3FANA

Crystal structure of chymotrypsin-like protease/proteinase (3clsp/nsp4) of porcine reproductive and respiratory syndrome virus (prrsv)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
197
structure length
192
Chain Sequence
FRTQKPSLNTVNVVGSSMGSGGVFTIDGKIKCVTAAHVLTGNSARVSGVGFNQMLDFDVKGDFAIADCPNWQGVAPKAQFCEDGWTGRAYWLTSSGVEPGVIGNGFAFCFTACGDSGSPVITEAGELVGVHTGGGIVTRPSGQFCNVKPIKLSELSEFFAGPKVPLGDVKIGSHIIKDTCEVPSDLCALLAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-structural protein
publication title Structure and cleavage specificity of the chymotrypsin-like serine protease (3CLSP/nsp4) of Porcine Reproductive and Respiratory Syndrome Virus (PRRSV).
pubmed doi rcsb
source organism Porcine respiratory and reproductive syndrome virus
molecule tags Hydrolase
total genus 45
structure length 192
sequence length 197
ec nomenclature ec 3.4.21.114: Equine arterivirus serine peptidase.
pdb deposition date 2008-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3fanA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3fanA02
3.30.40.20 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Chymotrypsin-like serine protease; domain 3 3fanA03
3DFLA 1TX6A 1QRWA 4AFUA 2BOKA 1AIXH 2CHAC 2GV7A 1DT2A 2BQ6B 8ESTE 3A84A 3I77A 1C1OA 1CHOG 1THRH 1TA2A 1D3DB 1L4ZA 3W94A 4AZ2B 1A0HB 2GMTB 1BRBE 4DIIH 2P3UB 4X1SU 2AGIX 4B73A 4AB8A 1TALA 1P3CA 1YYY1 3SU5A 4YOJA 3M3VA 2OP9A 4X1PU 4IMZA 1GMDG 4MDSA 1LQEA 2HNTC 1BMLA 3SZNA 1C1TA 1LVOA 2VH0A 1CU1A 1MTNB 1XVOA 3EGKH 4UD9H 4TPIZ 1ZPCA 4O97A 2SGEE 4XFQA 5E2OA 1YPHE 3ITIA 3FZZA 2GCHG 4NIWA 3ZV9A 5BRRE 1O2WA 1J15A 1EASA 2PWXA 1GCTB 3PLBA 2XNIA 1AN1E 2ESTE 3B23B 2FPZA 3GYLB 4ABIA 4KP0A 1ETRH 3M7UA 4ZHAA 8GCHG 4B2CA 1TRYA 5L6NH 2ODYB 2ZGXH 1H9HE 1ZSKA 4SGAE 2ILNA 2PSYA 1FIZA 1OYTH 1RXPA 2PKSC 3SHCH 4X1NU 1K1LA 1GMHG 3SNDA 5BPEA 1UHBB 1K28D 1TOCB 4O03A 3M3TA 1TONA 1W0ZU 4ABEA 1GBFA 3P8GA 1CVWH 1ABJH 2FOEA 3VB6A 5A8ZA 1GI4A 1GJ6A 1BJUA 4ZAEA 2VIDA 1FPCH 2GKVE 2FOMB 2FI5E 1SLXB 3R3GB 4ISHH 3VGCC 3JZ2B 2FOFA 3UNSA 1DPOA 7GCHF 3P6ZB 5JBAS 3BTKE 2IN2A 3C1KA 1GJ7B 1UTQA 2ZU3A 1GDQA 2GCTC 2JETC 3JZ1B 4NIXA 1WTHD 2R9PA 1ETSH 1SFQB 3GCTG 4J2YB 1O2VA 4OS7A 3HGPA 1HUTH 1E34B 4CRDA 2WV5A 4RKJB 2AGEX 1DXWA 1KIGH 1WV7H 1SGDE 1DSUA 1GJBB 4X8SH 5HM9A 1DUAA 4XBDA 2H1UA 1BZXE 1QA0A 2A31A 1FQ3A 1QURH 1NRRH 5FXLA 2NU0E 3LJOA 2H5CA 3VXEH 4GCHF 2F9PA 1PFXC 3CS7A 1OOKB 3PMHB 3Q3KA 1ZHPA 3SBKA 1UVPA 4Y7BA 4AFZA 1C5XB 3LPRA 2HOBA 3M5OA 1A5GH 4JZDH 2NU1E 1SB1H 1NY22 1Q3XA 4DURA 2HPQH 4YM9A 1RIWB 4X1RU 2G8TA 1NRSH 2V3HH 3CENA 5ETXA 5FX5A 4HI3A 3MH5A 2OD3B 2UWOA 1KLTA 3DHKH 3VB3A 2BYAX 1IQEA 2OLGA 3PLKA 2VINA 2Z9KA 1DWBH 5PTPA 1EPTB 1GHBF 5LPRA 1AUJA 2ZGBH 1TFXA 4UFEH 3R0FA 4H6TA 4VGCB 3TNTA 1JBUH 1Y5BT 2ZU2A 2Y5GA 1YCPM 4IC5A 1S84A 4YOIA 4FUGA 3TGJE 2J94A 3W95A 2GCHF 4UDWH 1O2UA 1MD8A 4NA7A 3QN7A 1V2WT 4KKDA 3OYPA 4BXSA 3F1SB 1EPTA 1K1JA 2JH6D 1UTJA 2XTTB 1O2MA 1AZ8A 1A3EH 1FUJA 1S5SA 1ZGIA 2QXHA 3EYDA 2J9NA 4I7YH 1Z71A 4XDEA 3RXTA 2P8OC 4I31A 1EAXA 3GDVA 2Z3CA 3NCLA 3GY6A 1T32A 1P05A 1IHSH 2PR3A 4R8TB 3GCOA 1MZDA 4FU8A 4X2YA 1A0LA 4YZUA 1V2VT 4U01A 2FI4E 4BOHA 3LT3A 1QBOA 1K9OE 2BDBA 2C8XB 3SUFA 2AGGX 2HGTH 3BN9A 1DXPA 1E38B 1O38A 3STIA 1GBAA 2ZFQH 1ZRKA 3Q3YA 2C4FH 3D49H 2BY8X 1UCYK 5DO4H 4FUDA 4JCNA 4F4OC 1NC6A 5G4BA 3SHAH 2VWNA 6GCHG 5E0HA 4ISNA 2BLQA 1DS2E 2G4TA 4ZXXH 2C8YB 2GV6A 4MPVA 1TGTA 2STBE 4GHTA 4BAMB 2PUXB 2F9OA 4O9VA 1BTUA 1C1VH 3BTFE 1W0YH 3OU0A 4KTSA 3T62A 2PLXA 1O2YA 1V2MT 2A7HA 1VITG 3B8JA 3TPIZ 1QL7A 1TBQH 2Z6BD 4CBNA 3PMAB 1EX3A 3ZVDA 5AF9H 2XW9A 2H9HA 2IOTA 1BTPA 3RXQA 1KXDA 1TWXB 2BX3A 2OINA 3MWIU 2FTMA 4NIVA 2SFAA 5HXFA 1NFWA 4Q7YA 2H9TH 1GHZA 5IDKA 3SV6A 1JRSA 1GJ5H 4AORA 3MU4A 5A8YA 5A0BA 2BD9A 5AFZH 2ZP0H 2PTNA 1O5BB 5GIBA 3RMLH 3UY9A 1JIRA 4WMEA 1S0RA 2A4QA 4FU9A 1KTSB 1UJ1A 1ZHMA 1QB6A 1BQYA 3O8CA 4THNH 4XBBA 1C5LH 2OBOA 1EP5A 3I78A 4FUBA 4WJG2 1SOTA 3RXMA 1EOLA 3BIUH 1C4V2 1DY9A 4OS2A 1H8DH 1ZSJA 1E0FD 1SVPA 3BF6H 1BTZA 1O37A 3DUXH 3EQ0H 1O2HA 1D6WA 3SU2A 3AVZA 1LVMA 1IAUA 4NGAH 2BVRH 1P9SA 5JBBS 1HAXB 2GZ8A 2Z3DA 2A7JA 2F83A 1L1GA 2H2ZA 5JBCS 1UK2A 1LHDH 2BHGA 1L2EA 4ABAA 4E06H 2P16A 1V2RT 3SV9A 1BBRE 2AH4X 1L4DA 2CF9H 1C2IA 5DP4A 2M5TA 3LKWA 2XBWA 4SGBE 1ZTJA 4I8KA 4IBLH 4DIHH 1S0QA 5EU8A 1HAPH 2UWPA 4MNYA 3RM2H 2VB0A 1IQHA 4ZXYH 1C5RA 3MMGA 1DY8A 3VB7A 5HGGA 2BY6X 4X6NA 2PFEA 1ARBA 1ZSLA 1T8OA 1TLDA 3SNAA 1BB0B 1C1NA 1QR3E 1O3LA 2XYAA 1UK3A 3DT0H 1GBJA 1P2JA 2R2WU 1MKWK 4H4FA 3RXUA 6LPRA 3H7TA 2R3UA 1HPGA 3A7XA 4WH6A 1BTYA 2Y82A 1P09A 1SGCA 2ZPQA 3BG4C 1CGIE 1H8IH 5H4IB 1ABIH 1LO6A 2ODQA 1SGPE 5F03A 3T25A 1O3NA 3GY5A 1Z1IA 4X6PA 5F6MA 1G37A 2EI6A 4MTBA 2Q6DA 1TPOA 4QT8C 4YLUA 1GBIA 1N6XA 2Z9JA 1ELEE 4TWWA 4IN1A 1GL1A 2BD2A 4IN2A 3QK1A 1J8AA 4NCYA 1Y3XA 3KL6A 1PPCE 2ZGHA 3EE0B 1QB1A 1ZTKA 3TK9A 5GDSH 3RXLA 1EUFA 1GCDA 3TITA 3BTDE 1SLWB 2ZU4A 1P2NA 4A7IB 1OPHB 1GBLA 1NZQH 3OY5U 1W7GH 1BHXB 3E90B 3UQOA 2WV4A 2CF8H 3PV4A 4CH8B 2ZFPH 1DDJA 2FX6A 1W3CA 2D2DA 1XUHA 2ANYA 3U8OH 3GCHC 2ZO3H 1O34A 1O2OA 9LPRA 2C8WB 2A4OA 2BY9X 4YLQH 1HAOH 1CGHA 1QGFA 5EODA 1A2CH 2Z94A 4WY3A 3A8CA 1AKSB 1F0SA 2A32A 4RN6A 2B7DH 1TX8A 4DG4A 3ZZ4A 4JZ1A 3SU1A 2UUKB 3KQDA 1AB9C 3QO6A 5LH8A 1TYNA 1TAWA 1XVMA 3LGUA 1MCVA 2HRVA 5A0AE 1UVOA 5EW2H 1TQ0B 1MMJN 1K22H 7LPRA 1VZQH 4AFQA 1O2RA 3SGQE 1C5OH 1P3EA 1EB2A 3PTBA 1XUKA 3F68H 1LHFH 1Y3UA 2YNAA 3KHVA 1KXEA 1TE0A 2ZWLH 3ZZ3A 4BTUB 2EEKA 3UR6A 2YNBA 3ZVCA 1O30A 3LIWA 4ZUHA 1CBWB 2P3TB 3SUEA 4CR5A 3EA8A 4XSKU 1CSOE 1E35B 1W11U 2GDDA 2WUCA 3UQVA 1SLVB 1ELAA 1O3GA 4Y79A 1V2JT 1RRKA 3A7YA 4X1QU 3HPTB 1AQ7A 4OS6A 1P8VC 3LONA 2AERH 4K5ZA 1C5PA 2H9EH 2GD4B 2H5DA 5LPFA 3GOVB 5DGJA 1WTGH 1BBRK 1GMCG 1C2JA 1V2ST 3MU8A 2ANMH 4RSPA 3BTGE 4Y8YA 1B7XB 2NU3E 2P94A 1VGCB 5F8TA 1Z1JA 3E8LA 1KDQA 1LKAA 1O2SA 1YGCH 2VVUA 3GY8A 2F9BH 3O8DA 4INLA 1C2GA 2XC5A 5DP6A 1N6YA 2JH0D 5I46H 1B5GH 1GI2A 1HAGE 4OGYA 4K1TA 2C90B 2ODPA 1O35A 1UTOA 1GJAB 1L1JA 3A81A 2BD4A 3K2UA 3LH3A 1P03A 3AAUA 1VJAU 5J4QA 1T4VH 1AY6H 1ELFA 2W7SA 1FY1A 2HWLB 3M61U 2VIOA 3ZZ6A 1FY3A 2G4UA 1A7SA 1WSSH 3ZVBA 1P04A 1SGTA 3FANA 4Q2KA 5E0GA 1MTWA 1CQQA 4JZIA 1TQ7B 3A7TA 1TBZH 3P8FA 1O2LA 1FAKH 3E16B 4OGXA 3OSYA 5LPEA 1EB1H 5EQRA 2FYQA 1GI6A 2BX4A 5C5NA 5JYIA 3P17H 2ZDMA 1XM1A 1GI1A 1SMFE 1SGQE 4FUHA 2A7CA 3S7KB 2TGTA 1ORFA 3ZVFA 5A09A 1QQUA 3ODFA 4NWLA 9ESTA 4FUCA 1QBVH 4A1VA 1TNJA 1Z7KA 3TJNA 1BTXA 3NXPA 3MTYA 3LGVA 1GWAA 2V35A 2A0QB 3E91A 4D7GA 1ANEA 3MHWU 2WUBA 1OP2A 5CHAC 5LGOA 1BIOA 1YPEH 2ZFFH 5K0HA 1DWDH 3LGWA 1QHRB 3KEEA 3MYWA 3SGAE 3E0PB 1P01A 1C2EA 3U69H 3M5NA 3MO9A 2SNWA 4B76A 3GDSA 1D4PB 1T7CA 3ZZ5A 1BTHH 3A7WA 2SGDE 3NKKA 1MAXA 1UTLM 2A5KA 4AOQA 1TGSZ 1VJ9U 1YLCA 2ZG0H 3RMNH 1MKXK 1OSSA 4IMQA 5ABWA 1XXDA 3ESTA 1TABE 3ZZ8A 1C5YB 1SBWA 4X2XA 2SNVA 1T4UH 2HLCA 2A4GA 4AB9A 5L2YH 1ZPZA 1ZPBA 1CE5A 1CA0C 3FZDA 4DVAU 2PGQB 4Z6AH 1K1MA 1SGRE 3KGPA 1K21H 2BDHA 2O8LA 3RXVA 2VWOA 7ESTE 4U32A 2NWNA 1O3IA 2FYRA 4BANB 1ELGA 3QTOH 2FOAA 5DG6A 4WH8A 4A6LA 4JZEH 1T31A 1OKXA 1F5KU 2ALVA 2QXGA 1FMGA 5DP7A 1VCWA 1MTNC 3BTQE 1FAXA 1G30B 4FXGH 3M3SA 5C20A 1PQ5A 5DP8A 1E37B 4H42U 2ZGJA 1NRQH 2QXIA 5EPYA 5EXMA 1ZZZA 1JRTA 2FOGA 1RGQA 2FLRH 2HNTE 4GVUA 4JYUH 4NWKA 3AW0A 1Y3VA 4MLFB 2ZHWH 2OTVA 3HK6B 6CHAB 1TIOA 1AHTH 3T29A 2BXTH 4GUXA 3C27B 1BCUH 5IYTA 4I32A 1S81A 2O9QA 2V0BA 1O2PA 3TK5A 4CRGA 4ZMAH 4O3UA 4YT6H 3WY8A 1RFNA 4TPYA 1DVAH 2B8OH 1OWJA 3M37A 1SGYE 3BTTE 1JXPA 3AASA 3URCA 1A5HA 4X2VA 4F49A 1PYTC 1VR1H 2ANWA 4O3TA 1HV7A 1L0ZA 3P8NA 4U30A 1EZUC 3LC3A 4UFFH 1P9UA 1AWFH 3S7HB 4AG1A 1TPPA 1GG6C 2ZDNA 2ZQ1A 1EAWA 4ABBA 1DOJA 1TPAE 2EC9H 1GI7B 1LQDB 4NSVA 2FO9A 3RXCA 1V2PT 3M7QA 1PPZA 5EG4A 5T6DA 2EI7A 3BEFB 4IGDA 2WPIS 1P2IA 3TVJB 3RXRA 1BRAA 1FY5A 1GBCA 1WUNH 1ACBE 3KIDU 2Q1JA 1MD7A 3P70B 5EXLA 1CHOF 2GX4A 1L1NA 1WQSA 4Y11E 3ZZDA 1ESBA 1A0JA 1V3XA 3SI3H 2G55A 3E3TA 1P12E 1UCYH 4CRBA 5FPTA 3HKJB 1BTWA 2UUJB 5EGMA 3V0XA 1GMDF 3F6UH 1RS0A 3BSQA 4M7GA 1BUIA 2FOBA 1YP9A 1Z6JH 4CRCA 4A1TA 3A83A 2XCFA 1PQ7A 3K65B 3SQHE 2ZGCA 3F9EA 1LKBA 2FXRA 2UUFB 2ZI2H 1TRNA 2J4IA 1K1IA 4CBOA 4ABJA 1B0FA 1GBHA 3P95A 4ZKOU 1G32B 2BZAA 5C5OA 2D8WA 5A8XA 1UTMA 4ZKNU 1IOEA 3O8BA 4AFSA 5I25A 1V2KT 3TH2H 3B9FH 1GHAG 1O33A 2I6SA 1FI8A 4BAKB 3A85A 1YLDA 3PWBA 1QTFA 5JPMH 1GGDB 2BOHB 3EA9A 5TCCA 1ZMJA 8GCHF 1O3AA 3Q3XA 3U8TH 2LPRA 4YT7H 5EQQA 3RXAA 4VGCC 2GTBA 1T8NA 1ESTA 4WVPE 1C4U2 1GMHF 2Y5HA 5AVDA 3SV8A 2NU2E 1G36A 3MI4A 1AE5A 3PB1E 1BMMH 1RTLA 1SHHB 3SU3A 3GY2A 4KGAA 2VIPA 1WU1A 1J16A 2ULLA 3A7VA 1QL9A 4Y76A 3SJOA 1IQLA 2V6NA 1HBTH 1F0RA 4ISIH 3TJUA 2BXUH 1O2NA 3GISB 3FVFB 3VEQB 1AE8H 4TYDA 1FONA 3IITA 1SC8U 1O3BA 1FPHH 3GCTF 2R2MB 3KCGH 3SN8A 3STJA 1HCGA 2WPMS 1NN6A 5C1UA 2TRMA 4Y7AA 1W2KH 2W5EA 5TJXA 1GHYH 1AFQB 2BLVA 2SGFE 4B2AA 3A86A 1EKBB 1XUJA 4INHA 4CHAB 1O0DH 4NA8A 1C5TA 2G00A 1O5GH 1TMUH 5EXNA 1NM6A 4WMFA 1MKWH 1AWHB 2Q6GA 3RXJA 2F9VA 2CN0H 3RC5A 3HKIB 1GHWH 1LPZB 1C5WB 1TB6H 2GDEH 4FUJA 5EPNA 3SOSA 1LHCH 1DWCH 4HFPB 3QLPH 1ELBA 2JKHA 4OS4A 2GT7A 5FCKA 1THPB 3PO1B 3AW1A 1ZMLA 1EJNA 2ZFTA 3QGNB 4NIYA 1BA8B 1XUFA 2FZZA 3EAJA 4K69A 1C5ZB 2XC0A 1QQ4A 1UTNA 1C4Y2 2Y80A 1QRZA 1HDTH 3MNSA 3DA9B 4Z0KA 1BRCE 4AGJA 4TY6A 4Q7XA 1FY4A 3T26A 2PGBB 2TGPZ 3HATH 2F9UA 1WYKA 2FESH 2FDAA 3LOXA 3M35A 1SGEE 5FCRA 1J14A 5FPSA 1C5MD 1WOFA 3H7OA 3E6PH 4K8BA 1EAUA 1GI5A 1YC0A 1O3KA 3VFEA 2QY0B 1GDUA 1AI8H 1H9IE 1GHAF 3K6YA 2GVFA 1TNIA 2FP7B 5E8EH 3MU0A 4IS5A 4K1SA 5TCAA 3BG4B 4HGCA 3SU0A 1DWEH 4FUIA 1NU9A 1O2XA 4MNXA 3ATMA 1QY6A 4Y8XA 1SFIA 1SG8B 3RC6A 1C2MA 2RA3A 3TH4H 3T28A 3RXEA 1KY9A 4ZKRU 1O3OA 1YCPK 5GCHG 3IG6B 1GJ9B 2A4RA 1SQOA 1QRXA 3QWCH 1KSNA 2VJ1A 1FLEE 4OS1A 1PQAA 3Q00A 3S0NA 3GDUA 1D3TB 1P2QA 3UTUH 4DOQA 2A2XH 3KNXA 4JMYA 3BTME 2VGCC 2OUAA 3D65E 1UTPA 5ESBA 1GBKA 1IQNA 1QL8A 1PPEE 6GCHF 4GPGA 1DLKB 4ASHA 2ZTYA 3KF2A 1C1QA 3RXKA 1TBRH 1ZRBA 1XUGA 3SORA 2CMYA 1O3PB 3S9BA 1VITF 2BVXH 1ARCA 1KXCA 1GVKB 1O2QA 4WWYA 1Z8JB 1JOUB 1BBRH 3A8DA 3LGIA 2ZKSA 1IQMA 3SU6A 3E0NB 4I8LA 2ZNKH 4UFGH 1SGNE 1U6QA 2TGAA 4GLYA 3UUZA 3UWIA 1WCZA 1LPGB 1BHXF 1EATA 1UO6A 3GICB 1D9IA 4CR9A 1T8MA 3OTJE 1GJCB 2WPLS 2BLOA 3CP7A 1HAVA 3RU4D 1O2IA 1V2QT 1OWDA 1EAIA 3KQCA 2AEIH 4I8HA 4Q80A 2JH5D 1EZSC 3UR9A 1V2UT 1LVBA 1ZYOA 2WYJA 4Y8ZA 2THFB 3V13A 3NK8A 3MNXA 3KQEA 3URDA 4MPXA 1P2MA 3HGNA 1TA6A 3UOUA 2QF3A 3M5MA 1QA7A 2Q6FA 1UVUH 2OXSA 2P95A 3TIUA 3VB4A 1KDQB 1O3FA 1N8OC 3L33A 2ZECA 3KQBA 4JK5A 4CRFA 1GI0A 3UNRA 1G2MA 1F2SE 1GHVH 1V2NT 3ATWA 2VWMA 3QX5H 3T27A 4BAOB 3CS0A 3NWUA 1TNHA 2STAE 3RM0H 1MBQA 3BTEE 3GY7A 1GPZA 3SJKA 3SJIA 2QA9E 6ESTA 1PYTD 1DANH 3TJVA 2VH6A 3U8RH 2A5IA 2BMGB 2ZEBA 4D9RA 1A3BH 1BMNH 3F9HA 3TK6A 2C93B 5E0JA 2V3OH 4AX9H 3VPKA 4FUEA 1HIAA 1SLUB 1IQIA 2QGRA 3IWMA 5L30H 4WMDA 4UEHH 1EXFA 1DE7H 1YPKH 2TPIZ 2ZHDA 5L2ZH 1AMHA 1C5SA 1AVXA 3MFJA 4J1YA 1OX1A 3SW2B 4DT7B 1DLEA 1HAYB 4R0IA 3RXOA 2Z9GA 1HAHH 1TNGA 2Z7FE 2FI3E 4ZKSU 3V7TA 5J4SA 1MKXH 3RMOH 4ZH8A 3SUDA 3F9FA 1BDAA 5FHTA 1QJ6B 1SGFG 2G81E 4DY7B 1YBWA 1S6FA 1GJDB 1O3EA 1VGCC 4INKA 1T8LA 1HB0B 2VIWA 2IPHA 1BMAA 3SNBA 3SV2H 1VITH 2ZIQH 3PYHA 4XOJA 1MQ5A 1UK4A 4MNWA 1DM4B 1ZOMA 1QCPA 1C5QA 1P11E 1O36A 2VVCA 1C5NH 1HJAB 3TNSA 3A88A 2XBYA 4B1TA 1Y3YA 1A61H 4GAWA 1OP0A 1C2LA 1GDNA 3PM3A 4LXBH 2ANKH 2PKAA 2BM2A 2BTCE 2OQUA 4NFEA 3S69A 5EOKA 1OXGA 3P8OA 1UVSH 5CE1A 1FN8A 1O3MA 2TIOA 2CHAB 3MOCA 1XKBC 3PLPA 1V2TT 3RXSA 4H6SB 5ESTE 1C1MA 4B75A 2TGDA 3GCNA 4Y0ZE 3NPSA 1KXBA 1TMTH 1Q31A 3A80A 1P0SH 1S85A 2QV1A 1F5LA 2ZDKA 2Y6TA 1O39A 4BAHB 1DSTA 5AFYH 4AYYB 3RXIA 1HGTH 5JB9S 1MU6B 4E7RG 3SV7A 2Z9LA 1QNJA 3HK3B 3PMJA 3QUMP 2WINI 5DJ7A 5FX6A 4I33A 1Z8GA 2W7UA 1EJAA 3MNCA 2ZDLA 4IW4E 4LZ1H 3RC4A 3SGBE 1Z8IB 1HXEH 1LMWB 1UTKA 3BTHE 4K60A 2F3CE 3SJ8A 2VIVA 1PPHE 1C9TA 2HNTF 4OS5A 1KYNA 5HM2A 1TGBA 3RMMH 4NZQA 1ELTA 2ZU5A 3L3TA 3SUGA 2P3FH 3M7TA 1GHBG 1XKAC 3NUMA 3ZZBA 1GMCF 2GMTC 3ZYDA 1Y5AT 1SHYA 3UNQA 2PKSB 2OC1A 1KTTB 2QYIA 3UREA 4K8YA 1GBTA 2ZFRH 1N1LA 2J38A 3BTWE 4CH2B 5T3HA 1C1SA 3EA7A 1GBMA 4D76A 1NROH 3F9GA 2WYGA 1GHXH 1PPBH 1BITA 3A87A 2Z3EA 2O8MA 1CHGA 1W14U 2GZ7A 3BEIB 2O8UA 4I8JA 1ETTH 4RKOB 4FVDA 4LK4A 3VGCB 4PROA 3TH3H 2LNCA 4NFFA 4WF8A 5E2PA 3RXBA 1EZQA 3K6ZA 2GCTB 2JETB 4YTAA 1F92A 1FIWA 1G9IE 3BEUA 2YOLA 4K3JA 1Y3WA 1G3CA 1HJ8A 1Y8TA 2FX4A 2GGVB 4Q7ZA 3QDZB 4B2BA 2F9NA 1RTFB 1GCTC 1V2OT 5EQSA 1P02A 4FVBA 2VU8E 2ZU1A 1JIMA 1XUIA 1GJ8B 1NT1A 3TJOA 4K1EA 3BV9B 3FAOA 1TX7A 5GXPA 1MTUA 1FV9A 2OQ5A 1SGFA 3LDXH 1UCYE 1S82A 1KLIH 1NO9H 5SGAE 1GG6B 1CT0E 1HLTH 2FOHA 1Y5UT 2DE9A 2PW8H 4ISOA 3OX7U 1NFUA 2Y81A 1YPGH 3RUOA 1HRTH 2FWWA 3UIRA 1GBDA 3TGIE 1S83A 1ID5H 4AG2A 1UMAH 3RU4E 1C2HA 1PJPA 2Y7XA 1QB9A 3GY3A 1UHBA 3UOPA 4MVNA 2PUQH 3RXHA 6CHAC 1HXFH 1LTOA 2BQWB 3NZIA 3LGTA 1C2KA 1P2OA 1HFDA 3RXDA 3LGYA 3BIVH 1AO5A 2G5VA 2ZCHP 3ZZ7A 3Q77A 1O3DA 4ZHMU 4Y71A 2CJIA 1PQ8A 1OWIA 3DD2H 1JMOH 1DUEA 4LOYH 1GVLA 3MH4A 2QAAA 1ZLRA 1C1UH 1J9CH 4YO9A 1WBGB 3MH6A 2P93A 1A4WH 4A92A 4ISLA 5FPYA 4GSOA 2B0FA 1D3PB 2UUYA 1OS8A 1P06A 1G3EA 1HJ9A 1OP8A 4K2YA 1JWTA 1W10U 2HALA 1LCYA 2VIQA 2ZHQH 5C3NA 2EI8A 2QN5T 4IC6A 3TGKE 2FIRH 1ZHRA 2WPJS 3SNCA 2SGPE 4X6MA 4CRAA 2GP9B 4X6OA 4D8NA 3H5CB 1ESAA 1GBBA 4MPWA 1W7XH 2AMPA 4HTCH 1CA8B 5JDUB 2C8ZB 3QTVH 1GBEA 1DX5M 1RIWC 1YPLH 1MH0A 3VB5A 4FU7A 3UPEA 2FEQH 2P8OB 2ZFSA 4B71A 2WPHS 1O32A 3ZV8A 1GI8B 2TBSA 4NG9H 2K1QA 1H9LB 5DP9A 1HNEE 1EPTC 4GHQA 4DW2U 3ZVAA 3TLOA 4MNVA 4KTCA 3ATLA 3V12A 3U1JB 1XXFA 4A5TS 2BB4A 2ZQ2A 2A45B 2BVSH 2ALPA 2RCEA 1TGNA 1MAYA 3A89A 1D3QB 2D26C 4A1XA 1A5IA 4Y6DA 2AYWA 1DFPA 1NESE 2CV3A 2H6MA 1IHTH 2BD3A 2O8WA 4WXIA 5EW1H 3A82A 1ZJKA 2G5NA 1VCPA 1DICA 4UONA 1BJVA 2BD7A 3QZRA 5B6OA 2DE8A 3ENSB 2OC8A 3ZZCA 4NZLA 5GWZA 1O2GH 1MTVA 1GGDC 1W12U 1G3BA 2ZDVH 1NFYA 2FS9A 2A2QH 1O2JA 2BY5X 1K2I1 1O2TA 3U98H 1OWKA 1O5CB 1RD3B 1A46H 2FLBH 2BLWA 2ZHFH 5T6GA 1QJ7B 3MNBA 3QGJA 4E7NA 4CREA 1LHEH 4ABHA 2GT8A 4BTTB 4DGJA 2QF0A 3EDXB 7KMEH 2XBVA 1SQAA 1KLJH 3ZZAA 3QZQA 1HAZB 3UWJH 2HPPH 1AVGH 4AYVB 2RG3A 4BAQB 1H4WA 1YCPH 1AFEH 2GZ9A 1EJMA 2PSXA 1O5AB 1O5FH 3LH1A 1ANDA 1SGIB 5HMAA 1AZZA 2BDAA 1AD8H 1TGCA 3LU9B 1QFKH 2J34A 5A0CA 2ZPRA 4UFDH 1EZXC 3AAVA 1AFQC 5GJ4B 1J17T 1PPFE 1NTPA 1ANBA 4CHAC 3RDZA 1E36B 1O31A 3ZVEA 3D62A 3MH7A 2ZHEH 1WQVH 1IQKA 4D7FA 5GPIB 2RDLA 1P10A 1V2LT 1THSH 2PTCE 2EA3A 1QJ1B 1SPJA 3U9AH 2R3YA 1G3DA 2VWLA 1BT7A 3U1IB 1QIXB 1ZJDA 2ZA5A 2Z9IA 5JB8S 3GY4A 4ABDA 3Q76A 1CT2E 1MZAA 2ZPSA 3M36A 3T2NA 4B74A 2XXLA 1MBMA 3PO1C 1Y59T 1ZGVA 4X8TH 1SQTA 1ZMNA 1GJ4H 2XC4A 4E05H 1O3JA 3KN2A 4ABGA 1H1BA 1YKTA 4LZ4B 3UFAA 1GL0E 1ELVA 1FNIA 2ZCKP 4X2WA 2VVVA 1OWEA 1FY8E 1B0EA 2OCVB 1HAIH 2Y5FA 2ZZUH 3MU5A 3MU1A 5JBTA 1EOJA 1UVTH 3ELAH 2BDCA 3G01A 5FBIA 3RXGA 1TRMA 2B5TB 3TU7H 2VGCB 1F5RA 2ZTZA 1INCA 3RLWH 1TOMH 3P92A 2XBXA 4JYVH 1NPMA 1SOZA 1C9PA 5DP5A 1C2DA 1CT4E 4BXWA 4ZROA 4X8VH 8KME2 2QCYA 4X0WU 2XWAA 1MQ6A 2RA0A 8LPRA 3ATKA 1IQGA 2AFQB 2FOCA 2J92A 4JZFH 1KXAA 1MTSA 1M9UA 4AGKA 1NU7B 2SGQE 1C2FA 3GCHB 3RP2A 1TPSA 4KELA 3SNEA 3E1XB 1G2LA 1CO7E 3RXFA 4ABFA 1HAVB 2AMDA 2BQ7B 4KTUA 4XBCA 1KXFA 1ELCA 5C1YA 1NRNH 3A8BA 1O5DH 5F8ZA 3MO3A 2AIPA 1TMBH 1CGJE 3RXPA 4HZHA 1AB9B 2ZCLP 5C2ZA 1FDPA 1ZTLA 1P2KA 1ZR0A 3SQEE 3BG8A 4JK6A 2CXVA 2R0LA 3N7OA 2W3KA 4UE7H 4JYTA 1LHGH 5HYOA 3PMBB 3FFGA 3ATIA 4MG3A 4WXVA 2BDGA 1SL3A 3ZZ9A 2FTLE 4BNRA 4FUFA 3L6PA 1S6HA 5C1XA 5C67A 1F0TA 2HVXA 4NSYA 2ASUB 1N8OB 4BTIB 2J2UA 3LJJA 4Y10E 5DPAA 1NFXA 1C1PA 2UWLA 5T6FA 5FBEA 3D23A 2AS9A 1FXYA 1VCQA 2Y7ZA 2FMJA 4AN7A 3RU4T 1YF4A 2CGAA 1D6RA 2C3SA 1EQ9A 1HIAB 1LPKB 1WAYB 2PHBA 1FN6A 1OYQA 1W13U 2NU4E 2W3IA 4YESB 1AUTC 3VXFH 1SR5C 1QBNA 2FODA 3FP8E 4X8UH 3I29A 1AU8A 1LVYA 3SU4A 2ZTXA 4D9QA 1GVZA 3PTNA 1AKSA 4TWYA 2B9LA 2A1DB 2W26A 1K1NA 1Q2WA 2A5AA 1ANCA 1F0UA 2D1JA 2BD8A 1BRUP 1MUEB 2QC2A 1LDTT 1BOQA 1YPJH 2XCNA 3SO3A 4YOGA 1O3HA 3PROA 1CBWC 1RJXB 2G52A 4U2WA 2DUCA 4TY7A 1XMNB 4MPUA 5GCHF 3S9AA 2AIQA 1C5VA 1HYLA 2OBQA 2VNTA 3SI4H 5DP3A 2IJOB 2O8TA 2KAIB 1A1RA 4DCDA 1O3CA 3M5LA 3V3MA 1C5UA 3ODDA 3O8RA 2BDYA 1GI9B 3DFJA 4I8GA 3A7ZA 1C1WH 2PKAB 2P59A 5DKMA 1OWHA 3A8AA 2FS8A 2F91A 3S9CA 2BZ6H 2ZDAH 2R0KA 1SI5H 1EP6A 4XE4A 2G51A 4DJZB 1IQFA 4ZHLU 2SGAA 5CMXH 2XRCA 5F8XA 1ELDE 1NS3A 1MCTA 3MO6A 2KAIA 3ZVGA 5A2MH 1C1RA 3FP7E 1W8BH 5FAHA 2BY7X 1P57B 2BDIA 2WPKS 7GCHG 1GI3A 2ZC9H 1AGJA 3LC5A 1TNKA 5CHAB 1NRPH 4MQAA 3ZYEA 2QXJA 1YM0A 2OC0A 1Z8RA 3SJ9A 4ESTE 1X7AC 2ZF0H 2I6QA 2BD5A 2AMQA 4Y0YE 1O2KA 1DITH 1O2ZA 1Z6EA 3GYMA 1F7ZA 1FZZA 3PWCA 1K1OA 1O5EH 1TNLA 1K1PA 5DK1A 1V6DA 1XX9A 2PV9B 2FM2A 1HJAC 5AHGH 2OC7A 1SSXA 1YPHC 1FJSA 3OY6U 3RLYH 2J95A 1IQJA 3T5FH 2XWBI 4GCHG 3FP6E 5K7RA 4NA9H 1YPMH 1MU8B 1CA0B 2QIQA 3K9XB 1AVWA 1PPGE 1RTKA
chains in the Genus database with same CATH superfamily
5H1VA 3DFLA 1TX6A 1QRWA 4AFUA 2BOKA 1AIXH 2CHAC 2GV7A 1DT2A 2BQ6B 8ESTE 3A84A 3I77A 1C1OA 1CHOG 1THRH 1TA2A 1D3DB 2VNFA 1L4ZA 3W94A 4AZ2B 1A0HB 4O64A 2GMTB 1BRBE 4DIIH 4V3LC 2P3UB 4X1SU 2AGIX 3FL2A 4B73A 4AB8A 4A49A 1TALA 5B6LA 1P3CA 1YYY1 3SU5A 4YOJA 3M3VA 2OP9A 4X1PU 4IMZA 1HYIA 1V87A 1GMDG 4MDSA 1LQEA 2HNTC 1BMLA 4WZ2A 3SZNA 1C1TA 1RMDA 1LVOA 2VH0A 1CU1A 1MTNB 1XVOA 3EGKH 4UD9H 1S6LA 3T7LA 4TPIZ 5HIYA 1ZPCA 4O97A 2SGEE 4XFQA 5E2OA 1YPHE 3ITIA 3FZZA 3RTRB 2GCHG 4NIWA 3ZV9A 5BRRE 1O2WA 1J15A 1EASA 2PWXA 1GCTB 3PLBA 2XNIA 1AN1E 2ESTE 1ZBDB 3B23B 2FPZA 3GYLB 4ABIA 4KP0A 4B6EA 1ETRH 3M7UA 4ZHAA 8GCHG 4B2CA 2JDID 3SUBA 5IK2D 1TRYA 5L6NH 2ODYB 2ZGXH 1H9HE 2FSAA 1ZSKA 4SGAE 2ILNA 2PSYA 1FIZA 1OYTH 1RXPA 2PKSC 3SHCH 1U6GB 2AN6A 4X1NU 1K1LA 1GMHG 3SNDA 5BPEA 1UHBB 1K28D 1TOCB 3F0PA 4O03A 3M3TA 5DN6D 4ZCNA 1TONA 1W0ZU 4ABEA 1GBFA 3FOAA 3P8GA 5HIZA 1CVWH 1ABJH 5H9MA 2FOEA 3VB6A 5A8ZA 1GI4A 1GJ6A 1BJUA 4ZAEA 2VIDA 1FPCH 2GKVE 3L11A 2FOMB 4CA1A 2FI5E 1SLXB 3R3GB 4ISHH 3VGCC 3JZ2B 2FOFA 2MT5A 3UNSA 1DPOA 7GCHF 3P6ZB 5JBAS 3BTKE 2IN2A 3C1KA 1GJ7B 1UTQA 2ZU3A 1GDQA 2GCTC 2JETC 3JZ1B 2YREA 4Z0OA 4LK9A 4NIXA 1WTHD 2R9PA 1ETSH 1WEOA 1SFQB 3GCTG 4J2YB 1O2VA 4OS7A 3HGPA 3OE7D 1HUTH 3FJUB 1E34B 4CRDA 2WV5A 4RKJB 2Y1NA 2AGEX 1DXWA 3DWDA 1KIGH 1WV7H 1SGDE 1DSUA 1GJBB 1WIMA 4X8SH 5HM9A 2M6MA 1DUAA 4XBDA 2H1UA 1BZXE 1QA0A 2A31A 5SVXA 4B6FA 1FQ3A 4TKPB 1QURH 1NRRH 5FXLA 2NU0E 3LJOA 2H5CA 3VXEH 4GCHF 2F9PA 4QF3A 5B76A 1PFXC 2K17A 3O47A 3CS7A 1OOKB 3PMHB 3Q3KA 2C2LA 1ZHPA 3SBKA 1UVPA 4YAXA 4Y7BA 4AFZA 1C5XB 3LPRA 2HOBA 3MHHA 3M5OA 1A5GH 4JZDH 2NU1E 1SB1H 1NY22 1Q3XA 4DURA 2HPQH 4YM9A 1RIWB 4X1RU 3ZYQA 2G8TA 1NRSH 2DJAA 2V3HH 3CENA 5ETXA 5FX5A 4HI3A 3MH5A 2OD3B 2UWOA 1KLTA 3DHKH 3VB3A 2BYAX 1IQEA 2OLGA 2KGGA 3PLKA 2VINA 2Z9KA 5KECA 1DWBH 5PTPA 1EPTB 1GHBF 5LPRA 1AUJA 2ZGBH 5H1TA 1TFXA 4UFEH 3R0FA 2KWKA 4H6TA 2HYED 4VGCB 3TNTA 1JBUH 1Y5BT 2ZU2A 2JJ1D 4RT1A 3O35A 2Y5GA 2JIZD 1YCPM 4IC5A 1S84A 4YOIA 4FUGA 4GNEA 3TGJE 2J94A 3W95A 2GCHF 2QIZA 4UDWH 1O2UA 1MD8A 4NA7A 5B78A 3QN7A 1V2WT 2L80A 1SKYE 4KKDA 4AYCB 5SVYA 3OYPA 4BXSA 2ECVA 3F1SB 3MHSA 1EPTA 1K1JA 2JH6D 1UTJA 2XTTB 1O2MA 1AZ8A 1A3EH 1FUJA 1S5SA 1ZGIA 2QXHA 3EYDA 2J9NA 4I7YH 1Z71A 4XDEA 3RXTA 1JM7B 2P8OC 4I31A 4R7EA 1EAXA 3GDVA 4FOUC 2Z3CA 3NCLA 3GY6A 1T32A 1P05A 1IHSH 2PR3A 4R8TB 3GCOA 1MZDA 4FU8A 4X2YA 1A0LA 4YZUA 1V2VT 4U01A 2FI4E 4BOHA 3LT3A 1QBOA 1K9OE 2BDBA 3O7AA 2C8XB 3SUFA 2AGGX 2HGTH 3KYFA 3BN9A 1MABB 1H8HD 3PRBA 2EGMA 4Q6FA 1DXPA 1E38B 1O38A 3STIA 1GBAA 2ZFQH 1ZRKA 3Q3YA 2C4FH 2E6SA 3D49H 4Z1MD 2BY8X 5LKXA 3GS9A 1UCYK 5DO4H 4FUDA 4JCNA 4F4OC 1NC6A 5G4BA 3SHAH 2VWNA 6GCHG 5E0HA 4ISNA 2BLQA 1DS2E 2G4TA 4ZXXH 2C8YB 2GV6A 4MPVA 1TGTA 2STBE 4A0CD 4GHTA 4BAMB 2EA6A 2PUXB 2F9OA 4O9VA 1BTUA 1C1VH 3BTFE 1W0YH 3OU0A 4KTSA 3T62A 2PLXA 1O2YA 1V2MT 2A7HA 1VITG 1VYXA 3B8JA 3TPIZ 1QL7A 1TBQH 2Z6BD 4CBNA 3PMAB 1EX3A 3F2FA 2CKLB 3ZVDA 5AF9H 2XW9A 2H9HA 2L6OA 2IOTA 1BTPA 3RXQA 4DT4A 1KXDA 2YT5A 1TWXB 2BX3A 2OINA 3MWIU 3PV5A 2FTMA 4NIVA 2SFAA 5HXFA 1NFWA 4Q7YA 2H9TH 1GHZA 5IDKA 3SV6A 1JRSA 1GJ5H 4AORA 3MU4A 5A8YA 5A0BA 2BD9A 5AFZH 2ZP0H 5G0FA 2PTNA 1O5BB 5GIBA 3RMLH 2LXHC 3UY9A 4X3GA 1JIRA 4WMEA 1S0RA 2A4QA 4FU9A 1KTSB 2LGGA 1UJ1A 1ZHMA 1QB6A 1BQYA 3O8CA 3OTPA 4THNH 4XBBA 1C5LH 2CKLA 2OBOA 1EP5A 3I78A 4FUBA 4WJG2 4YC9A 4QF2A 1SOTA 3RXMA 1EOLA 3BIUH 1C4V2 1DY9A 4OS2A 1H8DH 1ZSJA 1E0FD 1SVPA 3BF6H 1BTZA 1O37A 3DUXH 3EQ0H 4ZUXU 1O2HA 1D6WA 3SU2A 3AVZA 4N3WA 1LVMA 1IAUA 4NGAH 2BVRH 1P9SA 5JBBS 1HAXB 2GZ8A 2Z3DA 2A7JA 2F83A 3N99A 1L1GA 1DVPA 2H2ZA 5JBCS 1UK2A 1LHDH 2BHGA 3IHPA 1L2EA 4ABAA 4E06H 2P16A 2KWOA 1V2RT 3SV9A 2PP6A 1BBRE 2KR7A 2AH4X 1L4DA 4GNFA 2CF9H 1C2IA 5DP4A 2M5TA 2LXPC 3LKWA 2XBWA 4SGBE 1ZTJA 5KH3A 4I8KA 5EYAF 4IBLH 4DIHH 1S0QA 5EU8A 1WEMA 1HAPH 2UWPA 4MNYA 3RM2H 2CSYA 4BHWA 2HLDD 2VB0A 1IQHA 4ZXYH 1C5RA 3MMGA 1DY8A 3VB7A 5HGGA 2BY6X 4X6NA 2PFEA 1ARBA 1ZSLA 4C9ZA 1T8OA 1TLDA 3SNAA 1LDJB 1BB0B 1C1NA 1QR3E 1O3LA 2XYAA 4Z0RA 1UK3A 3DT0H 1GBJA 1P2JA 2R2WU 1MKWK 4H4FA 1Z2QA 3RXUA 6LPRA 3H7TA 4XRNA 2R3UA 1HPGA 3A7XA 4WH6A 1BTYA 2Y82A 1P09A 1SGCA 2ZPQA 2YMSD 2J5UA 3BG4C 1CGIE 1H8IH 5H4IB 2VJFB 1ABIH 1LO6A 2ODQA 1SGPE 5F03A 3T25A 1O3NA 3GY5A 1Z1IA 4X6PA 5F6MA 1G37A 2EI6A 1NBMD 4MTBA 2Q6DA 3LJUX 1TPOA 4QT8C 3U5OA 4YLUA 1GBIA 1N6XA 2Z9JA 1ELEE 1X4IA 4TWWA 4IN1A 2KFWA 1GL1A 2BD2A 4IN2A 3QK1A 1BMFD 1J8AA 1Y3XA 4NCYA 2G6QA 3KL6A 2YQLA 3AK5A 1PPCE 2ZGHA 3EE0B 1QB1A 1ZTKA 3TK9A 5GDSH 2KYUA 3RXLA 1EUFA 5LKTA 1GCDA 3TITA 3BTDE 5C13A 1SLWB 2ZU4A 1P2NA 4A7IB 1OPHB 1GBLA 1NZQH 2IPQX 3OY5U 2VJFA 1W7GH 1BHXB 3E90B 5TDRA 3UQOA 3V43A 2WV4A 2CF8H 3PV4A 2F6NA 4CH8B 2ZFPH 1DDJA 2FX6A 2AHME 1W3CA 2D2DA 1XUHA 3OEHD 2ANYA 3U8OH 5C17A 3GCHC 2ZO3H 1O34A 5CHBA 1O2OA 2G43A 9LPRA 2C8WB 2A4OA 2BY9X 2WPDD 1Z6UA 4YLQH 1HAOH 1CGHA 1QGFA 5EODA 2ECJA 4LADB 1A2CH 2Z94A 4WY3A 3A8CA 1AKSB 1F0SA 2A32A 4RN6A 2B7DH 4ACAA 1TX8A 4DG4A 3N9QA 1SQRA 3ZZ4A 4JZ1A 3SU1A 4ASUD 5G05B 4YBMA 2UUKB 3KQDA 1AB9C 3QO6A 5LH8A 1TYNA 1TAWA 2KZ4A 1XVMA 3LGUA 1MCVA 2HRVA 5A0AE 1UVOA 3ZNIA 5EW2H 2JMJA 2XOCA 1TQ0B 1MMJN 1K22H 7LPRA 1VZQH 4AFQA 2LQ6A 1O2RA 3SGQE 2YW8A 2F42A 2ECGA 1C5OH 1P3EA 5KGOA 1EB2A 3PTBA 1XUKA 3F68H 1LHFH 1Y3UA 1WEVA 2YNAA 3KHVA 1G25A 1KXEA 2ECTA 1TE0A 2EY4C 2ZWLH 3ZZ3A 2KCAA 2IJD1 2KM0A 4BTUB 2EEKA 3UR6A 4XD7D 2YNBA 3ZVCA 1O30A 3LIWA 4ZUHA 1CBWB 2P3TB 3SUEA 4CR5A 3EA8A 4XSKU 3JUEA 1CSOE 5D1LB 1E35B 1W11U 2GDDA 2WUCA 1FP0A 3UQVA 1SLVB 1ELAA 1O3GA 4Y79A 1V2JT 1RRKA 3A7YA 4X1QU 3HPTB 4V3KC 5B77A 5FB0A 2M1RA 1AQ7A 4OS6A 1P8VC 3LONA 2AERH 4K5ZA 1C5PA 2H9EH 2GD4B 2H5DA 5LPFA 3GOVB 5DGJA 1WTGH 2PNXA 1BBRK 1GMCG 1C2JA 1V2ST 3MU8A 2ANMH 4RSPA 3BTGE 1XWHA 2VBCA 1B7XB 2NU3E 2P94A 4Y8YA 1VGCB 2YHNA 5F8TA 5D1MB 1Z1JA 3E8LA 1KDQA 1LKAA 1O2SA 1W0KD 2F43B 1YGCH 2VVUA 3GY8A 2F9BH 3O8DA 4INLA 1C2GA 2XC5A 5G04B 5DP6A 1N6YA 2JH0D 5I46H 1B5GH 1GI2A 1HAGE 2WV9A 4OGYA 2LGKA 4K1TA 2C90B 2ODPA 1O35A 1UTOA 1GJAB 1L1JA 3A81A 4R8PK 3KNVA 2BD4A 3K2UA 3LH3A 1P03A 3AAUA 1VJAU 5J4QA 1T4VH 2L5UA 1AY6H 1ELFA 2W7SA 1FY1A 2DSMA 2HWLB 3M61U 2VIOA 3ZZ6A 1FY3A 2G4UA 4IC2A 1A7SA 1WSSH 3LQIA 3F3BA 1YWUA 3ZVBA 1P04A 1SGTA 3FANA 4Q2KA 5E0GA 3MDBC 5SVIB 1MTWA 2MKEA 1CQQA 4JZIA 1TQ7B 3A7TA 1TBZH 3P8FA 3L1XA 1O2LA 1FAKH 3E16B 4OGXA 3OSYA 5LPEA 1EB1H 5EQRA 2FYQA 1GI6A 2BX4A 5C5NA 5JYIA 1F62A 3H09A 3P17H 2ZDMA 1XM1A 2LRIC 1GI1A 1SMFE 1SGQE 1K0HA 4FUHA 2A7CA 2GJGA 3S7KB 5KEDA 2TGTA 4L7XA 1ORFA 3ZVFA 5A09A 1QQUA 3ODFA 4HG6A 4NWLA 4S3OB 9ESTA 4FUCA 1QBVH 4A1VA 4LKAA 1TNJA 1Z7KA 3TJNA 3N7EA 1BTXA 3NXPA 3MTYA 3LGVA 1GWAA 2V35A 2A0QB 3E91A 4D7GA 1ANEA 3MHWU 2WUBA 1OP2A 5CHAC 2VPDA 5LGOA 1BIOA 1YPEH 2ZFFH 5K0HA 1DWDH 3DQVR 3LGWA 1QHRB 5D1KB 3KEEA 3MYWA 3SGAE 3E0PB 1P01A 1C2EA 3U69H 3M5NA 3WW7A 3MO9A 2SNWA 4B76A 2HVYB 3GDSA 1D4PB 1T7CA 3LQHA 3ZZ5A 1BTHH 3A7WA 4OGEA 2SGDE 3DSGA 3NKKA 1MAXA 1UTLM 2A5KA 4AOQA 1TGSZ 1VJ9U 1YLCA 4ZQLA 2ZG0H 2EQNA 3RMNH 2XOKD 1MKXK 1OSSA 4IMQA 5ABWA 1XXDA 2XB1A 3ESTA 1TABE 3ZZ8A 1C5YB 1SBWA 4X2XA 2SNVA 1T4UH 2HLCA 2A4GA 4AB9A 2CONA 5L2YH 1ZPZA 1ZPBA 2L7PA 1CE5A 1CA0C 1YY3A 3FZDA 4DVAU 2PGQB 4Z6AH 1E1QD 2JMDA 1K1MA 1SGRE 3KGPA 2RFKC 4YBTA 1K21H 2BDHA 2O8LA 2Y1MA 3RXVA 2VWOA 7ESTE 5FB1A 4F52B 4U32A 2NWNA 1O3IA 2FYRA 4BANB 1ELGA 3QTOH 2FOAA 5DG6A 4WH8A 4A6LA 2J97A 2M85A 4JZEH 1T31A 4GNGA 1OKXA 1NBME 1F5KU 3PUQA 2ALVA 2QXGA 3L1ZB 1FMGA 2XP0A 5DP7A 1VCWA 1MTNC 3BTQE 1FAXA 1G30B 4FXGH 3M3SA 4OM9A 5C20A 1PQ5A 5DP8A 1E37B 4H42U 2ZGJA 2RDEA 1NRQH 2QXIA 5EPYA 5EXMA 5LCWB 1ZZZA 1JRTA 2FOGA 1RGQA 2FLRH 2HNTE 4GVUA 4JYUH 4NWKA 2KIZA 3AW0A 1Y3VA 4MLFB 2ZHWH 2OTVA 3HK6B 6CHAB 1TIOA 1AHTH 3T29A 5I3LA 2BXTH 4GUXA 3C27B 1BCUH 3N9NA 2C2VS 5IYTA 4I32A 2YSMA 1S81A 2O9QA 2V0BA 1O2PA 3TK5A 4CRGA 4ZMAH 4O3UA 4YT6H 4AC9A 3WY8A 1RFNA 4TPYA 1DVAH 2B8OH 2F4LA 1OWJA 3M37A 1SGYE 2OXQC 3BTTE 1JXPA 3AASA 3URCA 1A5HA 4X2VA 3O36A 4F49A 1PYTC 1VR1H 2ANWA 2YSJA 4O3TA 2EXUA 1HV7A 1L0ZA 3P8NA 5C94A 1X4UA 4U30A 1EZUC 3LC3A 4UFFH 1P9UA 1AWFH 3S7HB 4AG1A 1TPPA 1GG6C 2ZDNA 2ZQ1A 2ECIA 1EAWA 3H7HA 2P57A 4ABBA 5B8DA 1DOJA 1TPAE 2EC9H 1GI7B 1LQDB 4NSVA 2IDAA 2FO9A 3RXCA 1V2PT 3M7QA 2YUCA 1PPZA 5EG4A 2OK5A 1DCQA 2UZGA 5T6DA 2EI7A 3BEFB 4IGDA 3WWBA 2WPIS 1P2IA 3TVJB 4BBQA 3RXRA 4FO9A 1BRAA 1FY5A 1GBCA 1WUNH 1ACBE 1BORA 3KIDU 2Q1JA 1MD7A 3P70B 5EXLA 1CHOF 2GX4A 1L1NA 1WQSA 4Y11E 3ZZDA 1ESBA 1A0JA 1V3XA 3SI3H 2G55A 3E3TA 3E2DA 1P12E 5DKAA 5B79A 2KR4A 1UCYH 4CRBA 5FPTA 3HKJB 1BTWA 2UUJB 5EGMA 3V0XA 1GMDF 4L58A 3F6UH 1RS0A 3BSQA 4M7GA 1BUIA 2FOBA 1YP9A 1Z6JH 4CRCA 4A1TA 3A83A 2XCFA 1PQ7A 3K65B 3SQHE 2ZGCA 3F9EA 1LKBA 2FXRA 2UUFB 2ZI2H 1TRNA 2J4IA 1K1IA 3PURA 2JJ2D 4CBOA 4ABJA 1B0FA 2FD4A 1GBHA 3P95A 4ZKOU 3EB6A 1G32B 3SOUA 2BZAA 5C5OA 4FIPA 3QZVA 2D8WA 5A8XA 1UTMA 2E6RA 4ZKNU 1IOEA 3O8BA 4AFSA 3LDYA 5I25A 1V2KT 2ECNA 3FN8A 3B9FH 3TH2H 5C0UA 1GHAG 3LVQE 1O33A 2I6SA 1FI8A 4BAKB 4ACBA 3A85A 1YLDA 3PWBA 1QTFA 5JPMH 1GGDB 2BOHB 3EA9A 5TCCA 1ZMJA 3VG8A 8GCHF 1O3AA 3Q3XA 3U8TH 2LPRA 4YT7H 2KGIA 5EQQA 3RXAA 4VGCC 2GTBA 4MSXA 1T8NA 1ESTA 4WVPE 1C4U2 1GMHF 2Y5HA 5AVDA 3SV8A 3N9LA 5FEYA 2NU2E 5EJZA 1G36A 3MI4A 1AE5A 3PB1E 1BMMH 1RTLA 1SHHB 3SU3A 3GY2A 2RI7A 4KGAA 2VIPA 1WU1A 2K4DA 4AP4A 1J16A 2ULLA 3A7VA 2PUYA 1QL9A 3M62A 4Y76A 3SJOA 4IC3A 5FL7D 1IQLA 3U28C 2V6NA 1HBTH 1F0RA 4ISIH 3TJUA 2BXUH 1O2NA 3GISB 3FVFB 3VEQB 1AE8H 4TYDA 1FONA 3IITA 2VJEB 1SC8U 1O3BA 1FPHH 3GCTF 4MVTA 2R2MB 3KCGH 2KCOA 3SN8A 3STJA 2NAAA 5TRBA 1HCGA 2WPMS 3U5NA 1NN6A 2LAUA 3FEHA 3O33A 5C1UA 2Y43A 2TRMA 4Y7AA 1W2KH 2W5EA 5TJXA 1GHYH 1AFQB 4B86C 2BLVA 2SGFE 4B2AA 3A86A 1EKBB 1XUJA 4INHA 4CHAB 1O0DH 4NA8A 1C5TA 2G00A 1O5GH 1TMUH 5EXNA 1NM6A 4WMFA 2VJEA 4YABA 1MKWH 3NRLA 1JM7A 1AWHB 2Q6GA 3RXJA 2F9VA 2CN0H 3RC5A 3HKIB 2K8IA 1GHWH 2B0OE 1VKYA 1LPZB 1C5WB 1TB6H 2GDEH 4FUJA 5EPNA 3O37A 3SOSA 1LHCH 1DWCH 4HFPB 3QLPH 1ELBA 3N9MA 2JKHA 3FO8D 4OS4A 5DSFA 2KU3A 2GT7A 5FCKA 1THPB 2YU4A 3PO1B 3AW1A 2LN0A 1ZMLA 1EJNA 2ZFTA 3QGNB 4NIYA 1BA8B 1XUFA 2FZZA 3EAJA 4K69A 3RPGB 1C5ZB 2XC0A 1QQ4A 1UTNA 1C4Y2 5JG6A 2Y80A 1QRZA 1HDTH 3MNSA 5T1VA 1UW7A 3DA9B 1T1HA 4Z0KA 1BRCE 4AGJA 4TY6A 4Q7XA 1FY4A 3T26A 2PGBB 2TGPZ 3HATH 2F9UA 1WYKA 3ZIAD 3KQIA 2FESH 2FDAA 3LOXA 3M35A 1SGEE 5FCRA 1J14A 5FPSA 1C5MD 1WOFA 3H7OA 3E6PH 4K8BA 3HTKC 1EAUA 5HKKD 1GI5A 1YC0A 1O3KA 3VFEA 2QY0B 1GDUA 1AI8H 1H9IE 1GHAF 3K6YA 2GVFA 1TNIA 2FP7B 5E8EH 3MU0A 4IS5A 4K1SA 5TCAA 3BG4B 4HGCA 3SU0A 1DWEH 4FUIA 3LQJA 1NU9A 1O2XA 2KCYA 4MNXA 3ATMA 1QY6A 4Y8XA 1SFIA 4I7DA 1SG8B 3RC6A 1C2MA 2RA3A 3TH4H 3T28A 3RXEA 1KY9A 4ZKRU 1O3OA 1YCPK 5GCHG 3IG6B 1GJ9B 2A4RA 4AVXA 1SQOA 1QRXA 2H0DA 3QWCH 1KSNA 2VJ1A 2VPGA 1FLEE 4OS1A 1PQAA 3Q00A 3S0NA 5B75A 3GDUA 1D3TB 1P2QA 3UTUH 4DOQA 2A2XH 3KNXA 4JMYA 3BTME 2VGCC 2KX4A 2OUAA 3D65E 2YVRA 1UTPA 2HDPA 5ESBA 1GBKA 1IQNA 1QL8A 1PPEE 6GCHF 4GPGA 5H1UA 1DLKB 4ASHA 2ZTYA 3KF2A 1C1QA 3RXKA 1TBRH 5EJLA 1ZRBA 2K1JA 1OHHD 1XUGA 3SORA 2CMYA 1O3PB 2BAYA 3S9BA 1VITF 2BVXH 1ARCA 1KXCA 1GVKB 1O2QA 4WWYA 1Z8JB 1JOUB 1BBRH 3KV5A 2MNYA 3A8DA 3PHDA 3LGIA 2ZKSA 1IQMA 3SU6A 2LDRA 3SOXA 3E0NB 4I8LA 5C11A 2ZNKH 2CT2A 4UFGH 1SGNE 1U6QA 2TGAA 4GLYA 3UUZA 3UWIA 1WCZA 1LPGB 2QICA 1BHXF 1EATA 3Q1DA 2M2AA 1UO6A 3GICB 3PRDA 3ZVYA 1D9IA 4CR9A 4B7YC 1T8MA 3OTJE 1GJCB 2WPLS 2M13A 2BLOA 3CP7A 4LLBA 4PPEA 1HAVA 3RU4D 1O2IA 1V2QT 3ZTGA 1OWDA 1EAIA 3KQCA 2EODA 2AEIH 1WEEA 2XEUA 4I8HA 4Q80A 2JH5D 1EZSC 3UR9A 2RSDA 1V2UT 1LVBA 3ZPVE 1ZYOA 2WYJA 4Y8ZA 2THFB 3V13A 3NK8A 3MNXA 3KQEA 2ZETC 3URDA 4MPXA 1P2MA 3HGNA 1TA6A 3UOUA 2QF3A 3M5MA 1QA7A 2Q6FA 2K16A 1UVUH 2OXSA 1E4UA 2P95A 3TIUA 3VB4A 1KDQB 1O3FA 1N8OC 3ZVZB 3L33A 2ZECA 3KQBA 4JK5A 4CRFA 1GI0A 3UNRA 1G2MA 1F2SE 1GHVH 1V2NT 2LV9A 3ATWA 3SHBA 2VWMA 1VFYA 4F48B 3QX5H 3KYGA 3T27A 4BAOB 3CS0A 3NWUA 1TNHA 2STAE 3RM0H 1MBQA 3BTEE 3GY7A 1GPZA 3SJKA 3SJIA 2QA9E 6ESTA 1PYTD 1DANH 3TJVA 2VH6A 3U8RH 2A5IA 2BMGB 2ZEBA 4D9RA 1A3BH 1BMNH 3F9HA 3TK6A 2C93B 5E0JA 2V3OH 4AX9H 3VPKA 4FUEA 1HIAA 1SLUB 1IQIA 2QGRA 3IWMA 5L30H 4WMDA 2F6JA 4UEHH 2VPBA 1EXFA 1DE7H 1YPKH 2TPIZ 2ZHDA 5L2ZH 1AMHA 1C5SA 1AVXA 3MFJA 4J1YA 1OX1A 3SW2B 4DT7B 1DLEA 1HAYB 4R0IA 1E79D 2Z9GA 3RXOA 1HAHH 4AUQB 2KREA 1TNGA 2Z7FE 2FI3E 4ZKSU 3V7TA 3T6RA 5J4SA 1MKXH 3RMOH 4ZH8A 4TSFD 4WA6A 3SUDA 3F9FA 1CHCA 1BDAA 5FHTA 1QJ6B 3C5KA 1SGFG 2G81E 4DY7B 3VK6A 1YBWA 1S6FA 1GJDB 1O3EA 1VGCC 2MUMA 4GB0A 4INKA 1T8LA 1HB0B 2VIWA 2IPHA 1BMAA 3SNBA 3SV2H 1VITH 2ZIQH 3PYHA 4XOJA 1MQ5A 1UK4A 4MNWA 1DM4B 1ZOMA 3C6WA 1QCPA 4TT3D 1C5QA 1P11E 1O36A 2VVCA 1C5NH 1QZ8A 1HJAB 2LP6A 3TNSA 5AITA 3A88A 2XBYA 4B1TA 1Y3YA 1A61H 4GAWA 1OP0A 1C2LA 1GDNA 2CK3D 3PM3A 4LXBH 2ANKH 2PKAA 5EJ1A 2BM2A 3DSPA 5TDWA 2BTCE 2OQUA 2J98B 2YMSB 4LJNA 4NFEA 3S69A 3U5MA 5EOKA 1OXGA 3P8OA 1UVSH 5CE1A 1FN8A 1O3MA 2TIOA 2QF5A 2CHAB 3MOCA 1XKBC 3O70A 3PLPA 1V2TT 4N4FA 3RXSA 4H6SB 3WWFA 5ESTE 1C1MA 4B75A 2TGDA 3GCNA 4Y0ZE 3NPSA 1KXBA 1TMTH 1Q31A 3A80A 1P0SH 1S85A 2QV1A 1F5LA 2ZDKA 2Y6TA 1O39A 4BAHB 1DSTA 5AFYH 4AYYB 3RXIA 1HGTH 3ASLA 5JB9S 1MU6B 2W6JD 4E7RG 3SV7A 1MM3A 2Z9LA 5F53A 4UP0A 1QNJA 2QF4A 4W4UA 3HK3B 3PMJA 3QUMP 2J98A 2WINI 5DJ7A 5FX6A 4I33A 4H9DA 1Z8GA 2W7UA 1EJAA 3MNCA 2ZDLA 4IW4E 1WEUA 4S3OC 4LZ1H 3RC4A 3SGBE 1Z8IB 2YHOA 1HXEH 1LMWB 1UTKA 3BTHE 4K60A 4PTBA 2F3CE 3SJ8A 2VIVA 1PPHE 4QQ4A 1C9TA 3DSOA 2HNTF 4OS5A 2K0QA 1KYNA 5HM2A 1TGBA 3RMMH 4NZQA 1ELTA 2LELA 2ZU5A 3L3TA 3SUGA 2EGPA 2P3FH 3M7TA 1GHBG 1COWD 1XKAC 3NUMA 3ZZBA 1GMCF 2GMTC 3ZYDA 1Y5AT 1SHYA 3UNQA 2PKSB 2OC1A 1KTTB 5FERA 2QYIA 3UREA 4K8YA 1GBTA 2ZFRH 4FETA 1N1LA 2J38A 3BTWE 4CH2B 5T3HA 1C1SA 3EA7A 1GBMA 4D76A 1NROH 3F9GA 2WYGA 2WZQA 1GHXH 1PPBH 1BITA 3A87A 3F0OA 2Z3EA 2O8MA 1CHGA 3HCUA 1E1RD 1W14U 2GZ7A 3BEIB 3CNRA 1X4JA 2OWAA 2O8UA 4I8JA 1ETTH 4RKOB 4FVDA 4LK4A 2JRJA 4UP5A 3VGCB 3SOWA 4PROA 3TH3H 2LNCA 4NFFA 4WF8A 5E2PA 3OEED 3RXBA 2MD8C 1WFKA 1EZQA 3K6ZA 2GCTB 2JETB 4YTAA 1F92A 1FIWA 1G9IE 3BEUA 2YOLA 4K3JA 1MM2A 1Y3WA 1G3CA 3GV4A 1HJ8A 1Y8TA 2FX4A 2GGVB 4Q7ZA 3QDZB 4B2BA 2F9NA 1RTFB 2CSZA 1GCTC 1V2OT 5EQSA 1P02A 4FVBA 2VU8E 2ZU1A 1JIMA 1WENA 1XUIA 1GJ8B 1NT1A 4A4BA 3TJOA 4K1EA 3BV9B 3FAOA 1TX7A 5GXPA 2QE7D 1MTUA 4I7BA 1FV9A 2OQ5A 1SGFA 3LDXH 1UCYE 1S82A 1KLIH 1NO9H 5SGAE 1Z60A 1GG6B 1CT0E 1HLTH 2FOHA 2CSVA 1Y5UT 2DE9A 2PW8H 4ISOA 3OX7U 1NFUA 2Y81A 1YPGH 3OAAD 1HRTH 3RUOA 2FWWA 3UIRA 2I50A 1GBDA 3KQ5A 3TGIE 1S83A 1ID5H 4AG2A 1UMAH 3RU4E 1C2HA 2KE1A 1WE9A 1PJPA 2Y7XA 4YADA 1QB9A 3GY3A 1UHBA 3UOPA 4MVNA 2PUQH 3M63A 3RXHA 6CHAC 1HXFH 1LTOA 2BQWB 3NZIA 3LGTA 4CCGX 3MQKC 1C2KA 1P2OA 1HFDA 3RXDA 3LGYA 3BIVH 1AO5A 2G5VA 2ZCHP 2YURA 3ZZ7A 3Q77A 1O3DA 4ZHMU 4Y71A 2CJIA 1PQ8A 5KH9A 2RR4A 1OWIA 3DD2H 1JMOH 1DUEA 4LOYH 1GVLA 3MH4A 2QAAA 1ZLRA 1C1UH 1J9CH 4YO9A 1WBGB 3MH6A 2P93A 1A4WH 4A92A 4ISLA 5FPYA 4GSOA 2L0BA 2B0FA 1D3PB 2UUYA 2VPEA 4A4CA 1OS8A 1P06A 1G3EA 1HJ9A 1OP8A 4R2YA 4K2YA 1JWTA 1W10U 2HALA 1LCYA 2VIQA 2ZHQH 5C3NA 2EI8A 2QN5T 4IC6A 3UB0A 3TGKE 2FIRH 1ZHRA 2WPJS 3SNCA 2SGPE 4X6MA 4CRAA 2GP9B 4X6OA 4D8NA 3H5CB 1IYMA 3SZEA 1ESAA 2IQJA 1GBBA 4MPWA 1W7XH 2AMPA 4HTCH 1CA8B 1JOCA 2WSSD 5JDUB 2C8ZB 2G45A 3QTVH 1GBEA 1DX5M 1KMHB 1RIWC 1MH0A 1YPLH 3VB5A 2MIQA 4FU7A 2XOYA 3UPEA 2FEQH 2P8OB 2ZFSA 4P5OB 2E61A 4B71A 2WPHS 1O32A 3EE7A 3ZV8A 1GI8B 2TBSA 4NG9H 3T9KA 2K1QA 2KKXA 2MA5A 1N87A 1H9LB 5DP9A 1HNEE 1EPTC 4GHQA 4DW2U 3DDTA 1H8ED 3ZVAA 3TLOA 4MNVA 5AIUA 4KTCA 3ATLA 3V12A 2MNZA 3U1JB 1XXFA 4A5TS 1WESA 2BB4A 2ZQ2A 2A45B 2BVSH 2ALPA 2RCEA 2W6ID 1TGNA 1WDIA 1MAYA 1WXRA 3A89A 1D3QB 2D26C 4A1XA 1FBVA 1A5IA 4Y6DA 2AYWA 1DFPA 1NESE 2CV3A 2H6MA 1IHTH 2BD3A 2O8WA 4WXIA 5EW1H 3A82A 1ZJKA 2G5NA 1VCPA 1DICA 2VP7A 4UONA 1HYJA 1BJVA 2BD7A 3QZRA 5B6OA 2DE8A 3ENSB 2OC8A 3ZZCA 4NZLA 5GWZA 1O2GH 3DCLA 1MTVA 1GGDC 1W12U 3ZPV1 1G3BA 4AYCA 2ZDVH 1NFYA 2FS9A 2A2QH 2JMIA 1O2JA 2BY5X 1K2I1 1O2TA 3U98H 1OWKA 1O5CB 1RD3B 1A46H 2FLBH 5KH7A 2BLWA 2ZHFH 5T6GA 2CRWA 1QJ7B 3MNBA 3LRQA 3QGJA 4E7NA 3NG2A 4CREA 1LHEH 4ABHA 2GT8A 4BTTB 4F55A 4DGJA 2QF0A 3EDXB 7KMEH 2XBVA 2QJ0A 1SQAA 1KLJH 2V7QD 3ZZAA 3QZQA 5DINA 1HAZB 3UWJH 2HPPH 1AVGH 3KDEC 4AYVB 2RG3A 4BAQB 1H4WA 1YCPH 4WZ0A 1AFEH 2GZ9A 1EJMA 2PSXA 1O5AB 5CDFE 3N7DA 1O5FH 3LH1A 1K2FA 1ANDA 1SGIB 5HMAA 1AZZA 2BDAA 1AD8H 1TGCA 3LU9B 1QFKH 2KWJA 2J34A 5A0CA 3HCTA 2ZPRA 4UFDH 1EZXC 3AAVA 1AFQC 5GJ4B 1J17T 2MA6A 4F1PA 1PPFE 1NTPA 2FUUA 1ANBA 4CHAC 3RDZA 1E36B 4RT0A 2YQMA 1O31A 4I86A 3ZVEA 3D62A 3MH7A 2ZHEH 1WQVH 1IQKA 4D7FA 5GPIB 2RDLA 1P10A 2XNDD 1V2LT 1THSH 3HCSA 1WEPA 2LGLA 2PTCE 2EA3A 1QJ1B 1SPJA 3U9AH 2R3YA 1G3DA 2VWLA 2KFTA 3I2DA 1BT7A 2YYRA 3U1IB 2XOZA 1QIXB 1ZJDA 3EB5A 2ZA5A 2Z9IA 5JB8S 3GY4A 4ABDA 3Q76A 1CT2E 1MZAA 2ZPSA 3M36A 4Q63A 2H0DB 3T2NA 4B74A 5LKZA 2XXLA 1MBMA 3PO1C 1Y59T 1ZGVA 4X8TH 1SQTA 1ZMNA 2V3MA 1GJ4H 2XC4A 3UAIC 4E05H 3FKSD 2JM3A 1O3JA 3RPGC 3KN2A 2MD7B 4ABGA 5LKUA 2L43A 1H1BA 1YKTA 4LZ4B 3UFAA 1GL0E 1ELVA 1FNIA 2ZCKP 4X2WA 2VVVA 1OWEA 1FY8E 1B0EA 2OCVB 1HAIH 2Y5FA 2ZZUH 3MU5A 3MU1A 5JBTA 1EOJA 1UVTH 3ELAH 2BDCA 3G01A 5FBIA 3RXGA 5EIYA 1TRMA 2B5TB 3TU7H 2VGCB 2JUNA 1F5RA 2ZTZA 2ECWA 1INCA 3RLWH 3PLWA 1TOMH 4Q4LA 3P92A 2XBXA 4JYVH 1NPMA 1SOZA 1C9PA 5DP5A 1C2DA 4YXWD 3O34A 1CT4E 4BXWA 3GL6A 4ZROA 4X8VH 8KME2 2QCYA 4X0WU 2L74A 2XWAA 1MQ6A 2RA0A 8LPRA 3ATKA 1IQGA 2AFQB 2FOCA 2J92A 4JZFH 5TABA 1KXAA 1MTSA 1M9UA 2M3HA 4AGKA 1NU7B 2SGQE 1C2FA 3GCHB 3RP2A 1TPSA 4KELA 3SNEA 3E1XB 1G2LA 1CO7E 3RXFA 4ZDTA 4ABFA 1HAVB 2AMDA 2BQ7B 4KTUA 4XBCA 1KXFA 1ELCA 5C1YA 1NRNH 2KKYA 3A8BA 1O5DH 5F8ZA 4GNDA 2KCPA 3MO3A 2AIPA 5J3XA 1TMBH 4P02A 1CGJE 3RXPA 4HZHA 1AB9B 2ZCLP 5C2ZA 1FDPA 1ZTLA 2FFWA 3N9OA 1P2KA 3PV2A 1ZR0A 3SQEE 3BG8A 4JK6A 2CXVA 2R0LA 4M9FA 3N7OA 2W3KA 4UE7H 4JYTA 1LHGH 5HYOA 3PMBB 3FFGA 3ATIA 4MG3A 4WXVA 2BDGA 1SL3A 3ZZ9A 2FTLE 4FJCA 4BNRA 4FUFA 3L6PA 1S6HA 5C1XA 5C67A 1F0TA 2HVXA 3DPLR 4NSYA 2ASUB 5GNDA 5K3QA 1N8OB 4BTIB 2J2UA 4YATA 2WHXA 3LJJA 4Y10E 4P00A 1NFXA 5DPAA 1C1PA 2UWLA 5T6FA 5FBEA 3D23A 2AS9A 1FXYA 1VCQA 2Y7ZA 2FMJA 4AN7A 3RU4T 1YF4A 2CGAA 3M99A 1D6RA 2C3SA 1EQ9A 1HIAB 1LPKB 1WAYB 2PHBA 1FN6A 1OYQA 1W13U 2NU4E 2W3IA 4YESB 1AUTC 3VXFH 1SR5C 1QBNA 2FODA 3FP8E 4X8UH 2L75A 3I29A 1AU8A 1LVYA 3SU4A 2ZTXA 4D9QA 1GVZA 2D8SA 3PTNA 1AKSA 4TWYA 2B9LA 4RI0A 2A1DB 3SYJA 4FK5A 2W26A 1K1NA 1Q2WA 2A5AA 1ANCA 1F0UA 3OFND 2D1JA 2BD8A 1BRUP 4UI9B 1MUEB 2QC2A 1LDTT 1BOQA 1YPJH 2XCNA 3SO3A 4YOGA 1O3HA 3PROA 1CBWC 1RJXB 1FX0B 1YLNA 2G52A 4U2WA 1VD4A 2DUCA 4TY7A 1XMNB 5C0TA 4MPUA 5GCHF 1WGMA 3S9AA 2AIQA 1C5VA 1HYLA 2OBQA 2VNTA 3SI4H 2D8UA 5DP3A 2IJOB 2O8TA 2KAIB 1A1RA 4DCDA 1O3CA 3F2HA 3M5LA 3V3MA 1C5UA 3ODDA 3O8RA 1EFRD 2BDYA 1GI9B 3DFJA 4I8GA 3A7ZA 2FUIA 4NN2A 1C1WH 2PKAB 2P59A 5DKMA 1OWHA 3A8AA 2FS8A 3LVRE 2F91A 3S9CA 2BZ6H 2ZDAH 2R0KA 1SI5H 1EP6A 4XE4A 2G51A 4DJZB 2LGVA 1IQFA 4ZHLU 2SGAA 5CMXH 2XRCA 5F8XA 1ELDE 1NS3A 3M7KA 1MCTA 3MO6A 2KAIA 3ZVGA 5A2MH 1C1RA 3FP7E 1W8BH 5FAHA 1WEWA 2BY7X 1P57B 2BDIA 2WPKS 7GCHG 1GI3A 2ZC9H 1AGJA 3LC5A 1TNKA 4YBSA 5CHAB 1NRPH 4OGCA 3N9PA 3KV6A 4MQAA 3ZYEA 2QXJA 3W1EA 4O62A 1YM0A 2OC0A 4I7CA 1Z8RA 3SJ9A 4XI1A 4ESTE 2KWNA 2DX8A 1X7AC 2ZF0H 2I6QA 2CRRA 2BD5A 3U5PA 2AMQA 4Y0YE 1O2KA 1DITH 1O2ZA 1Z6EA 3GYMA 1F7ZA 1FZZA 1LDKC 3PWCA 1K1OA 1O5EH 1TNLA 1K1PA 5DK1A 1V6DA 1XX9A 2PV9B 2FM2A 1HJAC 5AHGH 2OC7A 1SSXA 1YPHC 1FJSA 3OY6U 3RLYH 2J95A 1IQJA 3T5FH 3FM8C 5SVIA 2XWBI 3F2GA 4GCHG 3FP6E 5K7RA 4WZ3B 4NA9H 1YPMH 1MU8B 1CA0B 2QIQA 1WEQA 3K9XB 5TBNA 1AVWA 1PPGE 1W0JD 1WILA 2YMSC 1RTKA
chains in the Genus database with same CATH topology
3DFLA 1TX6A 1QRWA 4AFUA 2BOKA 1AIXH 2CHAC 2GV7A 1DT2A 2BQ6B 8ESTE 3A84A 3I77A 1C1OA 1CHOG 1THRH 1TA2A 1D3DB 1L4ZA 3W94A 4AZ2B 1A0HB 2GMTB 1BRBE 4DIIH 2P3UB 4X1SU 2AGIX 4B73A 4AB8A 1TALA 1P3CA 1YYY1 3SU5A 4YOJA 3M3VA 2OP9A 4X1PU 4IMZA 1GMDG 4MDSA 1LQEA 2HNTC 1BMLA 3SZNA 1C1TA 1LVOA 2VH0A 1CU1A 1MTNB 1XVOA 3EGKH 4UD9H 4TPIZ 1ZPCA 4O97A 2SGEE 4XFQA 5E2OA 1YPHE 3ITIA 3FZZA 2GCHG 4NIWA 3ZV9A 5BRRE 1O2WA 1J15A 1EASA 2PWXA 1GCTB 3PLBA 2XNIA 1AN1E 2ESTE 3B23B 2FPZA 3GYLB 4ABIA 4KP0A 1ETRH 3M7UA 4ZHAA 8GCHG 4B2CA 1TRYA 5L6NH 2ODYB 2ZGXH 1H9HE 1ZSKA 4SGAE 2ILNA 2PSYA 1FIZA 1OYTH 1RXPA 2PKSC 3SHCH 4X1NU 1K1LA 1GMHG 3SNDA 5BPEA 1UHBB 1K28D 1TOCB 4O03A 3M3TA 1TONA 1W0ZU 4ABEA 1GBFA 3P8GA 1CVWH 1ABJH 2FOEA 3VB6A 5A8ZA 1GI4A 1GJ6A 1BJUA 4ZAEA 2VIDA 1FPCH 2GKVE 2FOMB 2FI5E 1SLXB 3R3GB 4ISHH 3VGCC 3JZ2B 2FOFA 3UNSA 1DPOA 7GCHF 3P6ZB 5JBAS 3BTKE 2IN2A 3C1KA 1GJ7B 1UTQA 2ZU3A 1GDQA 2GCTC 2JETC 3JZ1B 4NIXA 1WTHD 2R9PA 1ETSH 1SFQB 3GCTG 4J2YB 1O2VA 4OS7A 3HGPA 1HUTH 1E34B 4CRDA 2WV5A 4RKJB 2AGEX 1DXWA 1KIGH 1WV7H 1SGDE 1DSUA 1GJBB 4X8SH 5HM9A 1DUAA 4XBDA 2H1UA 1BZXE 1QA0A 2A31A 1FQ3A 1QURH 1NRRH 5FXLA 2NU0E 3LJOA 2H5CA 3VXEH 4GCHF 2F9PA 1PFXC 3CS7A 1OOKB 3PMHB 3Q3KA 1ZHPA 3SBKA 1UVPA 4Y7BA 4AFZA 1C5XB 3LPRA 2HOBA 3M5OA 1A5GH 4JZDH 2NU1E 1SB1H 1NY22 1Q3XA 4DURA 2HPQH 4YM9A 1RIWB 4X1RU 2G8TA 1NRSH 2V3HH 3CENA 5ETXA 5FX5A 4HI3A 3MH5A 2OD3B 2UWOA 1KLTA 3DHKH 3VB3A 2BYAX 1IQEA 2OLGA 3PLKA 2VINA 2Z9KA 1DWBH 5PTPA 1EPTB 1GHBF 5LPRA 1AUJA 2ZGBH 1TFXA 4UFEH 3R0FA 4H6TA 4VGCB 3TNTA 1JBUH 1Y5BT 2ZU2A 2Y5GA 1YCPM 4IC5A 1S84A 4YOIA 4FUGA 3TGJE 2J94A 3W95A 2GCHF 4UDWH 1O2UA 1MD8A 4NA7A 3QN7A 1V2WT 4KKDA 3OYPA 4BXSA 3F1SB 1EPTA 1K1JA 2JH6D 1UTJA 2XTTB 1O2MA 1AZ8A 1A3EH 1FUJA 1S5SA 1ZGIA 2QXHA 3EYDA 2J9NA 4I7YH 1Z71A 4XDEA 3RXTA 2P8OC 4I31A 1EAXA 3GDVA 2Z3CA 3NCLA 3GY6A 1T32A 1P05A 1IHSH 2PR3A 4R8TB 3GCOA 1MZDA 4FU8A 4X2YA 1A0LA 4YZUA 1V2VT 4U01A 2FI4E 4BOHA 3LT3A 1QBOA 1K9OE 2BDBA 2C8XB 3SUFA 2AGGX 2HGTH 3BN9A 1DXPA 1E38B 1O38A 3STIA 1GBAA 2ZFQH 1ZRKA 3Q3YA 2C4FH 3D49H 2BY8X 1UCYK 5DO4H 4FUDA 4JCNA 4F4OC 1NC6A 5G4BA 3SHAH 2VWNA 6GCHG 5E0HA 4ISNA 2BLQA 1DS2E 2G4TA 4ZXXH 2C8YB 2GV6A 4MPVA 1TGTA 2STBE 4GHTA 4BAMB 2PUXB 2F9OA 4O9VA 1BTUA 1C1VH 3BTFE 1W0YH 3OU0A 4KTSA 3T62A 2PLXA 1O2YA 1V2MT 2A7HA 1VITG 3B8JA 3TPIZ 1QL7A 1TBQH 2Z6BD 4CBNA 3PMAB 1EX3A 3ZVDA 5AF9H 2XW9A 2H9HA 2IOTA 1BTPA 3RXQA 1KXDA 1TWXB 2BX3A 2OINA 3MWIU 2FTMA 4NIVA 2SFAA 5HXFA 1NFWA 4Q7YA 2H9TH 1GHZA 5IDKA 3SV6A 1JRSA 1GJ5H 4AORA 3MU4A 5A8YA 5A0BA 2BD9A 5AFZH 2ZP0H 2PTNA 1O5BB 5GIBA 3RMLH 3UY9A 1JIRA 4WMEA 1S0RA 2A4QA 4FU9A 1KTSB 1UJ1A 1ZHMA 1QB6A 1BQYA 3O8CA 4THNH 4XBBA 1C5LH 2OBOA 1EP5A 3I78A 4FUBA 4WJG2 1SOTA 3RXMA 1EOLA 3BIUH 1C4V2 1DY9A 4OS2A 1H8DH 1ZSJA 1E0FD 1SVPA 3BF6H 1BTZA 1O37A 3DUXH 3EQ0H 1O2HA 1D6WA 3SU2A 3AVZA 1LVMA 1IAUA 4NGAH 2BVRH 1P9SA 5JBBS 1HAXB 2GZ8A 2Z3DA 2A7JA 2F83A 1L1GA 2H2ZA 5JBCS 1UK2A 1LHDH 2BHGA 1L2EA 4ABAA 4E06H 2P16A 1V2RT 3SV9A 1BBRE 2AH4X 1L4DA 2CF9H 1C2IA 5DP4A 2M5TA 3LKWA 2XBWA 4SGBE 1ZTJA 4I8KA 4IBLH 4DIHH 1S0QA 5EU8A 1HAPH 2UWPA 4MNYA 3RM2H 2VB0A 1IQHA 4ZXYH 1C5RA 3MMGA 1DY8A 3VB7A 5HGGA 2BY6X 4X6NA 2PFEA 1ARBA 1ZSLA 1T8OA 1TLDA 3SNAA 1BB0B 1C1NA 1QR3E 1O3LA 2XYAA 1UK3A 3DT0H 1GBJA 1P2JA 2R2WU 1MKWK 4H4FA 3RXUA 6LPRA 3H7TA 2R3UA 1HPGA 3A7XA 4WH6A 1BTYA 2Y82A 1P09A 1SGCA 2ZPQA 3BG4C 1CGIE 1H8IH 5H4IB 1ABIH 1LO6A 2ODQA 1SGPE 5F03A 3T25A 1O3NA 3GY5A 1Z1IA 4X6PA 5F6MA 1G37A 2EI6A 4MTBA 2Q6DA 1TPOA 4QT8C 4YLUA 1GBIA 1N6XA 2Z9JA 1ELEE 4TWWA 4IN1A 1GL1A 2BD2A 4IN2A 3QK1A 1J8AA 4NCYA 1Y3XA 3KL6A 1PPCE 2ZGHA 3EE0B 1QB1A 1ZTKA 3TK9A 5GDSH 3RXLA 1EUFA 1GCDA 3TITA 3BTDE 1SLWB 2ZU4A 1P2NA 4A7IB 1OPHB 1GBLA 1NZQH 3OY5U 1W7GH 1BHXB 3E90B 3UQOA 2WV4A 2CF8H 3PV4A 4CH8B 2ZFPH 1DDJA 2FX6A 1W3CA 2D2DA 1XUHA 2ANYA 3U8OH 3GCHC 2ZO3H 1O34A 1O2OA 9LPRA 2C8WB 2A4OA 2BY9X 4YLQH 1HAOH 1CGHA 1QGFA 5EODA 1A2CH 2Z94A 4WY3A 3A8CA 1AKSB 1F0SA 2A32A 4RN6A 2B7DH 1TX8A 4DG4A 3ZZ4A 4JZ1A 3SU1A 2UUKB 3KQDA 1AB9C 3QO6A 5LH8A 1TYNA 1TAWA 1XVMA 3LGUA 1MCVA 2HRVA 5A0AE 1UVOA 5EW2H 1TQ0B 1MMJN 1K22H 7LPRA 1VZQH 4AFQA 1O2RA 3SGQE 1C5OH 1P3EA 1EB2A 3PTBA 1XUKA 3F68H 1LHFH 1Y3UA 2YNAA 3KHVA 1KXEA 1TE0A 2ZWLH 3ZZ3A 4BTUB 2EEKA 3UR6A 2YNBA 3ZVCA 1O30A 3LIWA 4ZUHA 1CBWB 2P3TB 3SUEA 4CR5A 3EA8A 4XSKU 1CSOE 1E35B 1W11U 2GDDA 2WUCA 3UQVA 1SLVB 1ELAA 1O3GA 4Y79A 1V2JT 1RRKA 3A7YA 4X1QU 3HPTB 1AQ7A 4OS6A 1P8VC 3LONA 2AERH 4K5ZA 1C5PA 2H9EH 2GD4B 2H5DA 5LPFA 3GOVB 5DGJA 1WTGH 1BBRK 1GMCG 1C2JA 1V2ST 3MU8A 2ANMH 4RSPA 3BTGE 4Y8YA 1B7XB 2NU3E 2P94A 1VGCB 5F8TA 1Z1JA 3E8LA 1KDQA 1LKAA 1O2SA 1YGCH 2VVUA 3GY8A 2F9BH 3O8DA 4INLA 1C2GA 2XC5A 5DP6A 1N6YA 2JH0D 5I46H 1B5GH 1GI2A 1HAGE 4OGYA 4K1TA 2C90B 2ODPA 1O35A 1UTOA 1GJAB 1L1JA 3A81A 2BD4A 3K2UA 3LH3A 1P03A 3AAUA 1VJAU 5J4QA 1T4VH 1AY6H 1ELFA 2W7SA 1FY1A 2HWLB 3M61U 2VIOA 3ZZ6A 1FY3A 2G4UA 1A7SA 1WSSH 3ZVBA 1P04A 1SGTA 3FANA 4Q2KA 5E0GA 1MTWA 1CQQA 4JZIA 1TQ7B 3A7TA 1TBZH 3P8FA 1O2LA 1FAKH 3E16B 4OGXA 3OSYA 5LPEA 1EB1H 5EQRA 2FYQA 1GI6A 2BX4A 5C5NA 5JYIA 3P17H 2ZDMA 1XM1A 1GI1A 1SMFE 1SGQE 4FUHA 2A7CA 3S7KB 2TGTA 1ORFA 3ZVFA 5A09A 1QQUA <