3FANA

Crystal structure of chymotrypsin-like protease/proteinase (3clsp/nsp4) of porcine reproductive and respiratory syndrome virus (prrsv)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
197
structure length
192
Chain Sequence
FRTQKPSLNTVNVVGSSMGSGGVFTIDGKIKCVTAAHVLTGNSARVSGVGFNQMLDFDVKGDFAIADCPNWQGVAPKAQFCEDGWTGRAYWLTSSGVEPGVIGNGFAFCFTACGDSGSPVITEAGELVGVHTGGGIVTRPSGQFCNVKPIKLSELSEFFAGPKVPLGDVKIGSHIIKDTCEVPSDLCALLAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and cleavage specificity of the chymotrypsin-like serine protease (3CLSP/nsp4) of Porcine Reproductive and Respiratory Syndrome Virus (PRRSV).
pubmed doi rcsb
source organism Porcine respiratory and reproductive syndrome virus
molecule tags Hydrolase
molecule keywords Non-structural protein
total genus 45
structure length 192
sequence length 197
ec nomenclature ec 3.4.21.114: Equine arterivirus serine peptidase.
pdb deposition date 2008-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3fanA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3fanA02
3.30.40.20 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Chymotrypsin-like serine protease; domain 3 3fanA03
5IYTA 2GCHF 2FOHA 1HAIH 3SORA 5J4QA 1CSOE 2STBE 1NRPH 3MOCA 1YPMH 1AU8A 2CJIA 3N7OA 1O2IA 2Z7FE 4CBOA 3B9FH 2GP9B 2H9EH 3KQDA 2EA3A 4ZMAH 3OU0A 1Y3YA 2BQ7B 3SW2B 3PV4A 4X1RU 1N8OC 1C1MA 1BBRE 1RXPA 5TCCA 1DE7H 2UWPA 2BMGB 2QXGA 2ZTZA 3L3TA 2ANKH 2VIWA 1YP9A 1ZHRA 3UREA 2FYQA 1DLEA 2P3FH 1DSUA 1TPAE 3SJKA 1P12E 1C1TA 4FUHA 5CMXH 4ABGA 3E3TA 3M35A 3ZZDA 4ABDA 2LNCA 2IJOB 1MZAA 1ZHMA 3U1JB 1O2QA 2BLQA 4XE4A 2PWXA 1GHXH 1NPMA 1SOZA 3QX5H 2W26A 4JZIA 4Y11E 4ASHA 1SGCA 1BB0B 1OYQA 1Y5BT 1GDQA 1AE8H 4UONA 4WH8A 1HYLA 2OINA 3M3SA 3KN2A 1WUNH 2QIQA 1AIXH 4OGYA 4AFUA 3SUGA 1SGRE 2J9NA 5ABWA 1HAVB 5T3HA 1P2KA 3MYWA 2BDAA 4YTAA 4BAHB 4Y71A 4MG3A 5GPIB 4Y0YE 2ZWLH 3I77A 1G3EA 1HRTH 3RXRA 1T8OA 5ESBA 3M36A 3VPKA 1C5YB 4O97A 3MWIU 3HPTB 1BRBE 1Z7KA 4AG1A 2PGBB 1IQIA 1FZZA 3VEQB 1LKBA 1FMGA 1MMJN 4DGJA 1ARBA 3TIUA 1WU1A 3MNSA 4FU7A 1O2XA 3ATMA 4A92A 2OC1A 2STAE 1O5BB 1E34B 1KDQA 1MUEB 1FDPA 2W5EA 1FAXA 1SC8U 1SGIB 1SMFE 2EI6A 3KGPA 3T29A 1LKAA 3SV7A 1HJAC 3PLPA 2ZEBA 1FY1A 1OWEA 3MU4A 4X8SH 4WH6A 2ZU1A 2GCTB 1EZQA 1CQQA 1W12U 1C1PA 1DX5M 2ANMH 2J4IA 2A31A 1C4Y2 4SGAE 1AB9B 3NZIA 1Y59T 1V2PT 4NFEA 3GCOA 1AFQB 1IQKA 2BYAX 4YOIA 1O5DH 3GOVB 3E0NB 8KME2 1TGNA 1GHWH 1EPTB 1D4PB 2GCTC 3BEFB 1BTPA 3RXCA 1EP6A 1GHAG 5HYOA 2GDDA 1QB9A 4AB8A 1NC6A 2OQUA 1K9OE 3QDZB 4LZ1H 1EJMA 3TVJB 2HNTC 3UPEA 1YKTA 1O2ZA 5HM2A 2FS9A 1ELAA 4F49A 4GPGA 2PV9B 1INCA 3M7QA 4X6PA 4AN7A 2ZFFH 1KXCA 3ITIA 5A0AE 1W7XH 2OC7A 3BEIB 3V13A 4BTUB 1LMWB 1LPZB 1DXWA 1MZDA 1ELTA 1F0UA 3RC6A 3S9CA 1OKXA 3ZV9A 4B2BA 1GL1A 3KQEA 5F8XA 4KTCA 4NZLA 1O38A 2PUQH 5EPYA 1O3KA 1V2KT 2H5DA 2ZHWH 2G51A 4D8NA 1T32A 1AY6H 2BD2A 1IQJA 1ZPCA 3MO3A 4RKJB 1MTNC 3PLKA 1E0FD 3UQVA 3A89A 1CBWC 3PO1B 5AF9H 1T8LA 2QN5T 2R0KA 1AQ7A 1GMCF 1ZGIA 4BOHA 3BG4C 3ZVCA 1P06A 1O3FA 1GI1A 2D2DA 3K6YA 1GGDC 3G01A 2V35A 5AFYH 2ZHQH 1UVUH 1Y5AT 4U32A 1OOKB 1V2ST 1FQ3A 3ZZ8A 1EAIA 1BUIA 1DY9A 1O0DH 3ATWA 3BG4B 4JZEH 3A83A 1TNGA 1OX1A 1QIXB 4ZHLU 1YYY1 4XSKU 3E90B 1HGTH 1TQ0B 1Z6JH 2CF8H 3A7WA 1EAUA 2F9BH 4ISLA 3M3VA 4M7GA 1QJ1B 2GX4A 1P8VC 4ZKOU 1EJNA 4K60A 1DANH 2VIOA 1BA8B 1GMDG 2UUJB 2Y6TA 1SSXA 1GCTC 1ZPBA 1ZGVA 3GCHC 2ANYA 1ANEA 2GGVB 3F68H 1S6FA 4CBNA 1C1RA 1HAXB 3TITA 3ZVGA 1KLIH 1NESE 2EEKA 2SFAA 2Y5GA 2Z9LA 1QBVH 5EG4A 2BTCE 3VXEH 1ZZZA 2HLCA 4AFQA 2H9TH 1MAYA 1DLKB 3PYHA 3TJUA 3RLYH 1SLUB 1KY9A 2J95A 2Z3EA 3URDA 2H9HA 1SGDE 3UUZA 4I8LA 2HVXA 1MTWA 1C5ZB 1AKSB 1LO6A 1TALA 6LPRA 1SFQB 2Z9JA 2A2QH 2ZGHA 4B2CA 1ZSJA 3EE0B 9ESTA 1NY22 1O3HA 3F1SB 4FVDA 1TQ7B 2BDGA 3W95A 1XUFA 1HAVA 4HZHA 3PM3A 4WF8A 3Q3YA 5EW2H 1GBLA 3LGVA 1EQ9A 1ZJKA 4IBLH 1O32A 1OP8A 2H5CA 1K2I1 2B9LA 4IC5A 3SV9A 1LPGB 1K1JA 1RTLA 1RIWB 3A7TA 4BNRA 3V3MA 2YNBA 2FI3E 5TJXA 4WMEA 1HAPH 2PUXB 5DP8A 2W7SA 5I46H 1O2TA 4Q7YA 3RMMH 3UWIA 1MQ6A 2HALA 4U2WA 5SGAE 1NFWA 3T26A 1QL8A 2A7HA 4IGDA 1KXBA 4CH8B 3QZRA 3Q3KA 3ELAH 3B23B 3RXHA 2Y7ZA 2BD7A 1ZTKA 1PFXC 3KIDU 1K1MA 1O3MA 2FI4E 1TA6A 3E91A 1E35B 2AGIX 1FJSA 3UFAA 3SGAE 5IDKA 1BJVA 1S83A 2AYWA 5E0GA 3QLPH 2J92A 1BCUH 3OY5U 1L4ZA 4D76A 2HNTE 3MH6A 3EDXB 3EYDA 4OS7A 4UDWH 1J17T 2VWNA 4DW2U 3T5FH 3GCTG 1SR5C 5ESTE 1BRAA 1Y3XA 1CGJE 2VJ1A 2ZKSA 4K1SA 1AZ8A 2Y5HA 2PSYA 4FUEA 1TNHA 1EZXC 4IN2A 1VITH 3PWBA 2XBWA 2B7DH 2BD3A 3M5NA 1UVPA 2UWOA 4NIYA 2Z9GA 3HGPA 2R0LA 3ZZ5A 3LU9B 1P0SH 3VB7A 4CHAC 1PPCE 2AIPA 1MKXH 1LQEA 1V6DA 2QA9E 1BTXA 1NFUA 5EQRA 2BX4A 2WPHS 3SJ8A 4DURA 2C3SA 2BD5A 3OY6U 1BJUA 2ILNA 1N1LA 2C4FH 4NIXA 2O8TA 1HXEH 3UOPA 3RXAA 1V2RT 2QC2A 7GCHG 4VGCB 1T8MA 4X1SU 3K6ZA 4UD9H 3RU4E 3TJOA 1DWBH 1CHOG 3GYMA 1Z1IA 4CREA 5B6OA 1O35A 4IMQA 1BMLA 1AWHB 4ZXYH 3S69A 3TK6A 2XYAA 1A2CH 2F91A 2P3UB 5L2YH 2PW8H 3UWJH 3T2NA 1WV7H 1QJ6B 1NRQH 1QA7A 3ESTA 1V2NT 3FZDA 1UVTH 2ZPSA 4Y79A 3QO6A 4K8BA 1C5XB 1T7CA 1HAOH 1DUEA 4NZQA 1QB1A 1BMMH 4J1YA 3SHCH 2Q1JA 1GCTB 1GI8B 1HFDA 2TGPZ 4INLA 1TB6H 5BRRE 1LCYA 2UUYA 5HMAA 4AB9A 2J34A 2C90B 1SG8B 1W8BH 4Q80A 4R0IA 4TPYA 1P3CA 2A2XH 2UUFB 1TGSZ 4ZROA 1GMHF 1C2LA 3RMNH 2XC0A 1HIAB 2VVVA 4CR9A 1V2WT 2TGTA 2OC8A 2OTVA 3MI4A 5EXLA 1EKBB 4I33A 4JZFH 2ZHFH 3RU4D 1YM0A 4X6OA 5EQQA 1OWHA 1A5HA 1BMAA 1XVMA 2ZU5A 3UR6A 5A8XA 1GBAA 4E06H 3O8CA 2XBVA 2PTCE 1ETTH 3UIRA 1FY5A 1UK3A 2P3TB 2YNAA 3I29A 5FHTA 1VGCB 5FPSA 1QQUA 5F03A 3BTWE 1HNEE 1W7GH 4NGAH 4FUDA 1ANDA 1GI3A 1T31A 1ZYOA 2OQ5A 2ZQ1A 1HJ9A 1ELEE 1FXYA 1OSSA 3M5LA 4THNH 5EXNA 1YCPH 2ALPA 3MNBA 1S0RA 4FU8A 1JRSA 5JYIA 3P8GA 2NU0E 1O3IA 3SQHE 4YOGA 1C2DA 1ZRKA 1C1SA 1VITG 2I6QA 3KF2A 3L6PA 1C5LH 4MNYA 2P8OC 4Q2KA 3TH2H 2O8MA 1UTLM 1A1RA 1MAXA 1TFXA 2WPMS 3AAUA 3M61U 1CE5A 2VWLA 1ZHPA 3HK6B 4PROA 5E2OA 5DO4H 1HB0B 1Y3UA 2O8UA 4BAKB 1O3CA 3STJA 5JBCS 2FESH 2FOGA 1V3XA 3RXLA 3LT3A 3BTME 3PMAB 1B0EA 1OWDA 1QCPA 2TPIZ 2ZGJA 2FOEA 2JETC 3R3GB 2ULLA 1IQLA 1YPKH 3QTOH 3ODFA 2VINA 3A7VA 1EATA 5FX5A 1GI7B 4FUFA 3SU3A 1GI2A 1C1UH 3AW0A 4O3TA 1T4UH 1SQAA 4KELA 2PKSB 3F6UH 3TJNA 1TNIA 3PO1C 2WV5A 4ABAA 3GY3A 2PSXA 4GCHG 2FOCA 2A1DB 4YO9A 1EJAA 1W10U 5EODA 3ZVDA 2D1JA 3TPIZ 3VB3A 1GPZA 5C67A 1XKBC 1F5KU 5DP3A 1YLCA 1MTUA 4AFSA 1SL3A 1EP5A 1IQGA 2C8XB 1GJ5H 1ZTLA 1NM6A 1RGQA 5FBEA 4A6LA 1TGBA 1HAHH 3LONA 4GVUA 2FOMB 3SZNA 2JH6D 2FWWA 3AVZA 1HJ8A 3MH7A 3QGNB 4J2YB 4INHA 2P8OB 3S7HB 1KLJH 3RXMA 2XRCA 2GDEH 1GGDB 1TRNA 2FIRH 2ZC9H 1G2MA 1O2LA 2EC9H 1AWFH 1QNJA 2VIDA 3KHVA 1MQ5A 4LK4A 4TWWA 3GY7A 1Z1JA 3UNQA 1UMAH 5A8ZA 3E1XB 5H4IB 2XCFA 1V2QT 1CA8B 4WMDA 2ZCKP 1SLXB 2VIVA 1G30B 3OSYA 1G3DA 1SQTA 1EAXA 3BG8A 4X1PU 3URCA 1BT7A 2OCVB 3GY8A 1ESAA 3GCNA 4Q7ZA 5C1YA 4K5ZA 4IN1A 1GMDF 5T6GA 3U1IB 4A1VA 1FIZA 2FODA 2W3KA 2C8YB 1FY3A 2HGTH 1GI4A 2GT8A 2BY8X 1UTMA 1WAYB 1VCPA 1YLDA 2JH0D 4BTTB 1LHCH 2HWLB 2PGQB 2OP9A 3RXIA 2FM2A 1DVAH 1K28D 2ZIQH 1UK2A 3SUDA 3RM2H 1AGJA 2D8WA 1C9TA 3SUFA 3IITA 1NRSH 7ESTE 3BTQE 3RXDA 2AEIH 1L1GA 2AERH 2FOFA 3NWUA 1MKXK 2Y80A 2ZU4A 3SNBA 3LGUA 4Y8YA 2RDLA 2BVRH 1YC0A 1HAZB 3LH1A 2FLBH 2FMJA 3U8RH 1TOMH 2CGAA 1AUTC 6ESTA 5DP9A 1O2KA 2ZPQA 3EA9A 5FCKA 4JYUH 2V3OH 1TGTA 3S7KB 1HAYB 1LPKB 5AVDA 3MHWU 5HXFA 1SGTA 1O2HA 2VNTA 5JPMH 4AYYB 1C5PA 1SGYE 1P02A 1C2JA 1PPGE 2O8WA 4ABHA 4JMYA 1NROH 1O2OA 1S84A 1W2KH 3A8AA 4TY7A 1LHEH 1BHXF 5C3NA 3E6PH 4O9VA 2BVSH 1K1IA 1J16A 1GBHA 3GY4A 2V0BA 4IC6A 2VIQA 2WYGA 4NSVA 3P8NA 1VJAU 4FUGA 1FPHH 1C5OH 3ZZ3A 2BZ6H 1G37A 1A0LA 2GMTC 1RIWC 1PYTD 1G3CA 1ELBA 3TJVA 1YPGH 1AUJA 3FANA 2FXRA 2IN2A 2Z9IA 3K2UA 1ORFA 4H6TA 1FAKH 1K1OA 4O3UA 1AN1E 4ZHMU 2XTTB 1QB6A 1GJ6A 2GT7A 1UTJA 4FVBA 4UFEH 1D6RA 1GJ8B 4GUXA 1AHTH 2BQ6B 1CT2E 1QGFA 4GLYA 3RXTA 1GI6A 4YLUA 2D26C 2G5VA 4SGBE 3NKKA 1SVPA 5LGOA 1TYNA 1IQEA 1KXDA 2ZFTA 4Y0ZE 3LJOA 3TH3H 4BAQB 4X6MA 1NZQH 4O03A 2Q6DA 1AI8H 1C2FA 1GHBF 4MPXA 1O5FH 1QA0A 1AVWA 2XW9A 3QTVH 1BIOA 1F5RA 4BXWA 4AX9H 1TOCB 4AG2A 2QGRA 3RC5A 4ZKSU 1HXFH 2G4TA 2Y5FA 4KTSA 4OS6A 2A5IA 1DITH 2UWLA 4KTUA 1D9IA 4NFFA 2SNWA 2G4UA 2WUBA 4NWKA 1H9LB 1HDTH 1BITA 3IWMA 1ETSH 2ZI2H 2CMYA 1D3TB 4AFZA 3FZZA 4XOJA 3VFEA 1SFIA 1WYKA 1HV7A 2DUCA 3OTJE 5FAHA 8GCHF 2P94A 1G36A 2ZECA 4D9QA 1UHBA 1FIWA 4Z0KA 2BD4A 1FI8A 1DUAA 1TE0A 2PHBA 2FO9A 1O3LA 1DOJA 4DCDA 1P2NA 1ELVA 2GZ9A 5EXMA 1UJ1A 4CRBA 1PJPA 1Y8TA 1ELFA 1PPHE 1XUJA 1FY4A 1Z8JB 2GCHG 3A8CA 3DFJA 1O3PB 4GAWA 1FPCH 1MU6B 1GHZA 2ZFQH 2OUAA 2ZDAH 1CT4E 4JK5A 2BB4A 1O5EH 4X0WU 2HNTF 4NA8A 1BTZA 1C9PA 4K1EA 1XKAC 1ARCA 1GBFA 1GI5A 1JBUH 3UOUA 2QF3A 2A7JA 2R2WU 4WXIA 1G3BA 4ISIH 3P95A 3BIUH 3A8BA 1VZQH 2BDIA 3E8LA 1C5QA 2ODQA 4ABIA 5GXPA 1GHYH 1TNKA 4YT7H 1GG6B 4NIVA 6GCHF 2OXSA 1BBRH 5LPRA 4GHQA 3IG6B 2NWNA 5T6FA 3LGYA 2DE8A 3DUXH 2G8TA 1MCVA 3DFLA 1Z6EA 1KXAA 2AMQA 3R0FA 9LPRA 4DG4A 3PMJA 3KCGH 4A1XA 1VCWA 1OWIA 2A0QB 1F0TA 2BLWA 2Z94A 2SGFE 3M37A 2HPPH 2BY5X 4Y8ZA 1XX9A 4ABEA 4NSYA 3MU0A 2C8ZB 2J94A 3Q77A 1MCTA 1QL9A 2IOTA 2XCNA 1KIGH 4DOQA 1UK4A 1AO5A 3JZ2B 3SV6A 1CGHA 1DWDH 2NU1E 4MPUA 3P92A 3TLOA 1TBQH 1TNJA 1CO7E 1C2IA 3H7OA 1RFNA 3FP6E 3RXUA 1KYNA 3TK5A 3C27B 1F5LA 4Y6DA 4E7NA 4B74A 2BY7X 3SJOA 5LPFA 4F4OC 4CH2B 5C20A 5CE1A 1Y5UT 2CHAB 2RA3A 4OS5A 1KXEA 1ANBA 3DA9B 3TH4H 2JH5D 3O8RA 1VR1H 3ZVEA 3KQBA 2H2ZA 1O3OA 3SU0A 1QY6A 2QXIA 1TONA 4A7IB 2Z3CA 5T6DA 4X8TH 4FXGH 4LOYH 1Z8IB 1OPHB 1QFKH 4UFFH 3NUMA 5K7RA 1ZOMA 4K2YA 2QXHA 1LTOA 4X8UH 1WTHD 1BRCE 3EA7A 4TYDA 4BXSA 1E38B 3SBKA 1GHBG 3ZYDA 2OC0A 1P03A 4ZKNU 1QQ4A 4TWYA 5HM9A 3SNDA 3K65B 3LGIA 4TPIZ 2OBOA 1T4VH 1JMOH 1C4U2 3BTDE 3V0XA 5EQSA 3LDXH 1NU9A 3TGKE 2ZHDA 2HRVA 5EPNA 4FUIA 3SU5A 1AKSA 3GICB 2A7CA 1OP2A 2GZ8A 3W94A 4VGCC 3LH3A 3SNEA 1N6YA 1A3BH 1PQ8A 1VGCC 3SU4A 1AD8H 1SHHB 1ZMLA 2ZDKA 4LXBH 2BZAA 1D6WA 3ATIA 5C1XA 4I8GA 2ZFPH 1O5CB 5FCRA 4A1TA 1OS8A 2QF0A 3ODDA 2ZHEH 2Q6FA 1W0YH 2UUKB 3SU6A 1CVWH 2ZPRA 4Y10E 4R8TB 5C1UA 1N8OB 3ENSB 1FLEE 2EI8A 1QBOA 2FOBA 5FXLA 2BXTH 4B76A 2SNVA 3HKIB 3HGNA 1W11U 1RTKA 2Y81A 3TNSA 1EOLA 4FUBA 3RM0H 4GHTA 4MLFB 2BLOA 3LPRA 1EASA 1X7AC 1J15A 1PQAA 1B0FA 1UTNA 2SGAA 3KL6A 3QUMP 4JYTA 2WINI 3MH5A 5L2ZH 1W3CA 4I32A 4MNXA 3U69H 1C2GA 2A5AA 2QYIA 3VB5A 1YPLH 3NXPA 4ZKRU 5DP7A 1A3EH 1TLDA 4CRCA 1GDNA 3GCTF 1P2MA 3VXFH 4X1QU 3CS0A 4MVNA 2GMTB 2ODYB 4DVAU 1QRWA 4RN6A 5A09A 3L33A 1L2EA 3A88A 4Y76A 1QRXA 4YOJA 4E05H 2SGDE 1C5MD 2KAIA 3P70B 4D7FA 1GWAA 3K9XB 1L1JA 4I8JA 2Q6GA 2AMPA 1SB1H 1QURH 4NG9H 1JRTA 1SGFG 1NTPA 5HGGA 1C2EA 1ZMJA 5AFZH 5DP5A 1K1PA 1C5SA 2K1QA 1XM1A 6GCHG 2A4RA 3LC5A 3RXEA 4U30A 1QRZA 1IOEA 1TMBH 3U8TH 3QK1A 1RTFB 3BTEE 3O8DA 5PTPA 3PTBA 3RLWH 1QTFA 1WOFA 1L4DA 3D62A 1P01A 2B5TB 3CP7A 3TGIE 4H6SB 5BPEA 3SGQE 3WY8A 1QHRB 3QWCH 2BLVA 2FLRH 1GBJA 2XBXA 2BY6X 1DSTA 3AAVA 2VVUA 4TY6A 4BAMB 3RMLH 1BTHH 2FI5E 3HK3B 1LHDH 1D3DB 2G55A 2GD4B 1V2OT 4OS1A 2QY0B 1GCDA 4WY3A 2I6SA 1UTPA 3BTKE 7KMEH 2FX6A 2LPRA 1RJXB 3M7UA 3DHKH 3NPSA 3LGWA 5GCHG 4WXVA 1XMNB 3FVFB 3A87A 1TRYA 4WJG2 1S6HA 2F83A 2W3IA 1WQSA 2EI7A 4BANB 1F0SA 2DE9A 1YPJH 3T28A 1O2VA 2ZTYA 5J4SA 2ZTXA 2XC4A 2PTNA 1C1WH 3PLBA 4ZAEA 4XBDA 4DT7B 2VB0A 3MNCA 3RP2A 2R3UA 3UNSA 1O31A 4CR5A 1P04A 4X2VA 1UTKA 4AORA 3MU5A 2C8WB 2B8OH 3ATKA 2F9UA 3Q3XA 1EOJA 1P09A 2AGGX 5DP6A 4XBCA 1A4WH 1CA0C 1ELCA 8LPRA 3SU2A 2A4QA 2A4GA 2QXJA 3RXKA 2R3YA 1A7SA 3A81A 1ZMNA 1BOQA 1BTWA 3MU8A 2OLGA 1DFPA 1XUHA 1S85A 1XXFA 1A0JA 3SQEE 5F8ZA 1O2PA 3RUOA 2PFEA 1MTSA 3NK8A 4I8KA 2BHGA 2CN0H 2ESTE 1RS0A 1UHBB 1KTTB 3RU4T 2NU3E 1AFEH 2Y7XA 3OYPA 1MTNB 1EX3A 1PPZA 3PB1E 4OS2A 3EGKH 4I7YH 1DT2A 1C5UA 3MH4A 2AS9A 2PR3A 1NRRH 4FUCA 1SOTA 1C2MA 1GBDA 4Y7BA 3NCLA 1HUTH 1DPOA 1GDUA 1GVLA 1O37A 3A8DA 1O3EA 3E0PB 2G00A 4KKDA 3SO3A 2BDCA 2FZZA 4ISOA 5JBTA 2O9QA 3LJJA 1WCZA 1Q2WA 2BQWB 4CHAB 4H42U 3A82A 4NA7A 5TCAA 2ZU3A 3F9FA 2ZFRH 1C4V2 1KDQB 1ZLRA 2TRMA 1C1QA 3SUEA 5E8EH 1GJAB 2ZFSA 3RXFA 1GMHG 2OD3B 1FV9A 7GCHF 1D3PB 3F9GA 3GDVA 1QR3E 8GCHG 1SLWB 1GBKA 2WV4A 3SN8A 1O39A 1LVMA 2NU2E 3EAJA 1DICA 1ABIH 3SNCA 1TPSA 1ANCA 4NCYA 1SHYA 3GCHB 5DK1A 1OYTH 3EQ0H 2FOAA 3S9AA 2GV7A 2R2MB 3SOSA 4KGAA 1GI9B 1TX6A 3D65E 4IW4E 2ZZUH 3U98H 4MPWA 2GVFA 1HCGA 5F6MA 3GISB 1BHXB 2ZCLP 3BTTE 3BF6H 5LH8A 2SGPE 4YT6H 5A0CA 3ZZ9A 1P9SA 1DM4B 1C5RA 2A45B 1P11E 4WMFA 1O30A 1SPJA 1A0HB 2A32A 3T62A 1DWEH 1E37B 4GCHF 1C5NH 1O2YA 5C2ZA 4ABFA 1LDTT 3S0NA 5I25A 2BD8A 1GBCA 2AGEX 2XWBI 1FY8E 2WPKS 3EA8A 3RXPA 2ALVA 4JZ1A 2WYJA 1JIRA 4B1TA 1LVOA 1O2RA 5EU8A 1DWCH 1TX8A 3VB6A 1XUIA 3M5OA 4AOQA 1VITF 4H4FA 2SGEE 4K1TA 5DPAA 1Q31A 3PMBB 4LZ4B 1DS2E 1FN8A 2Z3DA 1K1NA 5A2MH 6CHAC 1K22H 2FTLE 1S81A 1YPHE 5EW1H 5GJ4B 2RA0A 3P8FA 4U01A 3V7TA 3T27A 3E16B 4YM9A 1UVSH 2Y82A 4BAOB 1QJ7B 3O8BA 4DIIH 1HPGA 1E36B 1O36A 4K69A 1P9UA 1ESBA 1TBRH 2J38A 5JB8S 1GBBA 5AHGH 5DP4A 1ZPZA 1GBIA 1NRNH 4OGXA 1YGCH 4WVPE 3LKWA 1ETRH 1W14U 1Q3XA 2QAAA 4YLQH 1O3AA 2VGCC 3D49H 2FDAA 5JB9S 3VGCB 2TIOA 1THRH 1BTYA 4BTIB 1MKWH 2ZDLA 4HI3A 1BZXE 3FP7E 1IAUA 3D23A 4X2YA 1PPEE 1TWXB 1RRKA 4Y7AA 1C2HA 1F2SE 5GWZA 3ZZAA 2BM2A 1AVGH 2CHAC 2VH6A 1SBWA 2BVXH 2PKSC 1CU1A 4NIWA 1JIMA 2WPLS 3F9HA 3GY5A 1PYTC 2VWOA 2BOKA 1GHAF 3RXOA 4B71A 1OWJA 2TBSA 3SJ9A 1ID5H 1TABE 1B5GH 1CT0E 1GJCB 1FNIA 2TGDA 2ZA5A 2VH0A 1VCQA 4Z6AH 2A4OA 4E7RG 2F9NA 4X8VH 1AE5A 1JOUB 2ZF0H 3MMGA 4MDSA 1TGCA 2YOLA 4X1NU 5L6NH 1ZTJA 5ETXA 1GJBB 2AH4X 2GV6A 3LOXA 3TGJE 5LPEA 3DT0H 5C5NA 1TMTH 1KXFA 3FAOA 3I78A 2ZDNA 2ZDVH 2F9OA 4ZH8A 1TMUH 1WBGB 2WPJS 1UVOA 3RXGA 3M3TA 1A46H 1THPB 3RXQA 4I31A 3BTGE 5FPYA 1LHFH 2AMDA 3A86A 2G52A 1NFXA 2XNIA 4AGJA 2CF9H 2ZU2A 2QV1A 3PMHB 4XFQA 5DGJA 1BRUP 2KAIB 4IMZA 1GL0E 1J8AA 1ESTA 3MNXA 4XBBA 4YESB 1SQOA 1SLVB 2THFB 1IHTH 4DIHH 1GJ7B 4ESTE 1AVXA 1TBZH 2V6NA 1YCPK 3SGBE 1EZSC 1SI5H 4JK6A 3Q00A 1QBNA 2P93A 1OXGA 1BMNH 1TA2A 1P2QA 1XUGA 5GCHF 1VJ9U 2BDBA 1J14A 1SGQE 4FUJA 3Q76A 1PQ5A 6CHAB 3S9BA 5GDSH 1HLTH 4JCNA 1IQFA 1C5VA 2GKVE 2O8LA 3QGJA 1IHSH 1GJDB 4ISHH 2WUCA 1HAGE 7LPRA 8ESTE 4X2WA 2ZG0H 1MBMA 1C1VH 1A5GH 1S82A 1AB9C 3RMOH 2TGAA 2BD9A 2C93B 1H8IH 4A5TS 1PPFE 2VVCA 3ZZ4A 1GVZA 2BX3A 2Z6BD 4JYVH 1NU7B 4B2AA 1EPTC 3B8JA 1QL7A 4QT8C 3RXJA 4HFPB 2VWMA 2ODPA 1ACBE 1O33A 1TIOA 3SU1A 1KSNA 1AZZA 1O2NA 1F92A 1Z8RA 1UO6A 3GDUA 4AZ2B 4ABJA 4CRDA 1A5IA 1F0RA 3CENA 1G9IE 1MKWK 1GMCG 1O2SA 3H5CB 1J9CH 3ZVBA 5E0HA 3BIVH 1O3DA 4JZDH 1H1BA 1UCYK 4Q7XA 1CGIE 1K1LA 2BDYA 3BV9B 1TRMA 4CRGA 2HOBA 2FEQH 1EXFA 2QCYA 3MFJA 2J2UA 1MH0A 1CHOF 3SV8A 3FP8E 1GJ4H 1Z8GA 1D3QB 1ZSKA 1RD3B 2NU4E 1ZRBA 4RKOB 1LVYA 4OS4A 2F9VA 4NA9H 1UCYH 4GSOA 1P05A 1ABJH 1C5TA 4FU9A 4ISNA 1FUJA 3UTUH 3HATH 2ANWA 4YZUA 1O3NA 1V2MT 3KQCA 1P57B 1BDAA 1IQNA 1P2OA 4X2XA 2A5KA 4ZXXH 3STIA 3ZZ6A 3AW1A 5DKMA 2F3CE 3P17H 3RXBA 2FTMA 2CXVA 1L0ZA 3M7TA 1WQVH 1ZSLA 1H9IE 3ZVFA 5JBBS 1C2KA 2RG3A 4NWLA 1YF4A 4D7GA 2ASUB 2HPQH 3PROA 4IS5A 2XC5A 1MD8A 3LGTA 4HGCA 4B73A 1GI0A 5A8YA 2ZGXH 1NN6A 1NS3A 1GBMA 1CA0B 3MU1A 1Y3VA 1XXDA 2ZNKH 5FPTA 1DDJA 1GG6C 1WSSH 1YBWA 3GYLB 3RXVA 3ATLA 1EUFA 3AASA 2GTBA 2W7UA 1UTQA 3QN7A 2VGCB 3UQOA 2M5TA 1GHVH 3H7TA 1O2WA 4B75A 4UEHH 3TK9A 1NT1A 2BDHA 1SGEE 3BEUA 3LC3A 3TNTA 2ZGCA 4MQAA 3U8OH 3UY9A 2PLXA 5GIBA 3RC4A 2PKAB 3ZV8A 3C1KA 2VIPA 1KLTA 1W0ZU 1G32B 1T8NA 3KNXA 3DD2H 2G81E 2AIQA 1OWKA 4ZHAA 2CV3A 2R9PA 1EB2A 3ZZBA 1ELDE 3RXSA 3BTHE 3SHAH 3T25A 4K8YA 3OX7U 3HKJB 1V2LT 4HTCH 5K0HA 2XXLA 1H9HE 1P2JA 2FP7B 2FPZA 1LVBA 2XWAA 1O2JA 4ZUHA 1V2UT 1GJ9B 3MO6A 3A85A 2FX4A 2H6MA 3P6ZB 1MBQA 1O3GA 1NO9H 4MPVA 2B0FA 2WPIS 5FBIA 2AFQB 3KEEA 1GBEA 3RDZA 2ZO3H 2F9PA 1YPHC 1CBWB 2GZ7A 5EOKA 4D9RA 1G2LA 1EB1H 1SGPE 2V3HH 1XUKA 2FYRA 3BSQA 1M9UA 1PQ7A 3ZVAA 5CHAC 1BQYA 2BXUH 3A7ZA 4DJZB 1LQDB 1GBTA 1FONA 4RSPA 2SGQE 4MNVA 3SI3H 5L30H 2P16A 1EPTA 2ZCHP 5EGMA 3GDSA 3A7YA 1V2JT 3ZYEA 5JBAS 1EAWA 4UE7H 4CRFA 5C5OA 1C5WB 1O3BA 3JZ1B 3UR9A 4AYVB 1DY8A 1TNLA 1UCYE 1YPEH 1UTOA 3U9AH 4UFDH 2FS8A 1FN6A 3A80A 2OBQA 3PWCA 1HJAB 1P2IA 1O3JA 1Z71A 1O5AB 2Z9KA 3F9EA 2PKAA 1K21H 4CRAA 2JKHA 4AGKA 1EZUC 5A0BA 2BOHB 1AFQC 3PTNA 4MNWA 5FX6A 2IPHA 3ZZCA 1BTUA 3CS7A 1V2TT 4WWYA 2VU8E 1SGFA 1AMHA 3UNRA 1ZR0A 3VGCC 2H1UA 1U6QA 1C1OA 5E0JA 1S0QA 3BTFE 2ZQ2A 5DG6A 1SGNE 3ZZ7A 5JDUB 4XDEA 3LIWA 3SJIA 4UFGH 3V12A 1C1NA 1IQHA 1F7ZA 1V2VT 2P95A 4I8HA 1HIAA 1L1NA 4DY7B 1B7XB 1GVKB 4KP0A 1CHGA 1A61H 3GY6A 4MTBA 1WTGH 2XBYA 3A7XA 1O2MA 3FFGA 1H8DH 3M5MA 3MTYA 4ABBA 1TX7A 3BN9A 4K3JA 3MO9A 1IQMA 1TPOA 1MD7A 1Y3WA 5G4BA 4X6NA 5CHAB 3A84A 1MU8B 4Y8XA 5F8TA 1KTSB 1JWTA 2P59A 1JXPA 4INKA 1MTVA 1P10A 1O2GH 3GY2A 1LHGH 1THSH 3SNAA 1XVOA 2RCEA 1HBTH 1YCPM 1TAWA 1H4WA 1ZJDA 1TPPA 1DXPA 2ZGBH 3VB4A 5DJ7A 3SI4H 3TU7H 1ELGA 1N6XA 3SV2H 3QZQA 2BY9X 5E2PA 1NFYA 2G5NA 3P8OA 1O34A 1BBRK 2ZDMA 1OP0A 1O2UA 1S5SA 1W13U 2ZP0H 2JETB 1O5GH 1PPBH 1P3EA
chains in the Genus database with same CATH superfamily
5IYTA 2GCHF 2OWAA 2FOHA 1HAIH 3SORA 5J4QA 4Z0RA 1CSOE 2STBE 1NRPH 3MOCA 5LCWB 1YPMH 1AU8A 2CJIA 3N7OA 1O2IA 2D8UA 2Z7FE 1S6LA 3B9FH 2GP9B 2H9EH 4CBOA 3KQDA 2EA3A 4ZMAH 3OU0A 1Y3YA 2BQ7B 3SW2B 3PV4A 4X1RU 1N8OC 1C1MA 1BBRE 1RXPA 5TCCA 1DE7H 3VK6A 2UWPA 2BMGB 2QXGA 2ZTZA 2KCOA 3L3TA 2ANKH 2VIWA 1YP9A 1ZHRA 3UREA 2FYQA 1DLEA 2P3FH 1DSUA 1TPAE 3SJKA 1P12E 1C1TA 3N9LA 4FUHA 5CMXH 4GNDA 5KH3A 4ABGA 3E3TA 3M35A 3ZZDA 4ABDA 2LNCA 2IJOB 1MZAA 4MVTA 2VPEA 1ZHMA 3U1JB 1O2QA 2BLQA 4XE4A 2ZETC 2PWXA 1GHXH 1NPMA 1SOZA 3QX5H 2W26A 4JZIA 4Y11E 4ASHA 1SGCA 3C5KA 1BB0B 1OYQA 1Y5BT 1GDQA 1AE8H 4UONA 4WH8A 1HYLA 2OINA 3M3SA 3U28C 3KN2A 3MDBC 1WUNH 2QIQA 1AIXH 4OGYA 4AFUA 3SUGA 1SGRE 2J9NA 5ABWA 1HAVB 5T3HA 1P2KA 3MYWA 2BDAA 3U5MA 4YTAA 4BAHB 4Y71A 2FSAA 4MG3A 5GPIB 4Y0YE 2ZWLH 3I77A 1G3EA 1HRTH 3RXRA 1T8OA 5ESBA 3M36A 3VPKA 1C5YB 4O97A 3MWIU 3HPTB 1BRBE 2KCAA 1Z7KA 1E1QD 2PGBB 4AG1A 5TBNA 5FB1A 1IQIA 1FZZA 4FOUC 1LKBA 1FMGA 1MMJN 3VEQB 4DGJA 2G45A 3DWDA 5SVIB 1ARBA 3TIUA 1WU1A 3MNSA 4FU7A 2P57A 1O2XA 3ATMA 4A92A 2OC1A 2STAE 4X3GA 1O5BB 1WE9A 1E34B 1KDQA 2KE1A 1MUEB 1FDPA 2W5EA 1FAXA 1SC8U 1SGIB 1SMFE 4M9FA 2EI6A 3KGPA 3T29A 1LKAA 3SV7A 1HJAC 3PLPA 2ZEBA 1FY1A 1OWEA 3MU4A 4X8SH 4WH6A 2ZU1A 2GCTB 1EZQA 1CQQA 1W12U 1C1PA 1DX5M 2ANMH 2J4IA 3DPLR 2A31A 1C4Y2 4SGAE 1AB9B 3NZIA 1Y59T 1V2PT 4NFEA 3RPGB 3GCOA 1AFQB 1IQKA 2BYAX 2KYUA 4YOIA 1WIMA 2IQJA 1O5DH 3GOVB 3E0NB 8KME2 1TGNA 4QF2A 1GHWH 1EPTB 1D4PB 2GCTC 3BEFB 3LQHA 1BTPA 3RXCA 2Y1MA 2UZGA 2QF4A 1EP6A 1GHAG 5HYOA 3HCUA 2GDDA 1QB9A 4AB8A 1NC6A 2OQUA 5SVXA 1K9OE 3QDZB 3N9QA 4LZ1H 1EJMA 5EJLA 3TVJB 2HNTC 2VP7A 3UPEA 1YKTA 1O2ZA 5HM2A 2K0QA 2FS9A 1ELAA 4F49A 4GPGA 4ZCNA 2PV9B 1INCA 3M7QA 4X6PA 4AN7A 4F1PA 2ZFFH 2XP0A 2K16A 1KXCA 3ITIA 5A0AE 2IJD1 1W7XH 2OC7A 2RFKC 2VNFA 3BEIB 3V13A 4BTUB 1LMWB 1LPZB 2OK5A 1DXWA 1MZDA 1ELTA 1F0UA 3RC6A 3S9CA 1OKXA 2GJGA 3N9MA 3ZV9A 4B2BA 1GL1A 2MNYA 3KQEA 5F8XA 4KTCA 4NZLA 1O38A 2PUQH 5EPYA 1O3KA 2M85A 1V2KT 2H5DA 2ZHWH 2G51A 5FL7D 4D8NA 1T32A 1AY6H 3LRQA 2BD2A 2F6NA 1IQJA 4Q63A 1ZPCA 3MO3A 4RKJB 1MTNC 4LK9A 3PLKA 1E0FD 3UQVA 3A89A 1CBWC 3PO1B 5AF9H 1T8LA 2QN5T 3Q1DA 2R0KA 1AQ7A 1GMCF 1ZGIA 4BOHA 4ZDTA 3BG4C 3ZVCA 1W0KD 1P06A 1O3FA 1GI1A 2D2DA 5DN6D 3K6YA 1GGDC 3G01A 2V35A 5AFYH 2ZHQH 1UVUH 1Y5AT 4U32A 1OOKB 1V2ST 1FQ3A 3ZZ8A 4QF3A 1EAIA 1BUIA 3O34A 1DY9A 5SVYA 1O0DH 3ATWA 2KR7A 3BG4B 4JZEH 3A83A 1TNGA 1OX1A 1QIXB 4NN2A 4ZHLU 1YYY1 4XSKU 3E90B 4ASUD 1HGTH 1TQ0B 1Z6JH 2CF8H 3A7WA 1EAUA 2F9BH 4ISLA 2KZ4A 1MM3A 3M3VA 4M7GA 1QJ1B 2GX4A 3NG2A 1P8VC 2MD8C 4ZKOU 1EJNA 4K60A 1DANH 2VIOA 2Y43A 1BA8B 1GMDG 2UUJB 2Y6TA 1SSXA 1GCTC 3ZYQA 1ZPBA 1ZGVA 1V87A 2WHXA 3GCHC 2ANYA 2YQLA 1ANEA 2GGVB 3F68H 1S6FA 4CBNA 1C1RA 1HAXB 1SQRA 3TITA 3ZVGA 1KLIH 1NESE 2EEKA 2SFAA 2Y5GA 2Z9LA 1QBVH 4P00A 2BTCE 5EG4A 3VXEH 1ZZZA 2HLCA 4AFQA 2H9TH 1MAYA 1DLKB 3PYHA 3TJUA 3RLYH 3KNVA 2L75A 1SLUB 1KY9A 2J95A 5B77A 2Z3EA 3URDA 2H9HA 1SGDE 3UUZA 4I8LA 2HVXA 1MTWA 4C9ZA 1C5ZB 1AKSB 1LO6A 1TALA 6LPRA 2KKYA 2JM3A 1SFQB 2Z9JA 4RI0A 2A2QH 4IC2A 2ZGHA 4B2CA 1ZSJA 3EE0B 9ESTA 1WEWA 2E6SA 1NY22 1O3HA 4LKAA 3F1SB 4FVDA 1TQ7B 2BDGA 3W95A 1XUFA 1HAVA 4HZHA 3PM3A 4WF8A 1XWHA 2YT5A 5H1UA 3H7HA 3Q3YA 4YC9A 3OEHD 5EW2H 2KU3A 1GBLA 5LKXA 4P02A 3LGVA 1EQ9A 1ZJKA 4IBLH 1O32A 1OP8A 2H5CA 1K2I1 2B9LA 3SUBA 2I50A 4IC5A 3SV9A 1CHCA 1LPGB 1K1JA 1RTLA 1RIWB 3A7TA 4BNRA 3V3MA 2YNBA 2FI3E 5TJXA 4WMEA 1HAPH 2PUXB 5DP8A 2W7SA 5I46H 1O2TA 4Q7YA 3RMMH 3UWIA 1MQ6A 2HALA 2M3HA 4U2WA 4GNEA 5SGAE 1NFWA 3T26A 1QL8A 2A7HA 4IGDA 1KXBA 4CH8B 2C2VS 3QZRA 3Q3KA 3ELAH 2YMSB 3B23B 3RXHA 1UW7A 2LN0A 2Y7ZA 1IYMA 2BD7A 1ZTKA 1PFXC 3KIDU 4S3OB 1K1MA 1O3MA 2FI4E 4FK5A 1TA6A 3E91A 1E35B 2AGIX 1FJSA 3UFAA 3SGAE 5IDKA 1BJVA 1S83A 2AYWA 5E0GA 3QLPH 2J92A 1BCUH 3OY5U 1L4ZA 2MUMA 4D76A 2HNTE 3MH6A 3EDXB 3EYDA 4OS7A 4UDWH 1J17T 4Q6FA 2VWNA 5AITA 4DW2U 3T5FH 2MNZA 3GCTG 1SR5C 5ESTE 1BRAA 1Y3XA 1CGJE 2VJ1A 2ZKSA 3FL2A 4K1SA 1AZ8A 2Y5HA 2PSYA 4FUEA 1TNHA 1EZXC 4IN2A 1VITH 3PWBA 2XBWA 2FD4A 2B7DH 2BD3A 3M5NA 1UVPA 2E61A 2UWOA 4NIYA 2Z9GA 3HGPA 2R0LA 3U5OA 3ZZ5A 3LU9B 1P0SH 3VB7A 4CHAC 1PPCE 2AIPA 1MKXH 1LQEA 1V6DA 2DJAA 2L80A 4WA6A 2QA9E 5J3XA 1BTXA 2KM0A 1NFUA 2YYRA 5EQRA 2BX4A 2WPHS 3SJ8A 4DURA 2C3SA 2BD5A 2EQNA 3OY6U 1BJUA 2ILNA 4FIPA 1N1LA 2C4FH 4NIXA 2O8TA 1HXEH 3UOPA 2JMIA 3RXAA 1V2RT 2QC2A 4I86A 3ZVYA 7GCHG 4VGCB 1T8MA 2HLDD 4X1SU 2M2AA 3K6ZA 4UD9H 3RU4E 3TJOA 1DWBH 2QJ0A 1CHOG 3GYMA 1Z1IA 4CREA 3AK5A 5B6OA 1O35A 4IMQA 2YUCA 1BMLA 1AWHB 4ZXYH 3S69A 3TK6A 2XYAA 1A2CH 2F91A 2P3UB 2K4DA 5L2YH 2PW8H 4ACAA 3UWJH 3T2NA 1WV7H 1QJ6B 1NRQH 1QA7A 3ESTA 1V2NT 3FZDA 1UVTH 1QZ8A 2ZPSA 3H09A 3QO6A 4Y79A 4K8BA 2L7PA 1C5XB 1T7CA 1HAOH 1DUEA 5B78A 4NZQA 1QB1A 1BMMH 4R8PK 4J1YA 3SHCH 5EJZA 2Q1JA 1GCTB 1GI8B 1HFDA 2MIQA 2XOCA 2TGPZ 3U5PA 4INLA 1TB6H 1FX0B 5BRRE 1LCYA 2UUYA 5HMAA 4AB9A 2J34A 2C90B 1SG8B 1W8BH 4Q80A 4R0IA 4RT1A 4TPYA 1P3CA 2A2XH 2UUFB 3PV5A 1TGSZ 4ZROA 1GMHF 1C2LA 2YHOA 3RMNH 2XC0A 1HIAB 2XNDD 2VVVA 4CR9A 4I7CA 3O47A 1V2WT 2TGTA 2OC8A 2OTVA 3MI4A 5EXLA 1EKBB 2KFTA 4I33A 4JZFH 2ZHFH 3RU4D 3V43A 1YM0A 4X6OA 5EQQA 3MQKC 1OWHA 1A5HA 1BMAA 1XVMA 2ZU5A 3UR6A 5A8XA 1GBAA 4E06H 3O8CA 2XBVA 1K0HA 2PTCE 1ETTH 4N3WA 3RPGC 3UIRA 1FY5A 1UK3A 2P3TB 2YNAA 3I29A 5FHTA 3ZVZB 1FBVA 1VGCB 5FPSA 1DVPA 1QQUA 5F03A 3BTWE 5D1KB 1HNEE 1W7GH 4NGAH 4FUDA 1ANDA 1GI3A 1T31A 1ZYOA 2OQ5A 2ZQ1A 2VJEA 1HJ9A 1ELEE 1FXYA 1OSSA 3F2HA 3M5LA 4THNH 1WDIA 5EXNA 1YCPH 2CKLA 4BBQA 2ALPA 3F2FA 1MM2A 3MNBA 1S0RA 4FU8A 1JRSA 5JYIA 3P8GA 2NU0E 1O3IA 3ZNIA 3SQHE 4YOGA 3O35A 1C2DA 1ZRKA 1C1SA 1VITG 2I6QA 3KF2A 4ZQLA 3L6PA 3PRBA 1C5LH 4MNYA 2P8OC 4Q2KA 3TH2H 2RI7A 2O8MA 1UTLM 1A1RA 1MAXA 2ECTA 4XD7D 1TFXA 2WPMS 3AAUA 3M61U 1CE5A 2DSMA 2VWLA 1ZHPA 3HK6B 4PROA 5E2OA 3WWBA 5DO4H 1HB0B 2MA6A 1Y3UA 2O8UA 4BAKB 1O3CA 3STJA 3T9KA 5JBCS 2FESH 3W1EA 2FOGA 1V3XA 3RXLA 3LT3A 3BTME 3PMAB 1B0EA 1OWDA 4S3OC 1QCPA 2TPIZ 2ZGJA 3FM8C 2FOEA 2JETC 3R3GB 2ULLA 1IQLA 1YPKH 3QTOH 3ODFA 3GL6A 2VINA 3A7VA 3LVQE 1EATA 5FX5A 1GI7B 4FUFA 3SU3A 1GI2A 1C1UH 2V7QD 3AW0A 4O3TA 1T4UH 2YQMA 1SQAA 4KELA 2PKSB 3F6UH 3TJNA 1TNIA 3PO1C 2WV5A 4ABAA 4B86C 3GY3A 2PSXA 1E4UA 4A4BA 2WSSD 4GCHG 2YW8A 2FOCA 2A1DB 4YO9A 1EJAA 1H8ED 1W10U 5EODA 3ZVDA 2L74A 2D1JA 3TPIZ 3VB3A 1GPZA 5C67A 1XKBC 1F5KU 5DP3A 1YLCA 1MTUA 4AFSA 1SL3A 1EP5A 1IQGA 2C8XB 1GJ5H 1ZTLA 1NM6A 1RGQA 5FBEA 4A6LA 1TGBA 1HAHH 3LVRE 4YADA 3LONA 4GVUA 2FOMB 3SZNA 2JH6D 5C17A 3DSOA 2FWWA 3AVZA 1HJ8A 3MH7A 1WEUA 4L58A 3O7AA 2XEUA 3QGNB 3N9NA 2CRRA 4DT4A 4J2YB 4INHA 2P8OB 3S7HB 1KLJH 3RXMA 2XRCA 2ECWA 2GDEH 1GGDB 1TRNA 2FIRH 2ZC9H 2KWJA 1G2MA 1O2LA 2EC9H 2HVYB 1AWFH 2H0DB 1QNJA 2VIDA 3KHVA 1MQ5A 4LK4A 4TWWA 4R2YA 3GY7A 1Z1JA 3N99A 3UNQA 5AIUA 1UMAH 5A8ZA 3E1XB 5H4IB 2XCFA 2CSZA 1V2QT 4P5OB 1CA8B 4WMDA 1Z2QA 2ZCKP 1SLXB 2VIVA 1WENA 1G30B 3OSYA 1G3DA 3MHSA 1SQTA 1EAXA 3BG8A 4X1PU 3URCA 1BT7A 2OCVB 3GY8A 1ESAA 3GCNA 2QE7D 4Q7ZA 2FUIA 5C1YA 3I2DA 4K5ZA 4IN1A 1GMDF 5T6GA 3U1IB 1RMDA 4A1VA 1FIZA 2FODA 2W3KA 2C8YB 1FY3A 2HGTH 1GI4A 2GT8A 2BY8X 1UTMA 1WAYB 1VCPA 1YLDA 2JH0D 3M62A 3O36A 2LP6A 4BTTB 4Z0OA 1LHCH 2JMDA 2HWLB 2PGQB 2OP9A 3RXIA 2FM2A 1DVAH 1K28D 2ZIQH 1UK2A 3SUDA 3RM2H 1AGJA 2D8WA 1C9TA 3SUFA 3IITA 1NRSH 7ESTE 3BTQE 3RXDA 2CRWA 2AEIH 1L1GA 2AERH 3UB0A 2FOFA 3NWUA 5GNDA 1MKXK 2Y80A 2ZU4A 3SNBA 1WESA 3OEED 3LGUA 4Y8YA 2RDLA 2BVRH 1YC0A 1HAZB 5C0TA 3LH1A 2FLBH 2FMJA 3U8RH 1TOMH 2CGAA 1AUTC 4FJCA 6ESTA 5DP9A 1O2KA 2FFWA 2ZPQA 5EYAF 3EA9A 5FCKA 4FO9A 4JYUH 2VJFB 2V3OH 1TGTA 3S7KB 1HAYB 1LPKB 5AVDA 3MHWU 5HXFA 1SGTA 1O2HA 2VNTA 5JPMH 4AYYB 5TABA 1C5PA 1SGYE 1P02A 1C2JA 1PPGE 2O8WA 4ABHA 3T6RA 4JMYA 1NROH 1O2OA 1S84A 4O62A 1W2KH 3A8AA 4TY7A 1LHEH 1BHXF 5C3NA 3E6PH 4O9VA 2EGPA 2BVSH 1K1IA 5TRBA 1J16A 1GBHA 1K2FA 5EIYA 3GY4A 1N87A 2V0BA 4IC6A 2VIQA 2WYGA 4NSVA 5FERA 3P8NA 4XRNA 1VJAU 5DINA 4FUGA 1FPHH 2RSDA 1C5OH 3ZZ3A 2BZ6H 1G37A 1A0LA 2GMTC 1RIWC 4TSFD 1PYTD 1G3CA 1ELBA 3TJVA 1YPGH 1AUJA 3FANA 2FXRA 2IN2A 2Z9IA 3K2UA 1ORFA 4H6TA 1FAKH 1K1OA 3F3BA 4O3UA 1AN1E 4ZHMU 1QB6A 1GJ6A 2GT7A 2XTTB 1UTJA 4FVBA 4UFEH 1D6RA 1GJ8B 3L1XA 4GUXA 2CKLB 1AHTH 2BQ6B 1CT2E 3OFND 1QGFA 4GLYA 3RXTA 1GI6A 4YLUA 2D26C 2G5VA 4SGBE 3NKKA 1SVPA 5LGOA 1TYNA 1IQEA 1KXDA 2V3MA 2ZFTA 4Y0ZE 4I7DA 3LJOA 1SKYE 2WV9A 3TH3H 4BAQB 4X6MA 1NZQH 4O03A 2Q6DA 2J98B 5C94A 4AYCA 1AI8H 1C2FA 1GHBF 4MPXA 1O5FH 1QA0A 1AVWA 2XW9A 2YU4A 3QTVH 1BIOA 1F5RA 5LKUA 4BXWA 4AX9H 1TOCB 4AG2A 2QGRA 3RC5A 4ZKSU 1HXFH 2G4TA 2Y5FA 4KTSA 4OS6A 2A5IA 1DITH 2UWLA 4KTUA 1D9IA 2L6OA 4NFFA 4WZ0A 2SNWA 2G4UA 2WUBA 4NWKA 2W6JD 1H9LB 1HDTH 1BITA 3IWMA 2LXPC 1ETSH 2ZI2H 2CMYA 1D3TB 4AFZA 3FZZA 4XOJA 3VFEA 1SFIA 1WYKA 1HV7A 2DUCA 3OTJE 5FAHA 2H0DA 4PPEA 4A0CD 3SOWA 8GCHF 2P94A 1G36A 2ZECA 1WEEA 4D9QA 1UHBA 1FIWA 4Z0KA 1WEVA 2BD4A 1FI8A 1DUAA 1TE0A 3EE7A 2PHBA 2FO9A 2L0BA 2YMSC 1O3LA 1DOJA 1VD4A 4DCDA 1P2NA 5TDRA 1ELVA 2GZ9A 5EXMA 4W4UA 1UJ1A 2KCYA 4CRBA 1PJPA 1Y8TA 1ELFA 1PPHE 1XUJA 1FY4A 1Z8JB 2GCHG 3A8CA 3DFJA 1O3PB 4GAWA 1FPCH 1MU6B 5H1VA 1GHZA 2ECIA 2ZFQH 2OUAA 2ZDAH 1CT4E 4JK5A 2BB4A 1O5EH 2KKXA 4X0WU 5DKAA 2HNTF 2L5UA 1Z60A 4NA8A 1BTZA 5CDFE 1C9PA 4K1EA 1XKAC 1ARCA 1GBFA 1GI5A 1JBUH 3UOUA 3IHPA 2QF3A 2A7JA 2R2WU 4WXIA 4TT3D 1G3BA 4ISIH 3P95A 3BIUH 3A8BA 1VZQH 4AUQB 2BDIA 2C2LA 3E8LA 1C5QA 2ODQA 4ABIA 5GXPA 1GHYH 1TNKA 4YT7H 3CNRA 1GG6B 4NIVA 6GCHF 2OXSA 1BBRH 5LPRA 4N4FA 4GHQA 3IG6B 2NWNA 2JUNA 5T6FA 3LGYA 2DE8A 3DUXH 2G8TA 1MCVA 3DFLA 4YABA 1E79D 1Z6EA 1ZBDB 1KXAA 2AMQA 3R0FA 9LPRA 2YSJA 4DG4A 3PMJA 2EXUA 3KCGH 4A1XA 1VCWA 1OWIA 2A0QB 3DQVR 1F0TA 2BLWA 2Z94A 2SGFE 3M37A 2HPPH 2BY5X 4Y8ZA 3PV2A 1XX9A 4ABEA 2HDPA 4UI9B 4NSYA 3MU0A 2C8ZB 4Q4LA 2J94A 3Q77A 1MCTA 1QL9A 2IOTA 2XCNA 1KIGH 4DOQA 1UK4A 1AO5A 2EODA 3JZ2B 4LJNA 3SV6A 1CGHA 3N9OA 1DWDH 2NU1E 4MPUA 2ECJA 2F6JA 1G25A 3P92A 3TLOA 1TBQH 4WZ3B 1TNJA 1CO7E 1C2IA 3H7OA 1RFNA 3FP6E 3RXUA 3VG8A 1KYNA 3TK5A 3C27B 1X4JA 3ZTGA 1F5LA 4Y6DA 4E7NA 2JIZD 4B74A 2BY7X 1LDKC 3SJOA 5LPFA 4F4OC 2XOYA 4CH2B 3DSPA 5C20A 2K1JA 3N7EA 2HYED 5C11A 5CE1A 1Y5UT 2CHAB 2RA3A 2MKEA 4L7XA 4OS5A 1KXEA 1ANBA 2XOKD 3DA9B 2BAYA 3TH4H 2JH5D 3EB6A 3O8RA 2CONA 1VR1H 3ZVEA 3KQBA 2H2ZA 1O3OA 4B7YC 3SU0A 1QY6A 4OGCA 2QXIA 1TONA 1JM7B 3OE7D 4A7IB 2Z3CA 5T6DA 4X8TH 4FXGH 4LOYH 1Z8IB 1OPHB 1QFKH 4CCGX 4UFFH 3NUMA 5K7RA 2KWKA 1ZOMA 4K2YA 2QXHA 1LTOA 4X8UH 3SOUA 1WTHD 1BRCE 3EA7A 2YURA 4TYDA 4BXSA 1E38B 3SBKA 1GHBG 3ZYDA 4WZ2A 2OC0A 1P03A 4ZKNU 1QQ4A 4TWYA 5HM9A 3SNDA 3K65B 1WFKA 3LGIA 4TPIZ 2OBOA 1T4VH 1JMOH 1C4U2 3BTDE 3V0XA 5EQSA 3LDXH 1NU9A 3TGKE 2JJ2D 2ZHDA 2HRVA 5EPNA 4FUIA 3N7DA 3SU5A 1AKSA 2VPDA 1X4UA 3GICB 2A7CA 1OP2A 2GZ8A 3W94A 1H8HD 5C13A 5C0UA 4VGCC 3LH3A 3SNEA 1N6YA 1A3BH 1PQ8A 1VGCC 3SU4A 1AD8H 1SHHB 1ZMLA 2ZDKA 2M13A 4LXBH 2BZAA 1D6WA 4Z1MD 3ATIA 5C1XA 2KGIA 4I8GA 4YBSA 2EY4C 2ZFPH 1YY3A 1O5CB 5FCRA 4A1TA 1OS8A 2QF0A 4OM9A 2WZQA 3ODDA 2ZHEH 2VJFA 2Q6FA 1W0YH 2AN6A 2UUKB 1YLNA 1CVWH 3SU6A 4A4CA 2K8IA 2ZPRA 4Y10E 4R8TB 5C1UA 5HIZA 1N8OB 3ENSB 1FLEE 2EI8A 1QBOA 2FOBA 5FXLA 2BXTH 4B76A 2SNVA 3HKIB 3HGNA 4ACBA 2W6ID 1W11U 1RTKA 2Y81A 3TNSA 1EOLA 4FUBA 3RM0H 4GHTA 1WGMA 2CT2A 4MLFB 2BLOA 4B6EA 3LPRA 1EASA 1X7AC 1J15A 1PQAA 1B0FA 1UTNA 2SGAA 3KL6A 3QUMP 4JYTA 2WINI 3MH5A 5L2ZH 1W3CA 4I32A 4MNXA 3U69H 1C2GA 3EB5A 2A5AA 2MA5A 2QYIA 3VB5A 1YPLH 3NXPA 4ZKRU 5DP7A 1A3EH 4GNFA 3KQ5A 1TLDA 4CRCA 1GDNA 3GCTF 1P2MA 3VXFH 4X1QU 2XOZA 5K3QA 3CS0A 2KREA 4MVNA 2GMTB 2ODYB 4DVAU 1QRWA 1EFRD 4RN6A 5A09A 3L33A 1L2EA 3A88A 4Y76A 1QRXA 4YOJA 4E05H 2ECGA 3MHHA 2SGDE 1C5MD 2KAIA 2JJ1D 3P70B 1GWAA 3K9XB 1L1JA 4D7FA 4I8JA 2Q6GA 2AMPA 1SB1H 1QURH 4NG9H 1JRTA 1SGFG 1NTPA 3PUQA 5HGGA 1C2EA 1ZMJA 5AFZH 5DP5A 1K1PA 1C5SA 2LXHC 2K1QA 1XM1A 6GCHG 2A4RA 1VKYA 3LC5A 3RXEA 2L43A 4U30A 1QRZA 5I3LA 2IPQX 3M99A 1IOEA 1TMBH 3U8TH 3QK1A 1RTFB 3BTEE 3O8DA 5PTPA 2KFWA 3PTBA 3RLWH 1QTFA 1WOFA 1L4DA 5G0FA 5H9MA 2QF5A 3D62A 1P01A 4R7EA 2B5TB 3CP7A 3TGIE 4H6SB 5BPEA 3SGQE 3WY8A 1QHRB 3QWCH 1BMFD 2BLVA 2FLRH 1GBJA 2XBXA 2BY6X 1DSTA 1YWUA 2VVUA 3AAVA 4TY6A 4BAMB 3RMLH 2J5UA 1BTHH 2FI5E 3F0PA 3HK3B 1LHDH 1D3DB 2G55A 2GD4B 1V2OT 4OS1A 2QY0B 1GCDA 4WY3A 2I6SA 1UTPA 3BTKE 7KMEH 2FX6A 2LPRA 1RJXB 3M7UA 4LLBA 3DHKH 3NPSA 3LGWA 5GCHG 4WXVA 1XMNB 2G6QA 3FVFB 4CA1A 3A87A 1TRYA 4WJG2 1S6HA 2F83A 2W3IA 1U6GB 1WQSA 2EI7A 4BANB 4IC3A 1F0SA 2DE9A 3ZIAD 2J97A 5H1TA 3PRDA 1YPJH 3T28A 4GB0A 1O2VA 2ZTYA 5J4SA 1E1RD 2ZTXA 4A49A 2XC4A 2PTNA 1C1WH 3PLBA 2IDAA 4ZAEA 3F2GA 4XBDA 4DT7B 2VB0A 3MNCA 3RP2A 2R3UA 3UNSA 1O31A 5DSFA 4CR5A 1P04A 4X2VA 1UTKA 4AORA 3MU5A 2C8WB 2B8OH 3FKSD 5LKZA 3ATKA 2F9UA 3Q3XA 4FETA 4ZUXU 1EOJA 1P09A 2AGGX 5DP6A 2F4LA 4XBCA 1A4WH 1CA0C 1ELCA 8LPRA 3SU2A 3T7LA 2A4QA 2A4GA 2QXJA 3RXKA 2R3YA 1A7SA 3A81A 5F53A 1ZMNA 1BOQA 1BTWA 3MU8A 2OLGA 1DFPA 4AC9A 1XUHA 1S85A 1XXFA 1A0JA 3SQEE 3ZPVE 5F8ZA 1O2PA 3RUOA 2PFEA 1MTSA 3NK8A 4I8KA 3SOXA 2BHGA 2CN0H 2ESTE 2VPGA 1RS0A 1UHBB 1KTTB 3RU4T 2NU3E 1AFEH 2Y7XA 3OYPA 1MTNB 1EX3A 1PPZA 3PB1E 4OS2A 3EGKH 4I7YH 1DT2A 1C5UA 3MH4A 2AS9A 3HCSA 2PR3A 1NRRH 4FUCA 3M63A 1SOTA 1C2MA 1GBDA 4Y7BA 2PNXA 3NCLA 1HUTH 1DPOA 1GDUA 1GVLA 1O37A 3A8DA 3N9PA 5LKTA 1O3EA 3E0PB 2G00A 4KKDA 3SO3A 2BDCA 2FZZA 4ISOA 2E6RA 5JBTA 2K17A 2O9QA 3LJJA 1WCZA 1Q2WA 2BQWB 4CHAB 4H42U 1VFYA 3A82A 4NA7A 5TCAA 4UP0A 1WEMA 2ZU3A 3F9FA 2ZFRH 4AYCB 5G05B 1C4V2 1KDQB 1ZLRA 2TRMA 1C1QA 3SUEA 5E8EH 1GJAB 2ZFSA 3RXFA 1GMHG 2OD3B 4GNGA 1FV9A 7GCHF 1D3PB 3F9GA 3GDVA 1QR3E 4F48B 2LV9A 8GCHG 1SLWB 1GBKA 2WV4A 3SN8A 5EJ1A 1O39A 1LVMA 3OTPA 2NU2E 3EAJA 4B6FA 1DICA 1HYIA 1ABIH 3SNCA 1TPSA 1ANCA 4NCYA 1SHYA 3GCHB 5DK1A 1OYTH 3EQ0H 2JDID 2FOAA 3S9AA 2GV7A 2R2MB 3SOSA 4KGAA 1GI9B 1TX6A 3D65E 4IW4E 2ZZUH 3U98H 4MPWA 5KH7A 2GVFA 1HCGA 3KYGA 5F6MA 3GISB 1BHXB 2ZCLP 3BTTE 3BF6H 5LH8A 2SGPE 4YT6H 5A0CA 3ZZ9A 1DCQA 1P9SA 4LADB 1DM4B 3L1ZB 1C5RA 2A45B 1P11E 5D1LB 4WMFA 1O30A 1SPJA 3LQJA 1A0HB 2XB1A 2A32A 3T62A 1DWEH 1E37B 4GCHF 2YSMA 1C5NH 1O2YA 5C2ZA 4ABFA 1LDTT 3S0NA 5I25A 2BD8A 1GBCA 2LDRA 3PLWA 2AGEX 2XWBI 1FY8E 2WPKS 3EA8A 3RXPA 2ALVA 3DDTA 4JZ1A 5HIYA 2MT5A 2WYJA 1JIRA 4UP5A 4B1TA 1LVOA 2DX8A 1O2RA 5EU8A 1DWCH 1Z6UA 2NAAA 1TX8A 5KGOA 3VB6A 1XUIA 1WEOA 3M5OA 2VJEB 4AOQA 1VITF 4H4FA 3KYFA 2SGEE 4K1TA 5DPAA 1Q31A 3PMBB 4LZ4B 2LGLA 5SVIA 1DS2E 1FN8A 1NBME 2Z3DA 3SYJA 2Y1NA 1K1NA 5A2MH 3FEHA 6CHAC 2FUUA 1K22H 2FTLE 1S81A 1YPHE 5EW1H 5GJ4B 2RA0A 3P8FA 4U01A 3ZPV1 3V7TA 3T27A 3E16B 4YM9A 1UVSH 2Y82A 4BAOB 1QJ7B 3O8BA 4DIIH 1HPGA 1E36B 3GS9A 1O36A 4K69A 1P9UA 1ESBA 4TKPB 2YHNA 2KR4A 1TBRH 2J38A 5JB8S 1GBBA 5AHGH 5DP4A 4V3KC 1ZPZA 1GBIA 1NRNH 4OGXA 1YGCH 4WVPE 3LKWA 1ETRH 1W14U 2B0OE 1Q3XA 2QAAA 4YLQH 1O3AA 2VGCC 3D49H 2FDAA 5JB9S 3VGCB 2TIOA 5KECA 1THRH 1BTYA 4BTIB 1MKWH 5FEYA 3KV5A 2ZDLA 4HI3A 1BZXE 5IK2D 3FP7E 1IAUA 3D23A 4X2YA 1PPEE 1TWXB 1RRKA 4Y7AA 1C2HA 1F2SE 5GWZA 3ZZAA 2BM2A 1AVGH 2CHAC 4QQ4A 2VH6A 5B6LA 1SBWA 2LAUA 2BVXH 2PKSC 1CU1A 4NIWA 1JIMA 2WPLS 3F9HA 3GY5A 1PYTC 2VWOA 2BOKA 1GHAF 1WXRA 3RXOA 4B71A 1OWJA 2TBSA 3SJ9A 1ID5H 1TABE 3O70A 1B5GH 1CT0E 5T1VA 1GJCB 1FNIA 3L11A 2TGDA 2ZA5A 2VH0A 1VCQA 2KWNA 5G04B 1BORA 4Z6AH 3HCTA 2A4OA 4E7RG 2F9NA 4X8VH 1AE5A 1JOUB 2ZF0H 3MMGA 4MDSA 1TGCA 2YOLA 4X1NU 5L6NH 1ZTJA 5ETXA 1GJBB 2AH4X 2GV6A 3LOXA 3TGJE 1WEQA 5D1MB 3LDYA 5LPEA 2D8SA 3DT0H 3LJUX 5C5NA 1TMTH 1KXFA 3FAOA 3I78A 2ZDNA 2ZDVH 2F9OA 4ZH8A 5HKKD 1TMUH 1WBGB 5KEDA 2WPJS 1UVOA 3RXGA 3M3TA 1A46H 1THPB 3RXQA 4I31A 2YVRA 3BTGE 5FPYA 1LHFH 5B76A 1HYJA 2AMDA 3A86A 2G52A 1NFXA 2XNIA 4AGJA 2CF9H 2ZU2A 2QV1A 2YREA 3NRLA 3PMHB 4XFQA 5DGJA 1BRUP 2KAIB 4IMZA 1GL0E 1J8AA 1ESTA 3MNXA 4XBBA 4YESB 1SQOA 1SLVB 4OGEA 2THFB 1IHTH 4DIHH 5FB0A 1GJ7B 4ESTE 4H9DA 1AVXA 1TBZH 2LQ6A 2V6NA 1YCPK 3SGBE 1EZSC 1SI5H 4O64A 4JK6A 3Q00A 1QBNA 2P93A 1OXGA 1BMNH 1TA2A 1P2QA 2CSVA 1XUGA 5GCHF 2KX4A 1VJ9U 2BDBA 1J14A 1SGQE 4FUJA 3Q76A 1PQ5A 3LQIA 6CHAB 3S9BA 5GDSH 1HLTH 4JCNA 4I7BA 1IQFA 1C5VA 4F52B 2GKVE 2O8LA 4F55A 3QGJA 1IHSH 1GJDB 4ISHH 2WUCA 1HAGE 7LPRA 8ESTE 4X2WA 2ZG0H 5B79A 1MBMA 1C1VH 1A5GH 1S82A 3SZEA 1AB9C 3RMOH 2TGAA 2BD9A 2C93B 1H8IH 4A5TS 1PPFE 2VVCA 3ZZ4A 1GVZA 2MD7B 2BX3A 2Z6BD 4JYVH 1NU7B 4B2AA 2ECVA 3E2DA 1EPTC 3B8JA 1QL7A 4QT8C 3RXJA 4HFPB 1JOCA 2VWMA 2ODPA 1ACBE 1O33A 1TIOA 2YMSD 3SU1A 1KSNA 1AZZA 1O2NA 1F92A 1Z8RA 4AVXA 3ASLA 1UO6A 3GDUA 4AZ2B 3UAIC 4ABJA 2KCPA 4CRDA 1A5IA 1F0RA 3CENA 1G9IE 1MKWK 3O37A 1GMCG 1O2SA 3H5CB 1J9CH 3F0OA 3ZVBA 5E0HA 3BIVH 3KDEC 1O3DA 4JZDH 2CK3D 1H1BA 1UCYK 4Q7XA 1CGIE 1K1LA 2BDYA 3BV9B 1TRMA 3WWFA 4CRGA 2HOBA 3KV6A 2FEQH 1EXFA 2QCYA 3MFJA 3SHBA 2J2UA 1MH0A 1CHOF 2KGGA 3SV8A 3FP8E 1GJ4H 1Z8GA 1D3QB 1ZSKA 1RD3B 2NU4E 1ZRBA 4RKOB 2EGMA 1JM7A 1LVYA 4OS4A 2F9VA 4NA9H 1UCYH 4GSOA 1P05A 1ABJH 1C5TA 4FU9A 4ISNA 1FUJA 1COWD 1WEPA 3UTUH 3HATH 2ANWA 4YZUA 1O3NA 1V2MT 3KQCA 4YBTA 1P57B 1BDAA 1IQNA 1P2OA 4X2XA 2A5KA 5CHBA 4ZXXH 3STIA 3ZZ6A 3AW1A 5DKMA 2F3CE 3P17H 3RXBA 2CSYA 2FTMA 2CXVA 1L0ZA 3M7TA 1WQVH 1ZSLA 1H9IE 3ZVFA 5JBBS 1C2KA 2RG3A 4NWLA 1YF4A 4D7GA 2VPBA 2ASUB 2HPQH 3PROA 4IS5A 4RT0A 2XC5A 1MD8A 3LGTA 4HGCA 4YAXA 4B73A 1GI0A 5A8YA 2ZGXH 1T1HA 1NN6A 1NS3A 1GBMA 1OHHD 1CA0B 3MU1A 1Y3VA 1XXDA 2ZNKH 5FPTA 2G43A 3PHDA 1LDJB 1DDJA 2ECNA 1GG6C 1WSSH 1YBWA 3GYLB 3RXVA 3ATLA 5JG6A 3GV4A 1EUFA 3AASA 2GTBA 2W7UA 1UTQA 3QN7A 2VGCB 3UQOA 2M5TA 1GHVH 3H7TA 1O2WA 4B75A 4UEHH 3TK9A 1NT1A 2BDHA 1SGEE 3BEUA 3LC3A 3TNTA 2ZGCA 4MQAA 3PURA 3U8OH 3UY9A 2PLXA 5GIBA 3RC4A 2PKAB 3ZV8A 4XI1A 3C1KA 4YATA 3U5NA 1VYXA 1KLTA 1W0ZU 2VIPA 1G32B 1T8NA 3KNXA 3DD2H 2G81E 2AIQA 1OWKA 4ZHAA 2CV3A 2R9PA 4AP4A 1EB2A 3FOAA 3ZZBA 1ELDE 4HG6A 3RXSA 3BTHE 3SHAH 3T25A 4K8YA 2F43B 3OX7U 3HKJB 1V2LT 4HTCH 1MABB 5K0HA 2XXLA 1H9HE 1P2JA 2FP7B 2FPZA 1LVBA 2XWAA 1O2JA 2RR4A 3KQIA 4ZUHA 1V2UT 1GJ9B 3MO6A 2LELA 5TDWA 3A85A 2FX4A 2H6MA 3P6ZB 1MBQA 1F62A 1O3GA 1NO9H 2RDEA 4MPVA 2B0FA 1WILA 2WPIS 5FBIA 2AFQB 3KEEA 1GBEA 3RDZA 2M6MA 5B75A 2ZO3H 2F9PA 1YPHC 1CBWB 2GZ7A 5EOKA 4D9RA 1G2LA 1EB1H 1SGPE 2V3HH 1XUKA 2FYRA 3BSQA 1M9UA 1PQ7A 3ZVAA 5CHAC 1BQYA 2BXUH 3A7ZA 4DJZB 1LQDB 1GBTA 1FONA 2KWOA 4RSPA 1KMHB 3JUEA 2SGQE 4MNVA 3SI3H 5L30H 2P16A 1EPTA 2ZCHP 4YXWD 5EGMA 3GDSA 1W0JD 3A7YA 1V2JT 3ZYEA 5JBAS 2PP6A 1EAWA 4UE7H 4CRFA 3HTKC 5C5OA 1C5WB 1O3BA 3JZ1B 3UR9A 4YBMA 4AYVB 2LGKA 1DY8A 1TNLA 1UCYE 1YPEH 1UTOA 3WW7A 3U9AH 4UFDH 1X4IA 2FS8A 2LRIC 2QIZA 1FN6A 3A80A 2OBQA 3PWCA 3O33A 3M7KA 1HJAB 1P2IA 1O3JA 1Z71A 1O5AB 3OAAD 2Z9KA 2AHME 3F9EA 2PKAA 1K21H 3FO8D 4CRAA 2JKHA 3RTRB 4MSXA 4AGKA 2KIZA 3QZVA 1EZUC 5A0BA 2BOHB 1AFQC 3PTNA 4MNWA 5FX6A 2IPHA 2LGVA 3ZZCA 1BTUA 1NBMD 3CS7A 1V2TT 4WWYA 2VU8E 1SGFA 1AMHA 3UNRA 1ZR0A 3VGCC 2H1UA 1U6QA 2JMJA 1C1OA 2PUYA 5E0JA 1S0QA 3BTFE 2ZQ2A 5DG6A 1SGNE 3ZZ7A 5JDUB 4PTBA 4XDEA 3LIWA 3SJIA 4UFGH 3V12A 2OXQC 1C1NA 1IQHA 2VBCA 1F7ZA 1V2VT 2P95A 3DSGA 1HIAA 4I8HA 1L1NA 4DY7B 1B7XB 1GVKB 4KP0A 1CHGA 1A61H 2QICA 5KH9A 3GY6A 4MTBA 1WTGH 2XBYA 3A7XA 2EA6A 5B8DA 1O2MA 3FFGA 1H8DH 3M5MA 3MTYA 4ABBA 3C6WA 1TX7A 3BN9A 4K3JA 3MO9A 1IQMA 1TPOA 3FJUB 1MD7A 1Y3WA 5G4BA 4X6NA 5CHAB 3A84A 2LGGA 1MU8B 4Y8XA 5F8TA 3DCLA 1KTSB 1JWTA 2P59A 1JXPA 4INKA 1MTVA 3FN8A 1P10A 2JRJA 1O2GH 3GY2A 1LHGH 1THSH 3SNAA 1FP0A 4BHWA 1XVOA 2RCEA 1HBTH 1YCPM 1TAWA 1H4WA 1ZJDA 1TPPA 2J98A 1DXPA 2ZGBH 3VB4A 5DJ7A 3SI4H 3TU7H 1ELGA 1N6XA 3SV2H 3QZQA 2BY9X 5E2PA 1NFYA 2M1RA 2G5NA 3P8OA 1O34A 1BBRK 2ZDMA 2WPDD 1OP0A 1O2UA 1S5SA 1W13U 2F42A 2ZP0H 2JETB 1O5GH 1PPBH 4V3LC 1P3EA
chains in the Genus database with same CATH topology
5IYTA 2GCHF 2FOHA 1HAIH 3SORA 5J4QA 1CSOE 2STBE 1NRPH 3MOCA 1YPMH 1AU8A 2CJIA 3N7OA 1O2IA 2Z7FE 4CBOA 3B9FH 2GP9B 2H9EH 3KQDA 2EA3A 4ZMAH 3OU0A 1Y3YA 2BQ7B 3SW2B 3PV4A 4X1RU 1N8OC 1C1MA 1BBRE 1RXPA 5TCCA 1DE7H 2UWPA 2BMGB 2QXGA 2ZTZA 3L3TA 2ANKH 2VIWA 1YP9A 1ZHRA 3UREA 2FYQA 1DLEA 2P3FH 1DSUA 1TPAE 3SJKA 1P12E 1C1TA 4FUHA 5CMXH 4ABGA 3E3TA 3M35A 3ZZDA 4ABDA 2LNCA 2IJOB 1MZAA 1ZHMA 3U1JB 1O2QA 2BLQA 4XE4A 2PWXA 1GHXH 1NPMA 1SOZA 3QX5H 2W26A 4JZIA 4Y11E 4ASHA 1SGCA 1BB0B 1OYQA 1Y5BT 1GDQA 1AE8H 4UONA 4WH8A 1HYLA 2OINA 3M3SA 3KN2A 1WUNH 2QIQA 1AIXH 4OGYA 4AFUA 3SUGA 1SGRE 2J9NA 5ABWA 1HAVB 5T3HA 1P2KA 3MYWA 2BDAA 4YTAA 4BAHB 4Y71A 4MG3A 5GPIB 4Y0YE 2ZWLH 3I77A 1G3EA 1HRTH 3RXRA 1T8OA 5ESBA 3M36A 3VPKA 1C5YB 4O97A 3MWIU 3HPTB 1BRBE 1Z7KA 4AG1A 2PGBB 1IQIA 1FZZA 3VEQB 1LKBA 1FMGA 1MMJN 4DGJA 1ARBA 3TIUA 1WU1A 3MNSA 4FU7A 1O2XA 3ATMA 4A92A 2OC1A 2STAE 1O5BB 1E34B 1KDQA 1MUEB 1FDPA 2W5EA 1FAXA 1SC8U 1SGIB 1SMFE 2EI6A 3KGPA 3T29A 1LKAA 3SV7A 1HJAC 3PLPA 2ZEBA 1FY1A 1OWEA 3MU4A 4X8SH 4WH6A 2ZU1A 2GCTB 1EZQA 1CQQA 1W12U 1C1PA 1DX5M 2ANMH 2J4IA 2A31A 1C4Y2 4SGAE 1AB9B 3NZIA 1Y59T 1V2PT 4NFEA 3GCOA 1AFQB 1IQKA 2BYAX 4YOIA 1O5DH 3GOVB 3E0NB 8KME2 1TGNA 1GHWH 1EPTB 1D4PB 2GCTC 3BEFB 1BTPA 3RXCA 1EP6A 1GHAG 5HYOA 2GDDA 1QB9A 4AB8A 1NC6A 2OQUA 1K9OE 3QDZB 4LZ1H 1EJMA 3TVJB 2HNTC 3UPEA 1YKTA 1O2ZA 5HM2A 2FS9A 1ELAA 4F49A 4GPGA 2PV9B 1INCA 3M7QA 4X6PA 4AN7A 2ZFFH 1KXCA 3ITIA 5A0AE 1W7XH 2OC7A 3BEIB 3V13A 4BTUB 1LMWB 1LPZB 1DXWA 1MZDA 1ELTA 1F0UA 3RC6A 3S9CA 1OKXA 3ZV9A 4B2BA 1GL1A 3KQEA 5F8XA 4KTCA 4NZLA 1O38A 2PUQH 5EPYA 1O3KA 1V2KT 2H5DA 2ZHWH 2G51A 4D8NA 1T32A 1AY6H 2BD2A 1IQJA 1ZPCA 3MO3A 4RKJB 1MTNC 3PLKA 1E0FD 3UQVA 3A89A 1CBWC 3PO1B 5AF9H 1T8LA 2QN5T 2R0KA 1AQ7A 1GMCF 1ZGIA 4BOHA 3BG4C 3ZVCA 1P06A 1O3FA 1GI1A 2D2DA 3K6YA 1GGDC 3G01A 2V35A 5AFYH 2ZHQH 1UVUH 1Y5AT 4U32A 1OOKB 1V2ST 1FQ3A 3ZZ8A 1EAIA 1BUIA 1DY9A 1O0DH 3ATWA 3BG4B 4JZEH 3A83A 1TNGA 1OX1A 1QIXB 4ZHLU 1YYY1 4XSKU 3E90B 1HGTH 1TQ0B 1Z6JH 2CF8H 3A7WA 1EAUA 2F9BH 4ISLA 3M3VA 4M7GA 1QJ1B 2GX4A 1P8VC 4ZKOU 1EJNA 4K60A 1DANH 2VIOA 1BA8B 1GMDG 2UUJB 2Y6TA 1SSXA 1GCTC 1ZPBA 1ZGVA 3GCHC 2ANYA 1ANEA 2GGVB 3F68H 1S6FA 4CBNA 1C1RA 1HAXB 3TITA 3ZVGA 1KLIH 1NESE 2EEKA 2SFAA 2Y5GA 2Z9LA 1QBVH 5EG4A 2BTCE 3VXEH 1ZZZA 2HLCA 4AFQA 2H9TH 1MAYA 1DLKB 3PYHA 3TJUA 3RLYH 1SLUB 1KY9A 2J95A 2Z3EA 3URDA 2H9HA 1SGDE 3UUZA 4I8LA 2HVXA 1MTWA 1C5ZB 1AKSB 1LO6A 1TALA 6LPRA 1SFQB 2Z9JA 2A2QH 2ZGHA 4B2CA 1ZSJA 3EE0B 9ESTA 1NY22 1O3HA 3F1SB 4FVDA 1TQ7B 2BDGA 3W95A 1XUFA 1HAVA 4HZHA 3PM3A 4WF8A 3Q3YA 5EW2H 1GBLA 3LGVA 1EQ9A 1ZJKA 4IBLH 1O32A 1OP8A 2H5CA 1K2I1 2B9LA 4IC5A 3SV9A 1LPGB 1K1JA 1RTLA 1RIWB 3A7TA 4BNRA 3V3MA 2YNBA 2FI3E 5TJXA 4WMEA 1HAPH 2PUXB 5DP8A 2W7SA 5I46H 1O2TA 4Q7YA 3RMMH 3UWIA 1MQ6A 2HALA 4U2WA 5SGAE 1NFWA 3T26A 1QL8A 2A7HA 4IGDA 1KXBA 4CH8B 3QZRA 3Q3KA 3ELAH 3B23B 3RXHA 2Y7ZA 2BD7A 1ZTKA 1PFXC 3KIDU 1K1MA 1O3MA 2FI4E 1TA6A 3E91A 1E35B 2AGIX 1FJSA 3UFAA 3SGAE 5IDKA 1BJVA 1S83A 2AYWA 5E0GA 3QLPH 2J92A 1BCUH 3OY5U 1L4ZA 4D76A 2HNTE 3MH6A 3EDXB 3EYDA 4OS7A 4UDWH 1J17T 2VWNA 4DW2U 3T5FH 3GCTG 1SR5C 5ESTE 1BRAA 1Y3XA 1CGJE 2VJ1A 2ZKSA 4K1SA 1AZ8A 2Y5HA 2PSYA 4FUEA 1TNHA 1EZXC 4IN2A 1VITH 3PWBA 2XBWA 2B7DH 2BD3A 3M5NA 1UVPA 2UWOA 4NIYA 2Z9GA 3HGPA 2R0LA 3ZZ5A 3LU9B 1P0SH 3VB7A 4CHAC 1PPCE 2AIPA 1MKXH 1LQEA 1V6DA 2QA9E 1BTXA 1NFUA 5EQRA 2BX4A 2WPHS 3SJ8A 4DURA 2C3SA 2BD5A 3OY6U 1BJUA 2ILNA 1N1LA 2C4FH 4NIXA 2O8TA 1HXEH 3UOPA 3RXAA 1V2RT 2QC2A 7GCHG 4VGCB 1T8MA 4X1SU 3K6ZA 4UD9H 3RU4E 3TJOA 1DWBH 1CHOG 3GYMA 1Z1IA 4CREA 5B6OA 1O35A 4IMQA 1BMLA 1AWHB 4ZXYH 3S69A 3TK6A 2XYAA 1A2CH 2F91A 2P3UB 5L2YH 2PW8H 3UWJH 3T2NA 1WV7H 1QJ6B 1NRQH 1QA7A 3ESTA 1V2NT 3FZDA 1UVTH 2ZPSA 4Y79A 3QO6A 4K8BA 1C5XB 1T7CA 1HAOH 1DUEA 4NZQA 1QB1A 1BMMH 4J1YA 3SHCH 2Q1JA 1GCTB 1GI8B 1HFDA 2TGPZ 4INLA 1TB6H 5BRRE 1LCYA 2UUYA 5HMAA 4AB9A 2J34A 2C90B 1SG8B 1W8BH 4Q80A 4R0IA 4TPYA 1P3CA 2A2XH 2UUFB 1TGSZ 4ZROA 1GMHF 1C2LA 3RMNH 2XC0A 1HIAB 2VVVA 4CR9A 1V2WT 2TGTA 2OC8A 2OTVA 3MI4A 5EXLA 1EKBB 4I33A 4JZFH 2ZHFH 3RU4D 1YM0A 4X6OA 5EQQA 1OWHA 1A5HA 1BMAA 1XVMA 2ZU5A 3UR6A 5A8XA 1GBAA 4E06H 3O8CA 2XBVA 2PTCE 1ETTH 3UIRA 1FY5A 1UK3A 2P3TB 2YNAA 3I29A 5FHTA 1VGCB 5FPSA 1QQUA 5F03A 3BTWE 1HNEE 1W7GH 4NGAH 4FUDA 1ANDA 1GI3A 1T31A 1ZYOA 2OQ5A 2ZQ1A 1HJ9A 1ELEE 1FXYA 1OSSA 3M5LA 4THNH 5EXNA 1YCPH 2ALPA 3MNBA 1S0RA 4FU8A 1JRSA 5JYIA 3P8GA 2NU0E 1O3IA 3SQHE 4YOGA 1C2DA 1ZRKA 1C1SA 1VITG 2I6QA 3KF2A 3L6PA 1C5LH 4MNYA 2P8OC 4Q2KA 3TH2H 2O8MA 1UTLM 1A1RA 1MAXA 1TFXA 2WPMS 3AAUA 3M61U 1CE5A 2VWLA 1ZHPA 3HK6B 4PROA 5E2OA 5DO4H 1HB0B 1Y3UA 2O8UA 4BAKB 1O3CA 3STJA 5JBCS 2FESH 2FOGA 1V3XA 3RXLA 3LT3A 3BTME 3PMAB 1B0EA 1OWDA 1QCPA 2TPIZ 2ZGJA 2FOEA 2JETC 3R3GB 2ULLA 1IQLA 1YPKH 3QTOH 3ODFA 2VINA 3A7VA 1EATA 5FX5A 1GI7B 4FUFA 3SU3A 1GI2A 1C1UH 3AW0A 4O3TA 1T4UH 1SQAA 4KELA 2PKSB 3F6UH 3TJNA 1TNIA 3PO1C 2WV5A 4ABAA 3GY3A 2PSXA 4GCHG 2FOCA 2A1DB 4YO9A 1EJAA 1W10U 5EODA 3ZVDA 2D1JA 3TPIZ 3VB3A 1GPZA 5C67A 1XKBC 1F5KU 5DP3A 1YLCA 1MTUA 4AFSA 1SL3A 1EP5A 1IQGA 2C8XB 1GJ5H 1ZTLA 1NM6A 1RGQA 5FBEA 4A6LA 1TGBA 1HAHH 3LONA 4GVUA