 1F0UA 1BBRK 2BZ6H 1MTNB 4NA9H 3H5CB 2C8XB 4XFQA 2V3HH 2Q6DA 3L6PA 1W14U 3T29A 3PLBA 1XUIA 4INKA 4FUJA 1C2HA 1BCUH 1HLTH 3SNEA 4K60A 1QA0A 3S9CA 1P02A 3RXRA 1UJ1A 1G3EA 5E2PA 1O2UA 4K1SA 1IQLA 1MMJN 1E0FD 1MCTA 3QGNB 5LPRA 4SGBE 3TIUA 2ZI2H 2ZPRA 5A8ZA 1C5XB 5EG4A 1VITG 4JK6A 2Y7XA 2Z9IA 2BDYA 4OS2A 3AVZA 5IYTA 3UQVA 3ZVDA 2BD9A 2PUQH 2OXSA 2H2ZA 1JWTA 3OTJE 1IQMA 3I77A 1SFIA 4ABFA 5FX5A 3SJIA 3SV7A 2VIPA 2BQ7B 5E0HA 4NA8A 1Z7KA 4TY6A 3HKIB 4XBCA 1DY8A 4WJG2 2H5DA 5G4BA 1SGYE 1THSH 1B0FA 1B0EA 1V2MT 4XDEA 3EA9A 2XWAA 1GHYH 4ZKOU 4HGCA 1T8LA 4WF8A 2OQUA 1O3KA 4YESB 2Y82A 2F3CE 1GBBA 3LGYA 1C5YB 1ABIH 2Q6FA 4JYUH 1MCVA 1Y5UT 1WU1A 3ATKA 5LGOA 3P8FA 3PROA 3SBKA 2TGAA 3BTDE 2VJ1A 2ZCLP 2W3KA 4ISLA 3GY4A 3Q77A 1QFKH 1ZTLA 1HAYB 1XUFA 3P6ZB 1O2PA 4TWWA 1K2I1 3T25A 3SUDA 1ZPZA 3UNSA 1QA7A 3AAVA 3SJKA 2JETC 4BTUB 4YOJA 1LPZB 1MTUA 1GBAA 3MNBA 4NFEA 2WUCA 2CHAB 2BYAX 3F9EA 4FUIA 3BTEE 4RSPA 1U6QA 1DWBH 3ATIA 4H42U 5EW1H 2BD4A 4AB9A 3HGPA 5BRRE 2ZQ2A 1GHAG 1T8MA 1GCDA 1C2MA 3QWCH 5T3HA 1VITF 3LT3A 1FAKH 1KXEA 2ZGBH 2HOBA 3F9HA 2KAIA 4JK5A 1P10A 3DFLA 1C5SA 2HNTF 3RMLH 2G8TA 4GPGA 3MH6A 1S82A 1HYLA 2R2WU 4KTUA 3VB6A 3TH3H 1GHBG 1XUGA 4RKOB 4ZXYH 2GCTB 3SUEA 3NPSA 1GCTB 1DM4B 1YCPH 2OBOA 1JBUH 4NZQA 3UR9A 2QIQA 1TBRH 1Z71A 3TVJB 3ZVGA 2A2QH 4OS1A 2BX3A 5HMAA 1TMBH 5JDUB 3LH1A 2HALA 1ARCA 2Y6TA 3NXPA 1S81A 2VB0A 1Q31A 2Z9LA 2EI7A 2RCEA 1DXWA 4X1RU 2XXLA 3P95A 3ODDA 1EX3A 1SGFG 3E91A 4ISIH 1UO6A 4IN1A 4FXGH 1VR1H 1H9HE 1GHZA 3A87A 1P2QA 1YPKH 1TABE 3SV2H 4XE4A 1O5DH 4O3TA 4UONA 1HFDA 3NZIA 3RLYH 2J94A 2ULLA 4LZ1H 1NS3A 3VB3A 1S83A 3ZZCA 4Y8ZA 3SNDA 4ZHAA 5EW2H 1AKSB 3HATH 1DPOA 2EI8A 4I8KA 1QRXA 1Y3XA 5JPMH 5A0CA 1CA0B 3ZZ7A 1YLDA 1F5KU 1GG6B 1CHOG 1P3CA 4X6MA 4GHQA 3TITA 5GCHF 4GUXA 1O35A 1GG6C 1BHXF 1HAHH 1SHYA 8GCHG 3GYLB 2XWBI 3I29A 1TNHA 1DWCH 2O9QA 1ZZZA 3ZVBA 5DP3A 1GHBF 3SUFA 1K9OE 4X1QU 1ELGA 1YPJH 2FDAA 3LGVA 5EXMA 5DP9A 1CT0E 3O8BA 4AFSA 1PQAA 1KSNA 1CT2E 2A4QA 2BLOA 4TYDA 3V12A 2XC5A 2LNCA 1WAYB 3ENSB 2ZFPH 1MBMA 3GCTF 2YNAA 4ABBA 3GOVB 1TGNA 4F4OC 2XTTB 4AG1A 7GCHG 4ABHA 2JKHA 2FI3E 2F83A 1PPEE 3TH4H 1C5QA 3RXKA 5FPYA 7KMEH 2HPPH 1ELBA 5EXNA 2HVXA 3BTFE 4BXWA 3BN9A 4ZROA 1UVUH 4LK4A 2C8ZB 3T2NA 1Z6EA 1OXGA 4Z6AH 1ZMJA 1L4DA 3GDUA 1EUFA 1NRSH 1XKAC 4PROA 3RMNH 1NN6A 1GI0A 1EASA 4E7RG 1UCYH 4NSVA 1WUNH 1AO5A 1OWEA 2FOMB 2A45B 1AVWA 4ZHMU 1QNJA 3SZNA 2QF0A 2FM2A 4YT7H 4U32A 4D76A 5FBEA 1GI6A 2W7SA 3ZYDA 2NU1E 2WPHS 1SB1H 4BAMB 1BMNH 5A8YA 1GBMA 1EATA 1H1BA 4J1YA 1HGTH 4CHAC 1D3TB 2Z9KA 4DG4A 4YTAA 5IDKA 5ESBA 2BXTH 2BY6X 1VCWA 1TMUH 2ZEBA 3LH3A 4MPWA 3ZZ8A 1O3DA 4X6PA 2BB4A 1YYY1 4Q2KA 4FUBA 2ZO3H 4CH2B 2ZCKP 3A81A 3RXAA 1GMDG 1S84A 5K0HA 1BOQA 1O38A 4FVDA 3STJA 3V0XA 3KHVA 1IQKA 3KCGH 1A46H 1TA6A 1O2MA 2P16A 4I8GA 4O97A 1WBGB 1NY22 3N7OA 1P01A 3QDZB 1C4U2 4THNH 1YP9A 5FX6A 3P8NA 1SLWB 4DIHH 3P92A 1BTYA 1MD7A 1T32A 4GHTA 2G00A 1GI2A 2ZFFH 3LPRA 1TNIA 4DCDA 4MTBA 3RMOH 1O3CA 4MNWA 1UMAH 3ZZDA 1PYTD 2CF8H 2Z94A 2GT7A 1GI9B 5F8TA 3QN7A 3OU0A 1EZQA 4JZ1A 3JZ1B 1EPTB 1MAYA 2XRCA 1UTQA 3A85A 2Y81A 1DVAH 2GVFA 1ZR0A 3GY3A 1EPTC 1C2DA 1AE5A 2BY7X 2F9UA 1GGDC 3K65B 2F91A 1KXBA 3L3TA 2FWWA 3UREA 1HPGA 2IJOB 3PYHA 4B73A 5FAHA 2ZGXH 1OPHB 1YPEH 1GVKB 2R0LA 1TRYA 1NRNH 3DA9B 4FU7A 5DGJA 4ZKSU 3T26A 1MU6B 1O2LA 3EQ0H 3U69H 2D1JA 4X1NU 4FUEA 4E05H 1MH0A 1GMCG 2ZFSA 3A82A 4OGXA 1PPHE 1NFXA 2A4RA 1FY5A 1CHGA 1AMHA 1OP0A 1C1RA 6ESTA 1O0DH 4AGKA 2PHBA 2JH5D 3O8CA 1SVPA 4GVUA 1DSUA 1GJ6A 3RXJA 4KELA 1ELVA 5TJXA 1TGCA 3ZVCA 1X7AC 1UVOA 1GMHF 3RMMH 3T5FH 1ID5H 1O5CB 1O2OA 4WMEA 2FOHA 3RC4A 1P2KA 1AKSA 1UTNA 1HIAB 1JRTA 4UEHH 3F68H 5L2YH 2ZZUH 3MNSA 1ZMNA 2H9EH 3URDA 2BD3A 3DUXH 1ETSH 1V2NT 1QBNA 2TPIZ 2EC9H 2PSXA 3A8CA 3UFAA 2A5IA 1GBTA 2AMDA 1LDTT 3SU2A 1HCGA 1YLCA 4GCHG 3LGIA 3EAJA 3QZRA 1O5BB 1NRPH 1J8AA 1TGBA 1TPAE 1UK2A 4X6NA 2ASUB 1A5HA 2FODA 3NKKA 3K9XB 2ZDMA 3V7TA 1D4PB 1DXPA 2DE8A 3FP7E 2BVSH 2VWNA 2P3TB 2FP7B 3A88A 1Q3XA 2QY0B 1C5LH 5C5OA 2BDBA 4RN6A 2WUBA 2TIOA 1O2KA 2TGTA 2ZPSA 3E90B 3SGQE 1GMCF 4X1PU 4LXBH 1HJAB 4Y76A 1C5VA 3KQBA 1G3DA 1HJAC 4Y0ZE 4CRGA 2FOEA 1SR5C 3KNXA 4Y79A 1UTPA 1P3EA 3VXFH 2SGFE 4AYYB 1BJVA 1YPLH 1Z8IB 3TJNA 3VGCB 2G5NA 2RA0A 1IQNA 1YCPM 3A84A 5DJ7A 3M36A 3VGCC 5HM9A 1YGCH 2JH6D 1C1NA 3EYDA 3E16B 2O8TA 5HM2A 2WPIS 2BY9X 3ITIA 4MLFB 2ZDAH 4BAHB 4KKDA 1AUJA 1OWHA 1P2OA 1DANH 2G5VA 2ZGHA 1O2ZA 3SOSA 1BIOA 1SLVB 4XOJA 3Q00A 5K7RA 1RTFB 1ANBA 6CHAB 3TNTA 1WSSH 6CHAC 2F9PA 1C2EA 4GCHF 5LH8A 2UWLA 1C9PA 1LKBA 5TCAA 3DT0H 1AVGH 1AFQB 1C4V2 1AGJA 3RM0H 1BMAA 1DICA 1GWAA 4UDWH 1AFQC 1MZAA 3M7TA 1QL7A 3CP7A 1TPPA 2BM2A 2PWXA 1V2JT 2Q6GA 4ZKNU 3TJOA 4Y0YE 3IWMA 1A3BH 4B2AA 3PWCA 1MKXH 4Q7YA 1P04A 5C1XA 2Z3DA 3F1SB 1RFNA 4FVBA 1XKBC 3UUZA 4ZMAH 2ZDKA 3FVFB 4NSYA 1DDJA 1O5FH 1H8IH 4BTIB 1Y3WA 2ZP0H 5HYOA 1C5MD 3FP6E 3ZZ9A 1HV7A 1P8VC 2BXUH 1D6WA 3UPEA 1QBVH 1BRUP 3RU4T 5FXLA 2P8OB 1O2TA 1SBWA 3SV8A 3TGJE 1O37A 1PPBH 1HAPH 2P8OC 2AMQA 4U2WA 2VIDA 1Y3UA 4WVPE 1O33A 1BRBE 1C2FA 4I31A 5EGMA 3SORA 3RU4E 1GBJA 3KIDU 4X8TH 4IC6A 4VGCB 1EPTA 2EI6A 4SGAE 4CR5A 4ABIA 1O3IA 3FFGA 1V2LT 1BDAA 1WYKA 4U30A 5H4IB 1OOKB 2SNWA 1NFUA 1G2LA 2VNTA 1VJAU 3PMAB 2BLVA 1GJ9B 5DPAA 4BXSA 1O2WA 4Y7BA 4H4FA 2D26C 2OC0A 1GBKA 3LC5A 1FUJA 2W3IA 5E0JA 2BDCA 2HGTH 1MTNC 1FNIA 1GBCA 1OWDA 3STIA 1C5NH 1M9UA 2GZ7A 1V2PT 2Z3CA 1ACBE 5GXPA 1D3DB 1EZSC 2VVCA 3SJOA 4D7FA 1E38B 1T4UH 4YO9A 1CA8B 2GCHF 1LHFH 4FUHA 1BTPA 3AW0A 4HI3A 4WY3A 1T8NA 1AY6H 4MPVA 1YPHE 1TGSZ 4WMDA 1TNJA 5ESTE 2RA3A 1AZ8A 2SGQE 1RRKA 2FOAA 5F8XA 2WPJS 1KIGH 3BG4B 2ODYB 1EKBB 3TNSA 2C3SA 1G9IE 3BG4C 1W0ZU 1XUHA 5AFZH 2ZU1A 1NZQH 3P8OA 3AAUA 1SGNE 4BNRA 4CR9A 1AVXA 1HIAA 2GDDA 4KTSA 1RTLA 3PO1B 2ZU4A 1PPGE 1ZTJA 1BMLA 1GJBB 3KQDA 2Y5FA 3UOUA 1GI3A 3MH5A 1TAWA 3Q76A 1MBQA 1BTWA 3T28A 3RC5A 4NFFA 4DT7B 5AF9H 1CGHA 4MNYA 1J9CH 4YOIA 2ZPQA 1ARBA 3BTKE 5C1YA 1EB1H 2RG3A 1ZRKA 1KXCA 2EEKA 4CBOA 4DW2U 2ZA5A 4YZUA 1LCYA 1C1MA 2ZTZA 5GDSH 1GJCB 1W11U 3ZV8A 1SGCA 2V3OH 1TMTH 1Y5AT 1BJUA 1HUTH 1LPKB 4B76A 4GLYA 5I46H 2FLBH 1SHHB 1FPHH 3U98H 4D9RA 3ZVAA 2BVRH 4IC5A 2WPLS 2CHAC 4FUCA 1IQFA 1H9IE 1GJ7B 4K1TA 1W7GH 4JCNA 1CQQA 2BDIA 1DWEH 1HB0B 2FPZA 2OINA 4ZAEA 4ESTE 1K1JA 2BY8X 4Z0KA 1QJ6B 1W7XH 3LONA 3QZQA 2J34A 1PQ8A 1P2NA 1TQ0B 5GCHG 1OYTH 4BOHA 1DSTA 3EDXB 5T6FA 2J38A 2TGDA 2FTMA 4CBNA 2ALPA 1TYNA 1UTOA 3NUMA 1K21H 1UCYE 2CMYA 3VFEA 1QB6A 5C1UA 1NT1A 1P2IA 1IQIA 3SQHE 3RC6A 1GHVH 2GCTC 3QUMP 1GCTC 2B8OH 4UFDH 3BTME 1JIRA 1UVSH 3S0NA 1FPCH 4NIXA 4AOQA 2VH0A 4CRFA 1V2WT 1YCPK 4Q80A 1GI4A 3GCTG 1DE7H 3UR6A 1TBQH 1QJ7B 3SI4H 1A0JA 1O2JA 3A7XA 1C9TA 5CE1A 1O32A 4Q7ZA 3UNQA 4KTCA 4ZHLU 2YNBA 2B9LA 4GSOA 5A8XA 4K69A 2AGEX 1V2ST 3OYPA 2H9HA 1SGIB 1V6DA 3P8GA 1DITH 1MD8A 3BTTE 2OC7A 1UTLM 2C8YB 3A8BA 2C90B 5EOKA 1FIZA 1S85A 2ANMH 2FI4E 1NC6A 2H1UA 2ZDVH 2VU8E 2A7HA 1Y59T 5EPYA 1BTZA 2FXRA 1OP2A 4BAQB 3RP2A 1OX1A 1CA0C 2HWLB 5GJ4B 3BEIB 4ISNA 1QY6A 4IN2A 1QB9A 1SQTA 3IG6B 1A0HB 2BHGA 3W94A 3P70B 1BTHH 3R0FA 1ZPBA 4K3JA 4O3UA 1O30A 1TBZH 2ZFTA 1O2NA 1CU1A 5FPTA 1XX9A 3ZZ6A 4KP0A 3ZZBA 1RS0A 1XUJA 5EU8A 2XBYA 2G4TA 2SGPE 1NFWA 1TNKA 1UTJA 4YLUA 1FZZA 1D6RA 4YOGA 1V3XA 3TK5A 1P2MA 1ZHMA 1C1TA 1GDNA 2CXVA 2VIWA 3WY8A 4A1XA 2I6QA 1BRAA 1W13U 3E0PB 3SJ9A 3BEUA 5CHAB 3GY8A 1YF4A 2WV4A 3RXOA 1P09A 1LVYA 2XBVA 1ELCA 4X0WU 2C4FH 1ELTA 1TX8A 1OKXA 4IMQA 2AEIH 2A1DB 1C1UH 1E35B 3M5LA 1AIXH 4AG2A 3UIRA 3H7TA 1OWKA 3PMHB 1SLXB 1TQ7B 4AFZA 1KXFA 1DUEA 5E8EH 2GKVE 2FESH 1C1QA 4X1SU 2VH6A 3TH2H 1ZLRA 1ZPCA 4TPIZ 5EQQA 5A2MH 3H7OA 3QO6A 1LQDB 2I6SA 1UCYK 2WV5A 2UUKB 1AI8H 1ZRBA 2EA3A 2OQ5A 4MG3A 4WMFA 1HNEE 3R3GB 1HAGE 2BY5X 2ZECA 3M5NA 1ESAA 1P57B 1GJ4H 1ETRH 2FI5E 2QXJA 3A7YA 3DHKH 3URCA 1J16A 1UK3A 4OS6A 3UOPA 3SUGA 1JOUB 3W95A 1SQAA 2Z3EA 3LC3A 3VB4A 2FZZA 2ODQA 2BTCE 5C5NA 3A7WA 1C1WH 5DP5A 9ESTA 1PPZA 1JRSA 4JZIA 1BA8B 1V2UT 1KLIH 3B8JA 1NRRH 1OWJA 1UVPA 3EE0B 5FBIA 1C5RA 3SU5A 4NCYA 3SI3H 3M3TA 2GV6A 2J4IA 3MYWA 3RXDA 2Y7ZA 2B0FA 3PWBA 3DFJA 4ABJA 5JBBS 1XUKA 1TIOA 1GMHG 1K1NA 2P93A 1TA2A 2QN5T 2W26A 3M3VA 2ZCHP 3QTVH 1ZGVA 2XC4A 1AB9B 1LHGH 3O8RA 2F9OA 4F49A 1ZSLA 1V2RT 1BT7A 1WTHD 1AB9C 2PUXB 3LDXH 4MDSA 2BQWB 3GY7A 3S69A 1AN1E 5FHTA 4A6LA 1N8OB 1QR3E 2RDLA 2P3FH 1J17T 3FZZA 3MU5A 1WV7H 4A5TS 4H6SB 1KTSB 1N8OC 2XNIA 2BDGA 1YC0A 2IOTA 5AHGH 1O2IA 3M3SA 2AS9A 1SQOA 5GWZA 3SU6A 4B1TA 3HKJB 1V2VT 4AFUA 1DOJA 2R9PA 2Z7FE 4UE7H 2UWPA 7ESTE 1C1PA 4GAWA 3HK3B 1C2KA 4AX9H 1A3EH 3K2UA 4B2CA 1YBWA 3LGTA 3BIVH 3ZZAA 2GV7A 4DURA 1HJ9A 1CGIE 1MKWH 3K6YA 1FI8A 3OSYA 4AZ2B 5PTPA 2FS9A 2R3YA 2GT8A 1O3EA 2ZU2A 4BAKB 2QYIA 1A5IA 3GY2A 2FOBA 1O5AB 3QTOH 2F9NA 3E1XB 2NWNA 2FYQA 2A31A 4AFQA 3EA7A 4NIYA 2SFAA 1P06A 4UFGH 2ANKH 1SGEE 1TRNA 2OBQA 1LVMA 1C4Y2 2ZQ1A 1F0RA 3TPIZ 3MNXA 1LMWB 2ZNKH 5DP6A 5CMXH 2J9NA 5FCKA 4D7GA 1EOJA 2P3UB 2CV3A 5BPEA 1O34A 1SGPE 2GTBA 2AYWA 4NGAH 7LPRA 1WQSA 2OD3B 2H5CA 1HDTH 3C1KA 2XCNA 4BTTB 1KY9A 3TK9A 4YLQH 1GBHA 2ZHQH 2WPMS 1GL1A 2W5EA 3NWUA 2OC1A 1LHDH 3VPKA 1ANDA 2VVVA 4HTCH 3LIWA 1D3QB 1F5RA 1KYNA 2BOKA 1ESTA 1SGQE 3KGPA 3BEFB 1LPGB 1EZXC 3M35A 3ZZ4A 2XCFA 1P9SA 1UTKA 1GJ8B 1P9UA 4Y10E 2C93B 2HLCA 5B6OA 1BMMH 1FLEE 2R0KA 2ZF0H 2VGCB 3O8DA 2B5TB 3AW1A 1NU9A 3MWIU 2ZHEH 1CSOE 1SGFA 3U8RH 4MVNA 4HZHA 2G81E 1MQ5A 2FYRA 1G32B 3D49H 2GZ8A 1MAXA 1IOEA 3F9FA 3BTQE 4D9QA 2F9BH 2D8WA 1D9IA 3BSQA 1G36A 1O2RA 1HXEH 1O5EH 2WYJA 3BTGE 1FXYA 1O3GA 1VJ9U 1O3AA 1DFPA 3A83A 1TONA 2BZAA 1EB2A 3HPTB 1OYQA 1F0TA 3UQOA 1DWDH 2CGAA 3HK6B 1K1OA 1O3LA 3RXVA 2PTCE 4B74A 1BITA 1NU7B 1TNLA 3PTBA 1RGQA 3LOXA 1GBEA 1YPMH 1TFXA 1RXPA 1K28D 2G4UA 2VINA 1L0ZA 4Y8XA 3BF6H 2NU0E 4I8HA 4DGJA 1T7CA 1S5SA 5DP4A 1WCZA 1N6XA 3UTUH 3I78A 2SNVA 4X2WA 4DIIH 1O3MA 4INLA 1Y3VA 1TPOA 4X8SH 3RU4D 1WTGH 1O3JA 3KL6A 1GJDB 1THPB 1LVBA 1L1JA 3E3TA 1C2GA 3Q3KA 1GBFA 3M5OA 5HXFA 1DLEA 1HJ8A 2FIRH 2J95A 3A8DA 4X2VA 4B2BA 2ZGCA 4NIVA 1HAVB 1ZJKA 4R8TB 2GCHG 3RXSA 1VZQH 1HAOH 3IITA 4UFEH 3TU7H 2TBSA 1TLDA 2OLGA 2ZU3A 1VGCB 1MQ6A 2GGVB 2GMTB 1IQHA 1NPMA 1E37B 1O2YA 1E36B 1GBDA 2CN0H 3KEEA 1O31A 2HPQH 1VGCC 1TRMA 1AD8H 1VITH 2G55A 4K8YA 1KTTB 1W0YH 1HBTH 2BD7A 1Z8JB 1MKXK 1KXDA 3D65E 1D3PB 3M5MA 3SV6A 1KLTA 3A7ZA 5JB8S 2XW9A 1LQEA 1EAIA 5FPSA 4I8JA 3S9AA 3VB7A 4BAOB 3LJJA 2A32A 4Y11E 2ZDNA 1EOLA 4FUFA 1FY1A 1QL9A 2H9TH 3LGWA 1FAXA 1GI1A 1JIMA 3RXLA 1DY9A 1RJXB 2BDAA 4VGCC 3U8OH 3T27A 3OY5U 4DJZB 1VCQA 1QIXB 2GX4A 2BD8A 1P0SH 1C2LA 2SGDE 3ATMA 4CRCA 4Y6DA 1F0SA 1O3BA 1FY3A 2NU3E 2Y5HA 2G51A 2ZU5A 3FP8E 3QGJA 2XC0A 1BBRH 2M5TA 3CS0A 1Y3YA 1O3OA 4IBLH 4RKJB 4D8NA 2PLXA 4FUGA 4ASHA 2STBE 2R2MB 1OWIA 3FZDA 3BIUH 1C1VH 5JYIA 1GJ5H 2IN2A 3TK6A 2O8LA 2NU4E 1AWFH 2ZDLA 1O5GH 5J4SA 1MU8B 2LPRA 1EJNA 1QQ4A 4TY7A 4JYVH 4I8LA 1RIWB 2CJIA 1QBOA 3MU8A 5F8ZA 1C1OA 4MNVA 1RIWC 8ESTE 1Z1IA 1AQ7A 3T62A 3Q3YA 1S0QA 3SQEE 2O8WA 2P59A 3E0NB 3SNAA 3PO1C 3UWJH 4A1VA 3SU0A 2UWOA 3PV4A 2P95A 1B7XB 1MTWA 3ZVEA 6GCHG 1C5UA 1MZDA 4NG9H 3E8LA 3SNBA 4CH8B 1DT2A 1ETTH 1B5GH 4K8BA 1SGDE 2PKSB 4JZDH 2FTLE 1FQ3A 3BG8A 2PKSC 1INCA 1ELDE 1J14A 1ANEA 2BLWA 4ZXXH 3RUOA 1LVOA 4AYVB 1AE8H 1T31A 3V3MA 1PPCE 1ZMLA 1T4VH 2ODPA 4AN7A 3B9FH 1FN6A 4ZKRU 1P2JA 1IHTH 3GY5A 3PMBB 5T6DA 3GCHB 3SV9A 1QTFA 4X6OA 1C5ZB 4DOQA 3M7QA 1C5WB 3GCHC 1AHTH 3A89A 3TLOA 1PYTC 1PFXC 2JETB 5EXLA 2HNTC 5JBCS 2F9VA 5DKMA 1YM0A 2QXIA 9LPRA 1G37A 1Z6JH 1NFYA 1LHEH 2Z9GA 3F6UH 2ZHWH 2AGGX 1TOMH 3QX5H 1W12U 5SGAE 5EQSA 1AFEH 1BB0B 1CO7E 4OS7A 3VXEH 1CE5A 1F92A 4X8VH 1H9LB 5T6GA 4JZEH 2PGBB 1ZGIA 4FUDA 2BOHB 5DO4H 1FMGA 1SC8U 2PTNA 2JH0D 5E0GA 2ZC9H 3ATWA 1FJSA 3ATLA 4INHA 2ANWA 2XBXA 5DK1A 6GCHF 4LOYH 2TRMA 2J92A 1DS2E 2GZ9A 4R0IA 3FAOA 3ODFA 3UWIA 1W8BH 1ANCA 3A80A 1CGJE 2G52A 5A0BA 3C27B 1BQYA 2VIQA 4AB8A 1A1RA 2A5AA 3U1IB 3ELAH 1A5GH 1HAVA 3CS7A 1EJMA 1GVZA 1OSSA 2UUYA 1HXFH 5EODA 3GDVA 1TX6A 5I25A 3ZV9A 1TPSA 1O2GH 3RDZA 5F6MA 1AUTC 3GCOA 1P11E 2AIQA 4CRBA 1BHXB 2ZHDA 2A4OA 2YOLA 1MUEB 5LPEA 2ZKSA 1HAZB 1FN8A 2STAE 2PKAB 1O2SA 8LPRA 3RXTA 2Q1JA 1BTXA 3RXEA 3RXUA 3BV9B 4WXIA 4TWYA 5AFYH 1GHAF 1TOCB 3A7VA 4MNXA 4K1EA 1FIWA 2AFQB 4FU8A 1BZXE 3BTWE 1S6FA 1CVWH 1TGTA 1F2SE 1BUIA 1P03A 1QRZA 1K22H 1NESE 1C5TA 2XYAA 2DE9A 3MO6A 1XVMA 4NIWA 3U1JB 2QXHA 4ABGA 2QXGA 3AASA 5TCCA 1IAUA 1DLKB 1JXPA 4Y71A 2C8WB 1P05A 1QJ1B 2VWOA 2D2DA 5AVDA 5C3NA 2BVXH 5CHAC 3LJOA 1O2VA 1PQ5A 4QT8C 3GY6A 3D23A 3M7UA 3SU1A 2A7CA 1SOTA 4I7YH 2Z6BD 3S7KB 3GICB 5C2ZA 1BRCE 3S7HB 3ZZ5A 1EP6A 1SG8B 2WYGA 1TALA 1AWHB 3OX7U 2PFEA 3LKWA 2PGQB 3M61U 4X8UH 1UTMA 1UHBB 4U01A 3ZZ3A 4IW4E 3GDSA 3LU9B 4OS5A 3MMGA 1XMNB 4WWYA 1JMOH 4NA7A 4K5ZA 3GISB 1PPFE 3MU0A 1ZYOA 2OC8A 2VIVA 3MI4A 4JYTA 1NRQH 4A92A 1TWXB 4WH6A 3RXMA 5L2ZH 2FOFA 1ORFA 3MO3A 4X2XA 4XBBA 2PW8H 2BD5A 2HRVA 1EQ9A 3VEQB 2WPKS 1CHOF 3A7TA 2QV1A 3KQEA 2Z9JA 4ISOA 2QCYA 2BMGB 2QC2A 4JZFH 1QRWA 4I33A 1WQVH 8GCHF 4K2YA 2VVUA 4DY7B 4YT6H 4CHAB 4MPXA 1V2QT 1C2IA 2Y5GA 1FDPA 1O3PB 2FX6A 1SL3A 3UNRA 2GDEH 2ZFQH 3PLPA 1EAUA 1GDQA 3TGIE 1ZTKA 2O8UA 1MTSA 2SGEE 2H6MA 1P12E 2OTVA 5EQRA 3PB1E 2VWMA 5A0AE 5DG6A 2A7JA 4A7IB 2A4GA 1Q2WA 3PM3A 2UUJB 5C20A 2QA9E 3SU3A 1YPHC 1LO6A 1GJAB 5A09A 3SHAH 1BTUA 1H4WA 5EPNA 1GPZA 3ZYEA 7GCHF 1O3NA 1NTPA 1UVTH 2AMPA 3SGBE 3BTHE 1SLUB 4MQAA 2PV9B 1NO9H 2FOCA 2ANYA 3SW2B 2OP9A 1V2TT 4CRAA 1FV9A 2ZIQH 3SGAE 1KDQB 1GBIA 4X2YA 5DP8A 3SN8A 2UUFB 4OGYA 2AERH 1A2CH 2A2XH 4Y8YA 3RXQA 3EA8A 1SMFE 3RXIA 2ILNA 1EAWA 2BD2A 1CT4E 1NROH 1K1LA 1K1MA 1A0LA 2ZFRH 1XVOA 4NZLA 4H6TA 1W10U 3K6ZA 1ABJH 2ESTE 3EGKH 3L33A 1GGDB 3MH4A 3KQCA 1GI5A 1N6YA 3NCLA 1QB1A 3D62A 3RXFA 1GI8B 2Y80A 1MKWK 1Y8TA 1G3CA 2AH4X 2W7UA 1GHXH 2GD4B 4ISHH 4KGAA 2AIPA 4J2YB 2AGIX 1THRH 5C67A 1L1GA 3RM2H 1H8DH 2DUCA 3MH7A 2IPHA 4I32A 1QCPA 8KME2 1K1IA 1G30B 2OCVB 4ABEA 1S0RA 1OP8A 5JB9S 1W3CA 2K1QA 4OS4A 1GDUA 1XXDA 3SU4A 3ESTA 1SI5H 2J2UA 4CRDA 1GMDF 2P94A 3LGUA 1O2HA 1C5PA 1EXFA 1S6HA 3PLKA 5ABWA 2O8MA 3VB5A 1Z8RA 2VIOA 1YPGH 4Q7XA 2ALVA 3GYMA 5GIBA 6LPRA 3MO9A 1C5OH 1PJPA 4CREA 2ZHFH 2PKAA 3SHCH 3MTYA 4UFFH 2XBWA 3TJVA
chains in the Genus database with same CATH superfamily
4BANB 5L30H 1O2QA 2HNTE 1EP5A 1TX7A 1FY4A 1Z1JA 2FS8A 2V0BA 3DD2H 5JBTA 3P17H 3RXPA 3ZVFA 4ABAA 2B7DH 2CF9H 3SNCA 3S9BA 1TNGA 3MNCA 1KXAA 5F03A 1N1LA 4XBDA 1YKTA 3GV4A 2QGRA 5H1UA 1QL8A 4TSFD 1SOZA 1KLJH 3QK1A 2NU2E 4UP0A 1LTOA 4JMYA 3SUBA 4LADB 1V2OT 2KWJA 1RTKA 2VGCC 3G01A 3SHBA 1G2MA 3TJUA 1Z8GA 2ZTYA 3FANA 4E06H 3E6PH 3DSPA 1EJAA 2V6NA 1F7ZA 1BBRE 5ETXA 1XXFA 4IGDA 4AGJA 4IS5A 4WXVA 4R8PK 5DINA 3U9AH 4YBTA 2BDHA 1QURH 1HAXB 2PP6A 3F9GA 3U8TH 4FU9A 1E34B 2THFB 1ESBA 1A7SA 1FY8E 2A0QB 4O03A 4MPUA 1EZUC 5E2OA 3QLPH 1QGFA 3MHWU 3A8AA 1UHBA 5DSFA 3A86A 1O39A 3JZ2B 4B75A 1PQ7A 2ZWLH 1IQEA 1RD3B 4NWKA 4DVAU 1OS8A 1DX5M 5GPIB 2KAIB 1IQGA 3LQIA 4AP4A 1CBWB 3RXHA 1T8OA 1WOFA 5J4QA 1CBWC 1QQUA 1IQJA 1ZHPA 2V3MA 3CENA 4HFPB 2C2VS 1HAIH 1IHSH 1ZJDA 1K1PA 4NWLA 1A61H 3B23B 1V2KT 2FMJA 3ZPV1 3KF2A 4WH8A 2KR7A 2CRRA 3MU4A 1NM6A 3PMJA 3RXCA 4LZ4B 1L4ZA 5FCRA 4O64A 4AORA 1UK4A 2PSYA 3OY6U 2ZGJA 3PV5A 1SGRE 3PTNA 1VCPA 1ZOMA 2GP9B 1LKAA 1TB6H 5FB1A 2WINI 4IMZA 2OUAA 3GCNA 4Y7AA 5L6NH 1ELAA 1SPJA 2FLRH 1ELEE 1AZZA 2GMTC 4YBSA 1AU8A 1ELFA 2R3UA 2QF3A 1DUAA 1SGTA 4B71A 1SSXA 1W2KH 1QHRB 1A4WH 1MTVA 1C1SA 2TGPZ 3HGNA 3RXGA 1LHCH 3LRQA 4XSKU 2BLQA 4YM9A 1FONA 3SJ8A 4ZH8A 2FOGA 2VWLA 2FEQH 1HRTH 1O3HA 2EA6A 3MOCA 1J15A 1L1NA 1O2XA 1GHWH 2B0OE 4ABDA 1ZHRA 1ZSJA 2SGAA 3EB6A 3RXBA 5LPFA 3NK8A 2YUCA 5JBAS 3KN2A 1EAXA 2BX4A 1GL0E 2JMIA 3RLWH 1KDQA 1Y5BT 1XM1A 1GI7B 5HGGA 3SO3A 4I86A 3TGKE 1O36A 3UY9A 2ZG0H 4TPYA 2A5KA 4O9VA 1G3BA 1L2EA 1SFQB 2YMSB 1GBLA 1FX0B 2BAYA 3MFJA 5B75A 3V13A 2YMSC 3Q3XA 4UD9H 2BQ6B 1F5LA 3MU1A 1GVLA 3M37A 1VYXA 2FX4A 3IHPA 4E7NA 4A1TA 1O3FA 1WEPA 1W0JD 2QAAA 5DP7A 1TE0A 2V35A 2FO9A 1C2JA 2PR3A 2ZTXA 4M7GA 4ZUHA 1ZSKA 1F0UA 2JM3A 1BBRK 2BZ6H 1MTNB 4NA9H 1DCQA 3H5CB 2C8XB 4XFQA 2V3HH 2Q6DA 3L6PA 1W14U 3T29A 3PLBA 1XUIA 5HKKD 2LDRA 4INKA 2JJ2D 4FUJA 3O70A 1C2HA 2QE7D 1BCUH 1HLTH 3ZYQA 3SNEA 4K60A 1QA0A 2MA5A 3S9CA 1P02A 3RXRA 1UJ1A 1G3EA 5E2PA 1O2UA 4K1SA 1IQLA 1MMJN 1E0FD 1MCTA 5I3LA 3QGNB 5LPRA 4SGBE 3TIUA 2ZI2H 2ZPRA 2F6JA 4S3OC 5A8ZA 4FJCA 1C5XB 5EG4A 1VITG 4JK6A 2YVRA 2KWKA 2Y7XA 2Z9IA 2BDYA 4OS2A 3AVZA 5IYTA 3UQVA 4I7CA 3ZVDA 2BD9A 3M62A 2ZETC 2PUQH 2OXSA 2H2ZA 1JWTA 3OTJE 1IQMA 3I77A 2KWOA 1SFIA 4ABFA 5G04B 4LLBA 5FX5A 3SJIA 3SV7A 5GNDA 2VIPA 2BQ7B 5E0HA 4NA8A 1Z7KA 4TY6A 3HKIB 4XBCA 2KZ4A 1DY8A 4WJG2 2H5DA 3F2FA 1SGYE 1THSH 5G4BA 1B0FA 1B0EA 1V2MT 4XDEA 3EA9A 5EJLA 2XWAA 2DJAA 1GHYH 4ZKOU 4HGCA 1T8LA 4WF8A 2OQUA 1O3KA 4YESB 2Y82A 2F3CE 1GBBA 3LGYA 1C5YB 2RFKC 1ABIH 2Q6FA 4JYUH 1MCVA 1Y5UT 1WU1A 3ATKA 5LGOA 3P8FA 3PROA 1MM3A 3SBKA 2TGAA 4HG6A 3BTDE 2VJ1A 2ZCLP 2W3KA 2LELA 3GY4A 3Q77A 4ISLA 1QFKH 1ZTLA 1HAYB 1XUFA 3P6ZB 2ECGA 1O2PA 2RDEA 4TWWA 1K2I1 3T25A 3SUDA 1ZPZA 3UNSA 1QA7A 1MM2A 3AAVA 3SJKA 2JETC 4BTUB 2MT5A 4YOJA 4A4BA 1LPZB 1MTUA 4C9ZA 1GBAA 3MNBA 4NFEA 2WUCA 2CHAB 5CDFE 2BYAX 3F9EA 4FUIA 2HYED 3BTEE 4RSPA 1U6QA 4TKPB 1DWBH 3ATIA 4H42U 5EW1H 2BD4A 4AB9A 3HGPA 5BRRE 4WA6A 2ZQ2A 1GHAG 1T8MA 1GCDA 1C2MA 3QWCH 5T3HA 1VITF 3LT3A 3DCLA 3U5PA 2YSJA 1FAKH 1RMDA 1KXEA 4GNDA 2WZQA 2ZGBH 2HOBA 3F9HA 2KAIA 4JK5A 1P10A 5EJZA 3DFLA 1C5SA 2HNTF 3RMLH 2L74A 2G8TA 4GPGA 3MH6A 3PV2A 1S82A 1HYLA 2R2WU 4KTUA 2CSZA 2K1JA 4P00A 3VB6A 4OGCA 3TH3H 1GHBG 1KMHB 1XUGA 4RKOB 2GCTB 4ZXYH 3SUEA 2K17A 3NPSA 1GCTB 1DM4B 5B77A 1YCPH 2OBOA 3PHDA 1JBUH 4NZQA 3UR9A 2QIQA 1TBRH 1Z71A 3TVJB 3ZVGA 2A2QH 4OS1A 2BX3A 5HMAA 1YY3A 1TMBH 5JDUB 3LH1A 2HALA 1ARCA 2Y6TA 1S6LA 2IDAA 3NXPA 1S81A 2VB0A 2MUMA 1Q31A 2Z9LA 2EI7A 2RCEA 1U6GB 1DXWA 4X1RU 2XXLA 3P95A 3ODDA 1EX3A 1SGFG 3E91A 4ISIH 1UO6A 5C0TA 4L7XA 4IN1A 4FXGH 1VR1H 2XOZA 1H9HE 2E6SA 1GHZA 3A87A 2VPBA 2VBCA 1P2QA 1YPKH 1TABE 3SV2H 4XE4A 1O5DH 4O3TA 4UONA 1HFDA 4RT1A 3NZIA 3RLYH 2J94A 2ULLA 4M9FA 4LZ1H 1NS3A 3VB3A 1S83A 2KKYA 3ZZCA 4Y8ZA 1ZBDB 3SNDA 4ZHAA 5EW2H 1AKSB 3HATH 1DPOA 2EI8A 4I8KA 1IYMA 2XB1A 3RPGB 1QRXA 1Y3XA 5JPMH 5A0CA 1CA0B 4A49A 3ZZ7A 1YLDA 1F5KU 1GG6B 1CHOG 1P3CA 4X6MA 4GHQA 3TITA 5GCHF 4GUXA 1O35A 1GG6C 1BHXF 1HAHH 1SHYA 5TRBA 8GCHG 3GYLB 2YHOA 3W1EA 2XWBI 3I29A 1TNHA 1DWCH 2O9QA 1ZZZA 3ZVBA 5DP3A 1GHBF 3SUFA 1K9OE 4X1QU 3SOWA 1ELGA 1YPJH 2FDAA 3U28C 3LGVA 5EXMA 5DP9A 1CT0E 3O8BA 3U5NA 3GS9A 4AFSA 1PQAA 1KSNA 1CT2E 2A4QA 2BLOA 4TYDA 3V12A 2XC5A 2LNCA 1WAYB 3ENSB 2ZFPH 1MBMA 3GCTF 1E1QD 2YNAA 4ABBA 2G43A 3GOVB 1TGNA 4F4OC 2XTTB 4AG1A 7GCHG 4ABHA 2JKHA 2FI3E 2F83A 1PPEE 3TH4H 5FERA 1C5QA 3RXKA 5FPYA 4L58A 7KMEH 5B78A 1X4IA 2HPPH 4PTBA 1ELBA 5EXNA 4MVTA 2HVXA 3BTFE 4BXWA 4YC9A 3BN9A 4ZROA 1UVUH 4LK4A 2C8ZB 3T2NA 2LP6A 1Z6EA 1OXGA 4Z6AH 1WIMA 1ZMJA 1L4DA 3GDUA 1EUFA 1NRSH 1XKAC 4PROA 3RMNH 1NN6A 1GI0A 1EASA 4E7RG 1UCYH 4NSVA 2L5UA 3NRLA 3N99A 1WUNH 1AO5A 1OWEA 2FOMB 4FOUC 2A45B 1AVWA 4ZHMU 1QNJA 3SZNA 2QF0A 2FM2A 2K0QA 4U32A 4D76A 4YT7H 2FUIA 5FBEA 1GI6A 5DN6D 4AUQB 2W7SA 1H8ED 3ZYDA 3U5MA 2NU1E 2WPHS 1SB1H 4BAMB 2MNYA 1BMNH 5A8YA 1GBMA 1EATA 1H1BA 2PUYA 4J1YA 3DDTA 1HGTH 4GB0A 2J98A 4CHAC 1D3TB 2Z9KA 4DG4A 4YTAA 5IDKA 5ESBA 2G45A 2BXTH 4WZ2A 2BY6X 1VCWA 1TMUH 5KH9A 5G0FA 5SVIA 2ZEBA 3LH3A 2L0BA 2M3HA 4MPWA 3ZZ8A 1O3DA 4X6PA 2VJEA 4LKAA 2BB4A 1YYY1 4AVXA 4Q2KA 4FUBA 2ZO3H 4CH2B 2ZCKP 3A81A 2XOKD 3RXAA 1GMDG 1S84A 5K0HA 1BOQA 1O38A 4FVDA 3STJA 3V0XA 3KHVA 1IQKA 3KCGH 1A46H 1TA6A 1O2MA 2P16A 4I8GA 4O97A 1WXRA 1WBGB 1NY22 3N7OA 1P01A 3ZIAD 5EJ1A 3QDZB 1C4U2 4THNH 3C6WA 1YP9A 5FX6A 3P8NA 5B6LA 1SLWB 4DIHH 3P92A 2M6MA 1BTYA 1MD7A 1T32A 4GHTA 3AK5A 2G00A 1GI2A 2ZFFH 3LPRA 1TNIA 4DCDA 2QIZA 2YREA 4MTBA 3RMOH 1O3CA 4MNWA 1UMAH 3ZZDA 1PYTD 3N9LA 5LKZA 2CF8H 2Z94A 2GT7A 1GI9B 5F8TA 3QN7A 2JMDA 3OU0A 1EZQA 4JZ1A 3JZ1B 1EPTB 1MAYA 2XRCA 1UTQA 3A85A 2Y81A 1DVAH 2GVFA 1ZR0A 3GY3A 1EPTC 1C2DA 1AE5A 4DT4A 2BY7X 2F9UA 1GGDC 3K65B 2F91A 1UW7A 1KXBA 3L3TA 2FWWA 3UREA 1HPGA 2IJOB 3PYHA 4B73A 2Y1NA 5FAHA 2ZGXH 1OPHB 1YPEH 1GVKB 2R0LA 1TRYA 1NRNH 3DA9B 4FU7A 5DGJA 4ZKSU 3T26A 3O7AA 3OTPA 1MU6B 1O2LA 3EQ0H 3U69H 2D1JA 4X1NU 4FUEA 5H1TA 4E05H 1MH0A 1GMCG 2ZFSA 3A82A 2IPQX 1PPHE 1NFXA 2A4RA 4OGXA 1FY5A 1F62A 1CHGA 1AMHA 1OP0A 1C1RA 2MD7B 6ESTA 1O0DH 2UZGA 4AGKA 2PHBA 2MNZA 2JH5D 3O8CA 1SVPA 2MIQA 4GVUA 1DSUA 1GJ6A 3RXJA 3M99A 4KELA 1ELVA 5TJXA 2IJD1 1TGCA 3ZVCA 1X7AC 2NAAA 3SOUA 1UVOA 1GMHF 2OWAA 3RMMH 3T5FH 1ID5H 1O5CB 1O2OA 4LJNA 4WMEA 2FOHA 3RC4A 1P2KA 1AKSA 1UTNA 3L1ZB 1HIAB 2RSDA 1JRTA 2KFWA 4UEHH 3F68H 2QF4A 5L2YH 2ZZUH 4WZ0A 4V3LC 2WPDD 3KYFA 3MNSA 1ZMNA 2H9EH 3URDA 2BD3A 3DUXH 2VJFB 4O62A 1ETSH 1V2NT 1WEUA 1QBNA 2TPIZ 2EC9H 2PSXA 3A8CA 3UFAA 2A5IA 1GBTA 2AMDA 1LDTT 4YADA 3SU2A 1HCGA 2KE1A 2LXHC 1YLCA 4GCHG 3LGIA 5KGOA 2CT2A 3EAJA 3QZRA 1O5BB 2HDPA 1NRPH 1J8AA 1TGBA 1TPAE 1UK2A 4X6NA 2ASUB 4Z1MD 2FUUA 1A5HA 2FODA 3NKKA 3K9XB 1SKYE 2ZDMA 3V7TA 1D4PB 1DXPA 2DE8A 3FP7E 3KV5A 4UP5A 2BVSH 2WSSD 2VWNA 2P3TB 2FP7B 3N7EA 3A88A 1Q3XA 2QY0B 1C5LH 5C5OA 2BDBA 4RN6A 2WUBA 4XD7D 2TIOA 1O2KA 2TGTA 2ZPSA 3E90B 4AC9A 3SGQE 1GMCF 3LJUX 4X1PU 4LXBH 3WW7A 1HJAB 4Y76A 1C5VA 2FSAA 3KQBA 1COWD 1G3DA 1HJAC 4Y0ZE 4CRGA 2FOEA 3MDBC 1SR5C 3KNXA 4Y79A 1UTPA 1P3EA 3VXFH 4YABA 3VG8A 2SGFE 4AYYB 2KKXA 1BJVA 1YPLH 1Z8IB 3TJNA 3VGCB 2G5NA 2RA0A 1IQNA 1YCPM 3A84A 5DJ7A 4ZQLA 3M36A 3VGCC 5HM9A 2EQNA 4P02A 1YGCH 2JH6D 1C1NA 3EYDA 3E16B 2O8TA 4H9DA 4YXWD 5HM2A 4Q4LA 2WPIS 2BY9X 3ITIA 4MLFB 2ZDAH 4BAHB 3CNRA 4KKDA 1AUJA 1OWHA 1P2OA 1DANH 3E2DA 2G5VA 2ZGHA 1O2ZA 3SOSA 1WFKA 1BIOA 1SLVB 4XOJA 3Q00A 5K7RA 1RTFB 1ANBA 6CHAB 3TNTA 2LAUA 1WSSH 6CHAC 2F9PA 1C2EA 4GCHF 5LH8A 2UWLA 1C9PA 1LKBA 5TCAA 3DT0H 1AVGH 1AFQB 1C4V2 1AGJA 2RI7A 3RM0H 3LVQE 1BMAA 1DICA 1GWAA 4UDWH 1AFQC 1MZAA 3GL6A 3M7TA 1QL7A 3CP7A 1TPPA 5LKUA 2BM2A 2PWXA 2KU3A 1V2JT 2Q6GA 4ZKNU 3TJOA 4Y0YE 3IWMA 1A3BH 4B2AA 2CKLB 3PWCA 1MKXH 4Q7YA 1P04A 5C1XA 2Z3DA 3F1SB 1RFNA 2KCOA 4FVBA 1XKBC 3UUZA 3HCUA 4R2YA 5AITA 4ZMAH 3O34A 2ZDKA 3FVFB 4NSYA 1DDJA 1O5FH 2GJGA 4Z0OA 1H8IH 4BTIB 1Y3WA 2ZP0H 5HYOA 1C5MD 3FP6E 3ZZ9A 1HV7A 1P8VC 2BXUH 1D6WA 3UPEA 1QBVH 1BRUP 3RU4T 3ASLA 5FXLA 2P8OB 1O2TA 1SBWA 3SV8A 2FD4A 3TGJE 3DSGA 1WEQA 1O37A 1PPBH 1HAPH 2P8OC 2AMQA 2KREA 4U2WA 2VIDA 1Y3UA 4WVPE 1O33A 1BRBE 3UAIC 1C2FA 4I31A 5EGMA 3SORA 3RU4E 1GBJA 2YURA 3KIDU 2OK5A 4X8TH 4IC6A 4VGCB 1EPTA 2EI6A 2K4DA 4SGAE 4CR5A 4ABIA 1O3IA 3FFGA 3FJUB 1V2LT 1BDAA 1WYKA 4U30A 2H0DB 5H4IB 1OOKB 3SYJA 2SNWA 1NFUA 1G2LA 2VNTA 1HYIA 1VJAU 3PMAB 2BLVA 1GJ9B 3LQJA 5DPAA 4BXSA 1O2WA 4Y7BA 4OGEA 4H4FA 5K3QA 2D26C 2OC0A 3I2DA 1GBKA 3LC5A 1FUJA 2W3IA 5E0JA 2BDCA 2HGTH 3MHHA 1MTNC 1FNIA 1GBCA 1OWDA 3STIA 1C5NH 1Z60A 1M9UA 2GZ7A 1V2PT 2Z3CA 1ACBE 5GXPA 2L75A 1D3DB 1EZSC 2VVCA 3SJOA 4D7FA 1E38B 2QJ0A 3L1XA 1T4UH 4YO9A 1CA8B 2GCHF 2JMJA 1LHFH 4FUHA 1BTPA 3AW0A 4HI3A 2ECTA 4WY3A 1T8NA 1FBVA 1AY6H 4MPVA 4GNGA 1YPHE 1TGSZ 4WMDA 1TNJA 5ESTE 3PUQA 2RA3A 1AZ8A 2SGQE 1RRKA 2FOAA 5F8XA 2WPJS 1KIGH 3BG4B 2ODYB 1EKBB 3TNSA 2C3SA 2E61A 1G9IE 3BG4C 1OHHD 5EYAF 1W0ZU 1XUHA 5AFZH 2ZU1A 1NZQH 3P8OA 3AAUA 1SGNE 4BNRA 4CR9A 1AVXA 3U5OA 1HIAA 2GDDA 3FM8C 4KTSA 1RTLA 3PO1B 2ZU4A 1PPGE 4P5OB 1ZTJA 5KEDA 3LDYA 1BMLA 1GJBB 3KQDA 2Y5FA 3UOUA 1GI3A 2VJFA 3MH5A 1TAWA 3Q76A 2M1RA 1MBQA 1BTWA 3T28A 3RC5A 4NFFA 4DT7B 5AF9H 1CGHA 4MNYA 1J9CH 4YOIA 5HIYA 2ZPQA 5LKTA 5EIYA 1ARBA 3BTKE 5C1YA 1EB1H 2JRJA 5C13A 2RG3A 1ZRKA 1XWHA 1V87A 1E79D 1KXCA 2K16A 2EEKA 4CBOA 4DW2U 5DKAA 2CSVA 2ZA5A 4YZUA 1LCYA 1C1MA 2ZTZA 5GDSH 1GJCB 1W11U 2VPEA 3ZV8A 1SGCA 2V3OH 1TMTH 1Y5AT 1BJUA 3F3BA 2L6OA 1HUTH 1LPKB 4B76A 4GLYA 5I46H 2FLBH 1SHHB 1FPHH 3U98H 4D9RA 3ZVAA 2BVRH 4IC5A 2WPLS 2CHAC 4FUCA 1IQFA 5CHBA 4LK9A 1H9IE 1GJ7B 4K1TA 1W7GH 4JCNA 1CQQA 2BDIA 1DWEH 1SQRA 1HB0B 4ACBA 2FPZA 2FFWA 5T1VA 2KCPA 2OINA 4ZAEA 4ESTE 3N9NA 1K1JA 2BY8X 4Z0KA 1QJ6B 1W7XH 3NG2A 3LONA 3QZQA 2J34A 3C5KA 1PQ8A 1P2NA 3KNVA 1TQ0B 5GCHG 1YLNA 1OYTH 4BOHA 1DSTA 3F2GA 1VD4A 3EDXB 5T6FA 2J38A 2TGDA 2FTMA 4CBNA 2ALPA 1TYNA 1UTOA 2JJ1D 2LV9A 3NUMA 2XOYA 1K21H 1WENA 1UCYE 2CMYA 3VFEA 1QB6A 5C1UA 1NT1A 1P2IA 1IQIA 3SQHE 3RC6A 1GHVH 2GCTC 1JOCA 4ACAA 3QUMP 5TBNA 1GCTC 2B8OH 2JDID 4UFDH 3BTME 1JIRA 1UVSH 3S0NA 1FPCH 4NIXA 4AOQA 1LDJB 2VH0A 3FL2A 4CRFA 3ZNIA 1V2WT 1YCPK 4Q80A 1GI4A 2VPDA 3GCTG 1DE7H 3UR6A 1TBQH 1QJ7B 3SI4H 1A0JA 1O2JA 3A7XA 2EGMA 1QZ8A 1C9TA 5CE1A 1O32A 2KX4A 4Q7ZA 3UNQA 2VNFA 4KTCA 4ZHLU 2YNBA 3L11A 2B9LA 4GSOA 1BORA 5A8XA 4K69A 2AGEX 3VK6A 1V2ST 2CK3D 3OYPA 2H9HA 1SGIB 1V6DA 3P8GA 2C2LA 2F6NA 4UI9B 1DITH 1MD8A 3BTTE 4TT3D 2OC7A 1UTLM 2C8YB 3A8BA 2C90B 5EOKA 1FIZA 2W6JD 3O36A 1S85A 2ANMH 2FI4E 3O33A 3DWDA 1NC6A 2H1UA 2ZDVH 1WESA 3EE7A 2VU8E 2A7HA 1Y59T 3HCSA 5EPYA 1BTZA 2FXRA 1OP2A 4BAQB 3RP2A 3RPGC 1OX1A 1CA0C 2HWLB 5GJ4B 3BEIB 5TABA 4ISNA 1QY6A 2XEUA 2VPGA 4IN2A 1QB9A 1SQTA 3IG6B 1A0HB 3T6RA 2BHGA 3W94A 3P70B 1BTHH 3FN8A 3R0FA 2PNXA 1LDKC 1ZPBA 4K3JA 4O3UA 1O30A 1TBZH 2J5UA 2ZFTA 1O2NA 1CU1A 5FPTA 1XX9A 3ZZ6A 5SVXA 4KP0A 3ZZBA 1RS0A 1XUJA 5EU8A 2H0DA 2XBYA 2G4TA 2SGPE 1NFWA 1TNKA 1UTJA 4YLUA 1FZZA 3H7HA 1D6RA 4YOGA 1V3XA 3TK5A 1P2MA 1ZHMA 1C1TA 1GDNA 2CXVA 2VIWA 3WY8A 4A1XA 2I6QA 1BRAA 2RR4A 1W13U 3E0PB 3SJ9A 5C0UA 1EFRD 2YMSD 3BEUA 5CHAB 3GY8A 1YF4A 2WV4A 3RXOA 1P09A 1LVYA 2XBVA 1ELCA 4X0WU 2C4FH 1ELTA 1TX8A 1OKXA 4IMQA 2AEIH 2A1DB 2WV9A 1C1UH 1E35B 3M5LA 2EGPA 3HTKC 1AIXH 4AG2A 3UIRA 3H7TA 1OWKA 3PMHB 1SLXB 1TQ7B 3ZVZB 4AFZA 5LKXA 1KXFA 1DUEA 5E8EH 2HLDD 4GNFA 2GKVE 2FESH 1C1QA 2E6RA 2QF5A 4X1SU 2VH6A 3TH2H 4W4UA 1ZLRA 1ZPCA 2KR4A 5FEYA 3OAAD 4TPIZ 5EQQA 5A2MH 3H7OA 3QO6A 1LQDB 2I6SA 1UCYK 2WV5A 2UUKB 1AI8H 2LRIC 2KCAA 1ZRBA 2YHNA 2EODA 2EA3A 2OQ5A 4MG3A 4WMFA 2YT5A 3O47A 1HNEE 4QF2A 3R3GB 1HAGE 2BY5X 2ZECA 3M5NA 1ESAA 1P57B 1GJ4H 3OE7D 1ETRH 3DQVR 2FI5E 2QXJA 3A7YA 3DHKH 3URCA 1J16A 1UK3A 2I50A 4N3WA 2Y43A 4OS6A 4XRNA 3UOPA 3SUGA 1JOUB 1WEVA 3W95A 1SQAA 2Z3EA 5G05B 3LC3A 3VB4A 2FZZA 3FKSD 5C94A 2ODQA 2BTCE 5C5NA 3A7WA 1C1WH 5DP5A 9ESTA 1PPZA 1JRSA 4JZIA 1BA8B 1V2UT 2J97A 1KLIH 3B8JA 1NRRH 1OWJA 1UVPA 3EE0B 5FBIA 1C5RA 3SU5A 4NCYA 3SI3H 5FL7D 2M2AA 3M3TA 2GV6A 2J4IA 3MYWA 3RXDA 2Y7ZA 2B0FA 3PWBA 3DFJA 4ABJA 5JBBS 1XUKA 1NBME 1TIOA 1K2FA 1GMHG 1K1NA 2P93A 1TA2A 2QN5T 2W26A 3M3VA 2ZCHP 3QTVH 1ZGVA 4OM9A 2XC4A 1AB9B 1LHGH 3O8RA 2F9OA 3O35A 2F4LA 4F49A 1ZSLA 1V2RT 1BT7A 1WTHD 1AB9C 2PUXB 3N9MA 3LDXH 4MDSA 4YATA 2BQWB 3GY7A 3S69A 3Q1DA 1AN1E 4R7EA 5FHTA 4A6LA 1N8OB 1QR3E 2RDLA 2P3FH 1J17T 3FZZA 3MU5A 1WV7H 4A5TS 4H6SB 1KTSB 4NN2A 1N8OC 2XNIA 2BDGA 1YC0A 2IOTA 5AHGH 1O2IA 3M3SA 2AS9A 1SQOA 5GWZA 3SU6A 4B1TA 3HKJB 1V2VT 4AFUA 1DOJA 2R9PA 2Z7FE 4UE7H 2UWPA 7ESTE 1C1PA 4GAWA 3HK3B 1C2KA 4AX9H 1A3EH 3K2UA 4B2CA 1YBWA 4F48B 1Z2QA 5KH7A 3LGTA 3BIVH 3ZZAA 2GV7A 4DURA 5H9MA 2EXUA 1HJ9A 4B6FA 1CGIE 1MKWH 3K6YA 1FI8A 3OSYA 4AZ2B 5PTPA 2FS9A 2R3YA 2GT8A 1O3EA 2ZU2A 4BAKB 2QYIA 1A5IA 3GY2A 5KECA 2FOBA 1O5AB 3QTOH 2F9NA 3E1XB 2NWNA 2FYQA 2A31A 4AFQA 3EA7A 4NIYA 2SFAA 1P06A 4UFGH 2ANKH 4AYCB 1SGEE 1TRNA 2OBQA 3JUEA 1LVMA 1C4Y2 4Q63A 2ZQ1A 1F0RA 3TPIZ 3MNXA 1LMWB 3SZEA 2ZNKH 5DP6A 5CMXH 3V43A 2J9NA 5FCKA 2XNDD 4D7GA 3QZVA 1EOJA 4B86C 2P3UB 2CV3A 5BPEA 3MQKC 1O34A 1SGPE 2GTBA 2AYWA 4NGAH 1X4UA 7LPRA 1WQSA 2OD3B 2H5CA 1HDTH 3C1KA 2XCNA 4XI1A 4BTTB 1KY9A 3TK9A 4YLQH 1GBHA 2ZHQH 2WPMS 1GL1A 2W5EA 3NWUA 2OC1A 1LHDH 3VPKA 1ANDA 2VVVA 2P57A 4HTCH 3LIWA 1D3QB 1F5RA 1KYNA 2BOKA 5AIUA 1ESTA 1SGQE 3KGPA 3BEFB 1LPGB 3PRBA 1EZXC 3M35A 2MA6A 3OFND 3ZZ4A 2XCFA 1P9SA 1UTKA 1GJ8B 1P9UA 4Y10E 2C93B 2HLCA 5B6OA 1BMMH 1DVPA 4I7DA 1FLEE 2R0KA 5B79A 2ZF0H 2VGCB 3O8DA 2B5TB 3AW1A 1NU9A 3MWIU 2ZHEH 1CSOE 1SGFA 3U8RH 2LQ6A 4MVNA 4YAXA 5J3XA 4HZHA 2G81E 1MQ5A 2FYRA 1K0HA 4V3KC 1G32B 3D49H 2GZ8A 1MAXA 2KIZA 1IOEA 3F9FA 3BTQE 4D9QA 2F9BH 2D8WA 2D8SA 3KQIA 1D9IA 3BSQA 1G36A 1O2RA 1HXEH 1O5EH 2WYJA 3BTGE 1FXYA 1O3GA 1VJ9U 1O3AA 1DFPA 2OXQC 3A83A 3N9QA 1TONA 2BZAA 1EB2A 3HPTB 1OYQA 1N87A 1F0TA 3UQOA 1DWDH 2CGAA 3HK6B 1K1OA 1O3LA 2F42A 3RXVA 2PTCE 4B74A 2LXPC 3F0OA 1BITA 2JIZD 2HVYB 2IQJA 1NU7B 1TNLA 3PTBA 3M7KA 1RGQA 3LOXA 1GBEA 1YPMH 1TFXA 1RXPA 4CCGX 1K28D 2G4UA 2VINA 1L0ZA 4Y8XA 3BF6H 2NU0E 2W6ID 1WEEA 4I8HA 4DGJA 1T7CA 1S5SA 2YYRA 3ZPVE 5DP4A 1WCZA 4RT0A 1N6XA 3UTUH 3I78A 2SNVA 4X2WA 4DIIH 4N4FA 1O3MA 4INLA 1Y3VA 4PPEA 2L80A 1TPOA 4X8SH 3RU4D 1WTGH 1O3JA 2LGVA 3KL6A 1GJDB 1THPB 1LVBA 1L1JA 3E3TA 1C2GA 3RTRB 3Q3KA 1GBFA 3M5OA 5HXFA 3PURA 1DLEA 1HJ8A 2FIRH 2J95A 3A8DA 4X2VA 4FIPA 4B2BA 2ZGCA 4NIVA 1HAVB 1ZJKA 4R8TB 3SOXA 2GCHG 3RXSA 1VZQH 1HAOH 3IITA 1YWUA 4UFEH 3TU7H 2TBSA 1TLDA 2V7QD 2OLGA 5FB0A 2ZU3A 1VGCB 5C17A 1MQ6A 2GGVB 2GMTB 1IQHA 1NPMA 1E37B 2Y1MA 1O2YA 1E36B 1GBDA 2CN0H 3KEEA 1O31A 2HPQH 1VGCC 1TRMA 3LVRE 1AD8H 1VITH 2G55A 4K8YA 1KTTB 1W0YH 2LGGA 2LGLA 1HBTH 2BD7A 1Z8JB 1MKXK 1KXDA 3D65E 1D3PB 3M5MA 4RI0A 3SV6A 1KLTA 3A7ZA 5JB8S 2LGKA 2XW9A 1LQEA 1EAIA 5FPSA 4I8JA 3S9AA 3VB7A 2CONA 4BAOB 3LJJA 2A32A 4Y11E 2ZDNA 1EOLA 4FUFA 5TDWA 1FY1A 1QL9A 1WEOA 2H9TH 2EY4C 3DPLR 3LGWA 2L7PA 1FAXA 1GI1A 3F0PA 1JIMA 3RXLA 2ECJA 1X4JA 1DY9A 1RJXB 2BDAA 4VGCC 2ECIA 2L43A 3U8OH 3T27A 3OY5U 4DJZB 1VCQA 1QIXB 2GX4A 4GNEA 2BD8A 1P0SH 1C2LA 3N9OA 5SVYA 2SGDE 3ATMA 4CRCA 4Y6DA 1F0SA 1O3BA 1FY3A 2NU3E 2Y5HA 2G51A 2ZU5A 3FP8E 3QGJA 2XC0A 1BBRH 2M5TA 3KQ5A 3CS0A 1Y3YA 1O3OA 4IBLH 4RKJB 4D8NA 2PLXA 1MABB 4FUGA 2ECVA 4ASHA 2STBE 2MKEA 2R2MB 1OWIA 2K8IA 3FZDA 3BIUH 1C1VH 5JYIA 1GJ5H 2ECNA 3ZVYA 2IN2A 4I7BA 3TK6A 2O8LA 2NU4E 1AWFH 2ZDLA 1O5GH 5J4SA 4AYCA 1MU8B 2LPRA 1EJNA 2G6QA 1QQ4A 4TY7A 4JYVH 3FOAA 4I8LA 1RIWB 2CJIA 1QBOA 2KYUA 3MU8A 5F8ZA 1C1OA 4MNVA 1RIWC 8ESTE 4S3OB 1Z1IA 1FP0A 1AQ7A 3T62A 2AN6A 3Q3YA 1S0QA 3SQEE 2O8WA 2XOCA 2P59A 3E0NB 1CHCA 3SNAA 2YQLA 4F52B 3PO1C 3UWJH 4A1VA 3SU0A 2UWOA 3PV4A 2P95A 2YU4A 1B7XB 1MTWA 3ZVEA 6GCHG 1WEMA 2LN0A 2MD8C 1C5UA 1MZDA 4NG9H 3E8LA 3SNBA 1JM7B 1VKYA 4CH8B 1DT2A 1ETTH 1B5GH 4K8BA 5HIZA 3O37A 1SGDE 2PKSB 5JG6A 4JZDH 2FTLE 1FQ3A 3BG8A 2PKSC 5TDRA 1INCA 1ELDE 1J14A 1ANEA 2BLWA 4ZXXH 3RUOA 1LVOA 3PLWA 5KH3A 4AYVB 4FETA 1AE8H 2J98B 1T31A 3V3MA 1PPCE 1ZMLA 1T4VH 2ODPA 4AN7A 3B9FH 1FN6A 4ZKRU 4IC2A 5SVIB 1P2JA 2KCYA 4B7YC 1IHTH 3GY5A 5D1LB 5LCWB 2VJEB 3PMBB 4BBQA 5T6DA 3GCHB 3SV9A 1QTFA 4X6OA 1C5ZB 4DOQA 3M7QA 3T9KA 1C5WB 3GCHC 2JUNA 1AHTH 3A89A 3TLOA 3WWBA 2WHXA 1PYTC 2VP7A 1PFXC 2JETB 4FK5A 5EXLA 2HNTC 5JBCS 2F9VA 5DKMA 1YM0A 2QXIA 9LPRA 1G37A 1Z6JH 1NFYA 1LHEH 2Z9GA 3F6UH 2ZHWH 2AGGX 1TOMH 2D8UA 3QX5H 1W12U 5SGAE 5EQSA 4F55A 1AFEH 1BB0B 1CO7E 4OS7A 3WWFA 3VXEH 1CE5A 1F92A 4X8VH 1H9LB 5T6GA 1VFYA 4X3GA 4JZEH 2PGBB 1ZGIA 4FUDA 3UB0A 2BOHB 5DO4H 5C11A 1FMGA 3KV6A 1SC8U 1Z6UA 4ZUXU 2PTNA 2JH0D 5E0GA 2ZC9H 3ATWA 1FJSA 3ATLA 4INHA 2ANWA 2XBXA 5DK1A 6GCHF 4LOYH 2TRMA 2J92A 1DS2E 2GZ9A 4R0IA 3FAOA 3ODFA 3UWIA 1W8BH 1ANCA 3A80A 1CGJE 4ZCNA 2YSMA 2G52A 5A0BA 3C27B 1BQYA 2VIQA 4AB8A 1G25A 1A1RA 2A5AA 3U1IB 3ELAH 1A5GH 1HAVA 2ECWA 3CS7A 1EJMA 1GVZA 2CKLA 1OSSA 2UUYA 1HXFH 5EODA 3GDVA 1WEWA 1TX6A 5I25A 3ZV9A 1TPSA 1WILA 1O2GH 2DSMA 3RDZA 5F6MA 2YW8A 1AUTC 3GCOA 3FEHA 1P11E 2AIQA 4CRBA 2QICA 1BHXB 2ZHDA 2A4OA 2YOLA 1MUEB 5LPEA 2ZKSA 1HAZB 1FN8A 2STAE 4WZ3B 2PKAB 1O2SA 8LPRA 1E1RD 3RXTA 5B76A 2Q1JA 1BTXA 4CA1A 3RXEA 3RXUA 3BV9B 4ASUD 5B8DA 4WXIA 4TWYA 5AFYH 1GHAF 1TOCB 3A7VA 4MNXA 4K1EA 1FIWA 4ZDTA 2AFQB 4FU8A 1BZXE 1BMFD 3BTWE 1S6FA 1CVWH 1TGTA 1F2SE 1BUIA 1P03A 1QRZA 1K22H 1NESE 1C5TA 2XYAA 2DE9A 3T7LA 3MO6A 4B6EA 1XVMA 4NIWA 4YBMA 3U1JB 3HCTA 2QXHA 4F1PA 4ABGA 2QXGA 3AASA 3OEHD 5TCCA 1IAUA 1DLKB 1JXPA 4Y71A 1WDIA 2C8WB 1P05A 1QJ1B 2VWOA 3N7DA 2D2DA 5AVDA 5C3NA 2BVXH 3KYGA 5CHAC 2XP0A 3LJOA 1O2VA 1PQ5A 4QT8C 1WGMA 3GY6A 3D23A 3M7UA 3SU1A 2A7CA 1SOTA 4I7YH 3KDEC 2CSYA 2Z6BD 3S7KB 3GICB 5C2ZA 1BRCE 3S7HB 3ZZ5A 1EP6A 1SG8B 2WYGA 1TALA 1AWHB 3OX7U 2M85A 2PFEA 3LKWA 2PGQB 3M61U 4X8UH 1UTMA 1NBMD 5IK2D 1UHBB 4U01A 3ZZ3A 4IW4E 3GDSA 3LU9B 4QF3A 4OS5A 3MMGA 3H09A 1XMNB 4WWYA 4A4CA 2KM0A 1JMOH 4NA7A 3F2HA 4K5ZA 3GISB 1PPFE 3MU0A 1ZYOA 2OC8A 2VIVA 3MI4A 1WE9A 4JYTA 1NRQH 4A92A 1TWXB 4WH6A 3RXMA 5L2ZH 2FOFA 1ORFA 3MO3A 4X2XA 4XBBA 2PW8H 2BD5A 2HRVA 1EQ9A 2M13A 3VEQB 2KWNA 2WPKS 1CHOF 3A7TA 2QV1A 3KQEA 3N9PA 1JM7A 2Z9JA 4ISOA 2QCYA 2BMGB 2QC2A 4JZFH 1QRWA 4I33A 1WQVH 8GCHF 4FO9A 4K2YA 2VVUA 4DY7B 4YT6H 4CHAB 4MPXA 1V2QT 1C2IA 1T1HA 2Y5GA 1FDPA 1O3PB 2FX6A 1SL3A 3UNRA 2GDEH 2ZFQH 3PLPA 1EAUA 1GDQA 3TGIE 1ZTKA 2O8UA 1MTSA 2SGEE 2H6MA 1P12E 2OTVA 5EQRA 3MHSA 3PB1E 2DX8A 2VWMA 5A0AE 5DG6A 2A7JA 4A7IB 2A4GA 1Q2WA 3PM3A 2UUJB 3ZTGA 5C20A 2CRWA 2QA9E 3SU3A 1YPHC 1LO6A 1GJAB 5A09A 3SHAH 1BTUA 1H4WA 5EPNA 1GPZA 3ZYEA 7GCHF 1O3NA 1NTPA 1UVTH 2AMPA 2KFTA 5D1KB 3SGBE 3BTHE 2AHME 1SLUB 4MQAA 2PV9B 1NO9H 2FOCA 2ANYA 3SW2B 2OP9A 1V2TT 5F53A 4CRAA 1FV9A 2ZIQH 3SGAE 1KDQB 1GBIA 4X2YA 5DP8A 3SN8A 4BHWA 2UUFB 1HYJA 4OGYA 2AERH 1A2CH 2A2XH 4Y8YA 3RXQA 4MSXA 3EA8A 4QQ4A 1SMFE 3RXIA 4Q6FA 2ILNA 1EAWA 3OEED 2BD2A 1CT4E 1NROH 1K1LA 1K1MA 2KGGA 1A0LA 2ZFRH 1XVOA 3FO8D 4NZLA 2KGIA 4H6TA 3EB5A 1W10U 3K6ZA 3LQHA 1ABJH 2ESTE 3EGKH 3L33A 1GGDB 5D1MB 3MH4A 3KQCA 1GI5A 1N6YA 3NCLA 1W0KD 1QB1A 3D62A 3RXFA 1GI8B 2Y80A 1MKWK 1Y8TA 1G3CA 2F43B 2AH4X 2W7UA 1GHXH 2GD4B 4ISHH 4KGAA 2AIPA 5H1VA 4J2YB 2AGIX 1THRH 5C67A 1L1GA 3RM2H 1H8DH 2DUCA 2YQMA 3MH7A 2IPHA 4I32A 1QCPA 8KME2 1K1IA 1G30B 2OCVB 4ABEA 4A0CD 3PRDA 1S0RA 1OP8A 5JB9S 4Z0RA 1W3CA 1E4UA 2K1QA 4OS4A 1GDUA 1XXDA 1H8HD 3SU4A 3ESTA 1SI5H 2J2UA 4CRDA 1GMDF 2P94A 3LGUA 1O2HA 1C5PA 1EXFA 1S6HA 3DSOA 3M63A 3PLKA 5ABWA 2O8MA 3VB5A 1Z8RA 2VIOA 1YPGH 4Q7XA 2ALVA 3GYMA 5GIBA 6LPRA 3MO9A 1C5OH 1PJPA 4IC3A 4CREA 2ZHFH 2PKAA 3SHCH 3MTYA 4UFFH 2XBWA 3TJVA
chains in the Genus database with same CATH topology
4BANB 5L30H 1O2QA 2HNTE 1EP5A 1TX7A 1FY4A 1Z1JA 2FS8A 2V0BA 3DD2H 5JBTA 3P17H 3RXPA 3ZVFA 4ABAA 2B7DH 2CF9H 3SNCA 3S9BA 1TNGA 3MNCA 1KXAA 5F03A 1N1LA 4XBDA 1YKTA 2QGRA 1QL8A 1SOZA 1KLJH 3QK1A 2NU2E 1LTOA 4JMYA 1V2OT 1RTKA 2VGCC 3G01A 1G2MA 3TJUA 1Z8GA 2ZTYA 3FANA 4E06H 3E6PH 1EJAA 2V6NA 1F7ZA 1BBRE 5ETXA 1XXFA 4IGDA 4AGJA 4IS5A 4WXVA 3U9AH 2BDHA 1QURH 1HAXB 3F9GA 3U8TH 4FU9A 1E34B 2THFB 1ESBA 1A7SA 1FY8E 2A0QB 4O03A 4MPUA 1EZUC 5E2OA 3QLPH 1QGFA 3MHWU 3A8AA 1UHBA 3A86A 1O39A 3JZ2B 4B75A 1PQ7A 2ZWLH 1IQEA 1RD3B 4NWKA 4DVAU 1OS8A 1DX5M 5GPIB 2KAIB 1IQGA 1CBWB 3RXHA 1T8OA 1WOFA 5J4QA 1CBWC 1QQUA 1IQJA 1ZHPA 3CENA 4HFPB 1HAIH 1IHSH 1ZJDA 1K1PA 4NWLA 1A61H 3B23B 1V2KT 2FMJA 3KF2A 4WH8A 3MU4A 1NM6A 3PMJA 3RXCA 4LZ4B 1L4ZA 5FCRA 4AORA 1UK4A 2PSYA 3OY6U 2ZGJA 1SGRE 3PTNA 1VCPA 1ZOMA 2GP9B 1LKAA 1TB6H 2WINI 4IMZA 2OUAA 3GCNA 4Y7AA 5L6NH 1ELAA 1SPJA 2FLRH 1ELEE 1AZZA 2GMTC 1AU8A 1ELFA 2R3UA 2QF3A 1DUAA 1SGTA 4B71A 1SSXA 1W2KH 1QHRB 1A4WH 1MTVA 1C1SA 2TGPZ 3HGNA 3RXGA 1LHCH 4XSKU 2BLQA 4YM9A 1FONA 3SJ8A 4ZH8A 2FOGA 2VWLA 2FEQH 1HRTH 1O3HA 3MOCA 1J15A 1L1NA 1O2XA 1GHWH 4ABDA 1ZHRA 1ZSJA 2SGAA 3RXBA 5LPFA 3NK8A 5JBAS 3KN2A 1EAXA 2BX4A 1GL0E 3RLWH 1KDQA 1Y5BT 1XM1A 1GI7B 5HGGA 3SO3A 3TGKE 1O36A 3UY9A 2ZG0H 4TPYA 2A5KA 4O9VA 1G3BA 1L2EA 1SFQB 1GBLA 3MFJA 3V13A 3Q3XA 4UD9H 2BQ6B 1F5LA 3MU1A 1GVLA 3M37A 2FX4A 4E7NA 4A1TA 1O3FA 2QAAA 5DP7A 1TE0A 2V35A 2FO9A 1C2JA 2PR3A 2ZTXA 4M7GA 4ZUHA 1ZSKA 1F0UA 1BBRK 2BZ6H 1MTNB 4NA9H 3H5CB 2C8XB 4XFQA 2V3HH 2Q6DA 3L6PA 1W14U 3T29A 3PLBA 1XUIA 4INKA 4FUJA 1C2HA 1BCUH 1HLTH 3SNEA 4K60A 1QA0A 3S9CA 1P02A 3RXRA 1UJ1A 1G3EA 5E2PA 1O2UA 4K1SA 1IQLA 1MMJN 1E0FD 1MCTA 3QGNB 5LPRA 4SGBE 3TIUA 2ZI2H 2ZPRA 5A8ZA 1C5XB 5EG4A 1VITG 4JK6A 2Y7XA 2Z9IA 2BDYA 4OS2A 3AVZA 5IYTA 3UQVA 3ZVDA 2BD9A 2PUQH 2OXSA 2H2ZA 1JWTA 3OTJE 1IQMA 3I77A 1SFIA 4ABFA 5FX5A 3SJIA 3SV7A 2VIPA 2BQ7B 5E0HA 4NA8A 1Z7KA 4TY6A 3HKIB 4XBCA 1DY8A 4WJG2 2H5DA 5G4BA 1SGYE 1THSH 1B0FA 1B0EA 1V2MT 4XDEA 3EA9A 2XWAA 1GHYH 4ZKOU 4HGCA 1T8LA 4WF8A 2OQUA 1O3KA 4YESB 2Y82A 2F3CE 1GBBA 3LGYA 1C5YB 1ABIH 2Q6FA 4JYUH 1MCVA 1Y5UT 1WU1A 3ATKA 5LGOA 3P8FA 3PROA 3SBKA 2TGAA 3BTDE 2VJ1A 2ZCLP 2W3KA 4ISLA 3GY4A 3Q77A 1QFKH 1ZTLA 1HAYB 1XUFA 3P6ZB 1O2PA 4TWWA 1K2I1 3T25A 3SUDA 1ZPZA 3UNSA 1QA7A 3AAVA 3SJKA 2JETC 4BTUB 4YOJA 1LPZB 1MTUA 1GBAA 3MNBA 4NFEA 2WUCA 2CHAB 2BYAX 3F9EA 4FUIA 3BTEE 4RSPA 1U6QA 1DWBH 3ATIA 4H42U 5EW1H 2BD4A 4AB9A 3HGPA 5BRRE 2ZQ2A 1GHAG 1T8MA 1GCDA 1C2MA 3QWCH 5T3HA 1VITF 3LT3A 1FAKH 1KXEA 2ZGBH 2HOBA 3F9HA 2KAIA 4JK5A 1P10A 3DFLA 1C5SA 2HNTF 3RMLH 2G8TA 4GPGA 3MH6A 1S82A 1HYLA 2R2WU 4KTUA 3VB6A 3TH3H 1GHBG 1XUGA 4RKOB 4ZXYH 2GCTB 3SUEA 3NPSA 1GCTB 1DM4B 1YCPH 2OBOA 1JBUH 4NZQA 3UR9A 2QIQA 1TBRH 1Z71A 3TVJB 3ZVGA 2A2QH 4OS1A 2BX3A 5HMAA 1TMBH 5JDUB 3LH1A 2HALA 1ARCA 2Y6TA 3NXPA 1S81A 2VB0A 1Q31A 2Z9LA 2EI7A 2RCEA 1DXWA 4X1RU 2XXLA 3P95A 3ODDA 1EX3A 1SGFG 3E91A 4ISIH 1UO6A 4IN1A 4FXGH 1VR1H 1H9HE 1GHZA 3A87A 1P2QA 1YPKH 1TABE 3SV2H 4XE4A 1O5DH 4O3TA 4UONA 1HFDA 3NZIA 3RLYH 2J94A 2ULLA 4LZ1H 1NS3A 3VB3A 1S83A 3ZZCA 4Y8ZA 3SNDA 4ZHAA 5EW2H 1AKSB 3HATH 1DPOA 2EI8A 4I8KA 1QRXA 1Y3XA 5JPMH 5A0CA 1CA0B 3ZZ7A 1YLDA 1F5KU 1GG6B 1CHOG 1P3CA 4X6MA 4GHQA 3TITA 5GCHF 4GUXA 1O35A 1GG6C 1BHXF 1HAHH 1SHYA 8GCHG 3GYLB 2XWBI 3I29A 1TNHA 1DWCH 2O9QA 1ZZZA 3ZVBA 5DP3A 1GHBF 3SUFA 1K9OE 4X1QU 1ELGA 1YPJH 2FDAA 3LGVA 5EXMA 5DP9A 1CT0E 3O8BA 4AFSA 1PQAA 1KSNA 1CT2E 2A4QA 2BLOA 4TYDA 3V12A 2XC5A 2LNCA 1WAYB 3ENSB 2ZFPH 1MBMA 3GCTF 2YNAA 4ABBA 3GOVB 1TGNA 4F4OC 2XTTB 4AG1A 7GCHG 4ABHA 2JKHA 2FI3E 2F83A 1PPEE 3TH4H 1C5QA 3RXKA 5FPYA 7KMEH 2HPPH 1ELBA 5EXNA 2HVXA 3BTFE 4BXWA 3BN9A 4ZROA 1UVUH 4LK4A 2C8ZB 3T2NA 1Z6EA 1OXGA 4Z6AH 1ZMJA 1L4DA 3GDUA 1EUFA 1NRSH 1XKAC 4PROA 3RMNH 1NN6A 1GI0A 1EASA 4E7RG 1UCYH 4NSVA 1WUNH 1AO5A 1OWEA 2FOMB 2A45B 1AVWA 4ZHMU 1QNJA 3SZNA 2QF0A 2FM2A 4YT7H 4U32A 4D76A 5FBEA 1GI6A 2W7SA 3ZYDA 2NU1E 2WPHS 1SB1H 4BAMB 1BMNH 5A8YA 1GBMA 1EATA 1H1BA 4J1YA 1HGTH 4CHAC 1D3TB 2Z9KA 4DG4A 4YTAA 5IDKA 5ESBA 2BXTH 2BY6X 1VCWA 1TMUH 2ZEBA 3LH3A 4MPWA 3ZZ8A 1O3DA 4X6PA 2BB4A 1YYY1 4Q2KA 4FUBA 2ZO3H 4CH2B 2ZCKP 3A81A 3RXAA 1GMDG 1S84A 5K0HA 1BOQA 1O38A 4FVDA 3STJA 3V0XA 3KHVA 1IQKA 3KCGH 1A46H 1TA6A 1O2MA 2P16A 4I8GA 4O97A 1WBGB 1NY22 3N7OA 1P01A 3QDZB 1C4U2 4THNH 1YP9A 5FX6A 3P8NA 1SLWB 4DIHH 3P92A 1BTYA 1MD7A 1T32A 4GHTA 2G00A 1GI2A 2ZFFH 3LPRA 1TNIA 4DCDA 4MTBA 3RMOH 1O3CA 4MNWA 1UMAH 3ZZDA 1PYTD 2CF8H 2Z94A 2GT7A 1GI9B 5F8TA 3QN7A 3OU0A 1EZQA 4JZ1A 3JZ1B 1EPTB 1MAYA 2XRCA 1UTQA 3A85A 2Y81A 1DVAH 2GVFA 1ZR0A 3GY3A 1EPTC 1C2DA 1AE5A 2BY7X 2F9UA 1GGDC 3K65B 2F91A 1KXBA 3L3TA 2FWWA 3UREA 1HPGA 2IJOB 3PYHA 4B73A 5FAHA 2ZGXH 1OPHB 1YPEH 1GVKB 2R0LA 1TRYA 1NRNH 3DA9B 4FU7A 5DGJA 4ZKSU 3T26A 1MU6B 1O2LA 3EQ0H 3U69H 2D1JA 4X1NU 4FUEA 4E05H 1MH0A 1GMCG 2ZFSA 3A82A 4OGXA 1PPHE 1NFXA 2A4RA 1FY5A 1CHGA 1AMHA 1OP0A 1C1RA 6ESTA 1O0DH 4AGKA 2PHBA 2JH5D 3O8CA 1SVPA 4GVUA 1DSUA 1GJ6A 3RXJA 4KELA 1ELVA 5TJXA 1TGCA 3ZVCA 1X7AC 1UVOA 1GMHF 3RMMH 3T5FH 1ID5H 1O5CB 1O2OA 4WMEA 2FOHA 3RC4A 1P2KA 1AKSA 1UTNA 1HIAB 1JRTA 4UEHH 3F68H 5L2YH 2ZZUH 3MNSA