3FANA

Crystal structure of chymotrypsin-like protease/proteinase (3clsp/nsp4) of porcine reproductive and respiratory syndrome virus (prrsv)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
197
structure length
192
Chain Sequence
FRTQKPSLNTVNVVGSSMGSGGVFTIDGKIKCVTAAHVLTGNSARVSGVGFNQMLDFDVKGDFAIADCPNWQGVAPKAQFCEDGWTGRAYWLTSSGVEPGVIGNGFAFCFTACGDSGSPVITEAGELVGVHTGGGIVTRPSGQFCNVKPIKLSELSEFFAGPKVPLGDVKIGSHIIKDTCEVPSDLCALLAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Non-structural protein
publication title Structure and cleavage specificity of the chymotrypsin-like serine protease (3CLSP/nsp4) of Porcine Reproductive and Respiratory Syndrome Virus (PRRSV).
pubmed doi rcsb
source organism Porcine respiratory and reproductive syndrome virus
total genus 45
structure length 192
sequence length 197
ec nomenclature ec 3.4.21.114: Equine arterivirus serine peptidase.
pdb deposition date 2008-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3fanA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3fanA02
3.30.40.20 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Chymotrypsin-like serine protease; domain 3 3fanA03
1OWHA 1OX1A 4X6NA 1K22H 3TU7H 1HGTH 4BAKB 3KQCA 3PMJA 1E0FD 2GV7A 1FPCH 1Z1JA 3RP2A 1CGIE 1FXYA 2FYQA 3MU0A 1DE7H 2G51A 1C2FA 1CHOG 1ELDE 3SHCH 1FY8E 2XNIA 1Q31A 3V13A 1GMHF 1O2IA 2ZFRH 4AG2A 1GBTA 3KL6A 2BX4A 1QBOA 2XC4A 2BY6X 2ZHQH 1OWIA 3QX5H 3QZQA 2PKAA 1ZLRA 1O3CA 1PFXC 1G2LA 3M37A 3OX7U 3VGCB 3PMAB 2CV3A 1BZXE 3CS0A 1PPHE 1GHBF 1EZUC 1LO6A 2BB4A 4MNYA 1HXFH 1CE5A 1AUTC 1GBJA 4B2AA 1A5HA 1BIOA 4O97A 5FPSA 1S6HA 4WMDA 1VITG 3EGKH 2VWLA 3HKJB 1QY6A 1GBEA 1FNIA 2XWAA 1OP8A 2Z3CA 5GCHG 3MNSA 1QA7A 1V2NT 2F9PA 2P16A 3CENA 3KNXA 1OYTH 1OSSA 1JXPA 2A45B 2A5KA 4D8NA 1OYQA 1O2QA 2PUQH 1TLDA 4Y79A 1DY8A 2UUKB 1LTOA 3K9XB 3F68H 1ZJKA 3BTFE 5TJXA 1PPGE 4IMQA 1LPGB 1LQEA 1A3BH 2FOCA 4CR5A 1G3EA 2A7CA 1W2KH 2PHBA 2BD7A 3KHVA 1THRH 3GY3A 1P06A 4B71A 4DIIH 6CHAC 4DG4A 1GMCG 1ZRBA 2EI8A 2XBYA 4INKA 2DUCA 1YPKH 3PTBA 5TCCA 1J14A 1LVOA 2HRVA 1DITH 4Y71A 4X8TH 1GJ8B 1O2YA 5DK1A 3NK8A 2EI6A 1BHXF 2BY7X 4I31A 1O3EA 1LHCH 5HXFA 1OXGA 3A8CA 5EW1H 1BB0B 1QR3E 2BLQA 3DA9B 1MQ5A 1QRWA 2F91A 2ZHWH 4CRCA 1D3DB 2H5DA 1WTGH 4FUIA 1O2RA 1O2OA 3BV9B 1EATA 3K6YA 3UFAA 2XYAA 1TQ7B 1OWJA 2ZGHA 2G00A 1C5MD 3KEEA 1NROH 3M5OA 3CP7A 3ZYDA 1GHVH 7LPRA 3M35A 2NU1E 4IBLH 2GGVB 4MQAA 2TBSA 1WYKA 4H42U 3ZVCA 1HAYB 4JCNA 5L6NH 4INLA 1K1OA 1TPAE 2ZCLP 3A7ZA 3VB3A 1V2WT 3RXTA 4AFUA 3BTEE 1GHBG 3U98H 1GBIA 2UWPA 3Q3KA 1CA8B 2VVVA 3F9HA 3I29A 3MWIU 1MTNB 1E36B 5F8ZA 3E1XB 5JPMH 1W0ZU 5I46H 1MTNC 2Q1JA 3A85A 1ZTKA 3ELAH 3F6UH 3GDVA 1O2MA 3SGQE 3TGJE 3SU6A 1XXFA 1P0SH 3SJ9A 1FLEE 3PV4A 4KTCA 2AERH 3S0NA 2FZZA 3S7HB 4K8YA 1D6RA 3T28A 3TNTA 4I33A 1CGHA 4IW4E 1AWFH 1DPOA 1JIRA 4DY7B 5C1YA 3EYDA 3ITIA 2G5NA 2CHAC 1AFEH 3U8OH 1SGRE 2Y7XA 3T29A 1GVKB 1MCVA 2AMPA 3GCNA 1TOMH 2ANYA 3RMLH 4IN1A 5EQSA 3AW1A 1QHRB 1TPPA 5JBAS 1C5SA 2Y6TA 2HWLB 2VVCA 5C20A 1PPFE 4Y8YA 1C5QA 1OWKA 4FXGH 1JRSA 3SJ8A 1PPEE 3LC5A 1RS0A 1TX6A 1O2SA 1O2UA 1P11E 1EZXC 2WPJS 2A4OA 2GD4B 5J4SA 4I8KA 2P94A 2OTVA 1S5SA 7GCHF 1BTHH 4X8SH 2QAAA 4IMZA 4X1NU 1ZSLA 1QNJA 1EPTB 1NN6A 4TY6A 3SUFA 5JYIA 1SC8U 4Y7BA 1EPTC 5A8XA 1Y3VA 4ZHLU 5GWZA 5IYTA 2ZI2H 3TK5A 1ZR0A 1P3EA 2VH6A 3MU4A 1FQ3A 1GL0E 4BANB 1AKSA 1ELBA 1HBTH 1AZZA 3BG4B 1XVMA 1J17T 4ZKRU 4ABIA 1GI4A 1EAIA 1H9HE 1TNHA 2RA3A 1K1IA 1W11U 4B75A 1RIWC 3U8TH 3TIUA 5FBIA 3MFJA 2WINI 3JZ2B 4JK5A 5JB8S 1F5KU 2FI3E 4JMYA 3M7TA 4ZROA 1IQGA 1FN6A 1UMAH 4Z6AH 5J4QA 1PQ8A 1BRCE 1DFPA 1TGBA 1GL1A 2V0BA 4A1TA 5C67A 1P04A 1P2OA 1F0UA 1LHFH 4MPXA 3NPSA 5A0AE 3SW2B 4ABEA 1A7SA 3SNDA 1ETTH 3SI4H 1VZQH 4I8JA 1B5GH 1O38A 3TLOA 1O2XA 5SGAE 4WXIA 1H8IH 3V12A 1PYTC 1EAWA 2BLWA 5EOKA 1A61H 2TGPZ 2RG3A 3PO1B 1VCPA 3VB7A 2VB0A 3BEIB 4A6LA 4XFQA 3UNSA 1UVTH 4WMEA 2GKVE 1O2KA 8GCHG 1K2I1 9LPRA 1THPB 3ATWA 4X6OA 5BPEA 1J8AA 2BLOA 2YOLA 1UHBB 2YNBA 1Q2WA 1UTMA 3LGTA 4OS1A 2AH4X 1BTUA 3F9FA 4NFEA 1O5GH 1FIZA 3NCLA 5DP3A 7GCHG 2XW9A 2CJIA 4AYVB 1KSNA 2FP7B 4K69A 4DVAU 1K28D 2VIOA 1TALA 3BTTE 2G8TA 1ESTA 5E0GA 1XKBC 1GHAF 1PQ5A 4DOQA 1SGFA 2ZPQA 1UK2A 2BZAA 2P59A 1HXEH 8LPRA 2ZU1A 3LONA 4AYYB 1UCYH 1C2DA 2TGDA 3BN9A 3BTGE 3MU1A 1TNIA 3T2NA 3S9CA 1HV7A 3FP8E 1P2NA 2OBQA 3M3TA 1KTTB 2BQ6B 3GYMA 3PMBB 1E35B 2XCFA 3PLPA 4OS6A 2TGAA 4MPWA 3EDXB 1MUEB 1AO5A 4YOJA 1C1TA 2JH0D 2SNVA 4WF8A 1QBNA 4OGYA 1LKBA 5LH8A 1FY4A 2RA0A 5K7RA 1UTPA 3LC3A 1U6QA 5A09A 4KELA 3MH5A 4INHA 1Q3XA 3SI3H 1HAHH 2ZHEH 3ZVBA 3LJOA 2H1UA 1BBRK 2ZHFH 2ZTZA 3KF2A 1IQHA 1TNGA 3KN2A 1T4VH 1TBQH 2TRMA 4KP0A 4HZHA 1BRBE 1TNJA 2A5AA 2J95A 1NPMA 4BTIB 1L1JA 1JMOH 5GPIB 1C1UH 1HYLA 3RLYH 4NIXA 4ZKSU 4DIHH 3UR9A 3MU5A 2GCHG 2BD2A 1MU8B 4KKDA 1FIWA 3U1IB 1FY5A 2ZKSA 1LPKB 3W94A 1HNEE 1JWTA 4GPGA 5EQQA 2ALVA 3SBKA 2TPIZ 3P92A 1YF4A 3ZZ3A 2FOGA 1BTZA 1XUJA 2BM2A 1SQOA 2QF3A 5HYOA 1NFYA 2BQ7B 4LZ4B 3K2UA 2TGTA 2GTBA 3QUMP 1E37B 2AGEX 3LOXA 4I8LA 2QY0B 2VWNA 3TJNA 1V2TT 3LT3A 4U30A 3SU5A 4H6TA 2GT7A 4PROA 1K1JA 2XTTB 2HNTC 2UUJB 1GHAG 3KGPA 4NFFA 2FLBH 1M9UA 3P8OA 2GVFA 1LVBA 1EASA 1GHXH 3RDZA 2QCYA 3RU4E 4FUHA 5GJ4B 1NM6A 3RXVA 1Z8GA 1MKWK 5K0HA 3LGWA 5I25A 1C2HA 1T8MA 4ABHA 3Q3YA 3WY8A 2PW8H 3RXHA 2C3SA 2GT8A 4BOHA 1AVWA 3GY5A 3UREA 2HLCA 2ZTYA 1O2LA 1TPOA 2BOKA 1NFWA 4YOGA 3FANA 1LVYA 1W8BH 5T6FA 1E34B 5A2MH 4LXBH 2FI4E 1DVAH 2ZO3H 1G2MA 2NU3E 3UWIA 4AGKA 1SQTA 1RJXB 2OUAA 5DKMA 3MNBA 2J34A 2WPIS 3TVJB 2O9QA 1GWAA 1EXFA 2FOEA 4CRBA 3I77A 1GGDB 5JBTA 1SGCA 1BRUP 2A7JA 3A8DA 4WY3A 2BD3A 2F3CE 2G4TA 4ZAEA 4ABAA 1TA6A 1C5VA 3GCHB 1HCGA 4AFQA 3BSQA 2Q6DA 1TMUH 2FTLE 3SJIA 3RMNH 1GI8B 1NESE 3O8BA 1UCYE 5F03A 2ZCKP 4DW2U 3TITA 1KDQA 1AIXH 1WV7H 3IWMA 1L4DA 3RXMA 1VGCC 1IQMA 3UPEA 5L30H 2RDLA 3SNCA 5DPAA 1QL8A 2OQUA 3R0FA 4LZ1H 4CREA 4ABDA 1BOQA 3ENSB 1LMWB 1UVOA 2ZQ1A 1BMAA 1WSSH 3BIVH 2ZQ2A 2AMDA 2JH5D 3A7XA 4Q7YA 4RKOB 3SGBE 1P2IA 1RTFB 2BY5X 1ANCA 2FLRH 1TE0A 2DE9A 1GBKA 4AB8A 2AGIX 1J16A 3PTNA 4UFFH 3ZZ4A 2P93A 3BG8A 1SSXA 2WPKS 2PFEA 2ZECA 3RXUA 4YLUA 4VGCC 3RC6A 4JK6A 1V2OT 4GSOA 1ID5H 1AN1E 5DJ7A 3ZVDA 1AB9B 2BYAX 1YPMH 1T8OA 6GCHG 3DFJA 3MO9A 1BMLA 3GYLB 2GX4A 2JETB 5GXPA 3V7TA 1CT4E 4GAWA 1CVWH 2JETC 2VGCC 1HAVA 3A7VA 4DCDA 3S9AA 1GJ9B 1T8NA 3V0XA 1DXPA 1JIMA 1XVOA 1W7GH 1SLUB 4F4OC 1H9LB 1TGSZ 4D9QA 3RXLA 5A0CA 2FPZA 3HATH 1SGPE 3NXPA 1GI3A 1RFNA 4HGCA 4I8HA 3T27A 4WH6A 1N1LA 2BLVA 4ASHA 2Z9JA 3DFLA 2B8OH 3DUXH 2ZTXA 1IAUA 3A83A 2BDGA 1SGYE 3ZZ7A 5DP8A 3E0NB 1GJDB 2O8LA 2A32A 2PSXA 2WPLS 3SUEA 2CMYA 2OLGA 3LGIA 1VCQA 4E05H 2O8MA 1O2PA 3Q00A 1TABE 1SI5H 5DP5A 2C90B 1C5RA 3H7OA 3SORA 1XUIA 3NUMA 2ZCHP 3RMOH 3UWJH 1JBUH 5AVDA 1ZGIA 1ARBA 2FESH 1OPHB 1EP5A 1Z8RA 4X6PA 1TWXB 4MVNA 3SZNA 3LH3A 3R3GB 2KAIA 4GHQA 1QB9A 4JZIA 4NIYA 1O39A 2FS9A 3EE0B 1QL7A 4XDEA 1VCWA 2BVRH 4YESB 1KIGH 2AYWA 4Y6DA 1P2JA 1Z6EA 1ZRKA 2P8OC 3ATKA 3M36A 1VITH 1D3QB 1WOFA 4XE4A 1CU1A 3BTME 3MNCA 1TBZH 1A2CH 4AOQA 1BMNH 4MPUA 2FM2A 2ZHDA 1RXPA 1C1VH 1BA8B 1D3TB 1HRTH 3RU4T 3MMGA 1C5PA 5A0BA 1UTOA 3UOUA 2AS9A 1FZZA 4GCHG 2QXIA 2ZIQH 3RM0H 2V35A 2AFQB 6CHAB 1TOCB 2ZU5A 3ZZAA 4E7RG 2H9EH 2Y81A 1ELCA 2Q6GA 1MZAA 1WTHD 1F0TA 1GVZA 1ZTLA 6LPRA 1YGCH 1GBMA 2A4GA 2EA3A 1UTNA 4NWLA 2C93B 1HAZB 1TMTH 4NCYA 1C4V2 1QTFA 2BX3A 2K1QA 4TWYA 2ANWA 1C5WB 3TH3H 3QN7A 2P3FH 1BTXA 4ZHMU 4OGXA 3D23A 2ODYB 5E2PA 2PTNA 3RUOA 1IQFA 4ISLA 1GBCA 1UTJA 4FVDA 3UIRA 2HALA 1BJVA 5GDSH 1BT7A 1IQJA 1AU8A 2IJOB 4X8UH 2BDCA 3W95A 1GMHG 1S82A 2XWBI 4RKJB 2FOFA 1G3DA 1GHYH 1C5TA 2BDAA 3D62A 1DLEA 4A1VA 1GJCB 2VIDA 1GBFA 1BBRH 3MI4A 3AAUA 3KQBA 2FDAA 1GJ5H 3PM3A 1DT2A 3ZV8A 3QLPH 2FX6A 4MDSA 2B9LA 1YP9A 1KXEA 2ASUB 3ODDA 3ATMA 2J2UA 4UFDH 5B6OA 4KTSA 1SBWA 2HGTH 2OC1A 2V3OH 3MOCA 5CMXH 4NA8A 4CBOA 3H7TA 4UFGH 3F9GA 1SGIB 2JKHA 2R0LA 2ZDMA 3UR6A 4Q80A 2IOTA 2XC0A 3LH1A 1XKAC 2CHAB 1ZHMA 4UE7H 1KY9A 2P3TB 2BDHA 5EW2H 2WUCA 4B2BA 1A46H 5LPEA 3A8AA 2W7UA 2W5EA 1YPEH 1DX5M 1ZPCA 5ESTE 1HJAC 3IITA 2A2XH 4TYDA 1QRZA 1MZDA 1O35A 2ZPSA 4K1SA 2J9NA 1UK3A 2BD9A 2M5TA 5T6DA 2GP9B 1V2QT 3D49H 4CH2B 3RXDA 1V2UT 1DOJA 4AX9H 3EA7A 2UUFB 2O8WA 3OY6U 1SG8B 3G01A 3P70B 2H9TH 1MKWH 2EC9H 3NKKA 3RXJA 4BXWA 1C1NA 1C2IA 3K6ZA 3ZZBA 1MU6B 1Z8JB 1OWDA 1BITA 1HIAB 1DWDH 4UDWH 1KYNA 1Y3UA 2Z3DA 2FYRA 1V2ST 3P8NA 5E8EH 3MO6A 1TB6H 3AAVA 4ZUHA 1T32A 1AD8H 1P57B 2STAE 3MH7A 3E91A 4ISOA 1YBWA 2QXGA 4CRAA 1Y5BT 1MD7A 4ZH8A 5E2OA 4FU7A 1XX9A 3A82A 3O8RA 4ZKOU 1TMBH 2A4RA 1TX8A 1C2JA 1P9SA 1V2VT 3A7YA 1Z6JH 2CXVA 1DLKB 2PKSC 2Z3EA 1RIWB 1EOLA 4X2VA 1P10A 1VJAU 5TCAA 1DANH 4ZHAA 2A0QB 3L6PA 3PLKA 1QRXA 1HUTH 2LNCA 5EGMA 1GDNA 1AY6H 1UK4A 3KCGH 3Q76A 4A92A 3SV8A 2ZGJA 1Z8IB 4O3TA 2AIPA 1O3NA 2EEKA 2OXSA 3GY6A 1MH0A 1KXDA 4Y8ZA 2SGAA 1Z71A 3MTYA 3JZ1B 3A89A 2Y80A 3STJA 5EXLA 2ULLA 2QXHA 1TPSA 1SGFG 2R3UA 3RXOA 4IC5A 4O03A 1AVXA 3MNXA 1XM1A 3GY7A 1P2MA 1BBRE 4TPIZ 1GI1A 4DGJA 1NZQH 4I32A 1EB1H 2QV1A 1W10U 1F0RA 3LGUA 1Y3YA 1XXDA 1V2RT 4AORA 2G5VA 3SJOA 1GJAB 1HLTH 3SU1A 1OP0A 1C9PA 3E90B 2VWOA 3HK6B 3RXFA 5C5OA 2SNWA 2XC5A 1C2GA 2G4UA 2FOHA 1GJ6A 5FPYA 2ZFSA 2G81E 1A0LA 2ALPA 1DS2E 3D65E 2BDBA 1PPZA 2SFAA 3BEFB 1F92A 4E7NA 1IOEA 2QA9E 1TNLA 3KQEA 1NC6A 2ZZUH 3M7UA 1AUJA 2FXRA 4Q7XA 4GUXA 4U01A 4R8TB 1V3XA 3ZZ8A 3URCA 1V2MT 3V3MA 3RMMH 1YLDA 4MNVA 1EPTA 2BD4A 1SVPA 1QB6A 2WYGA 2BXTH 1TRMA 3SU4A 3P8FA 3ZZ9A 2G55A 3E6PH 1CA0C 4NA7A 2XBVA 5LPFA 3TJVA 1NFUA 1QCPA 1SOZA 3TGKE 1YKTA 1NS3A 1QL9A 8ESTE 1A5IA 1KXBA 1O2JA 2CN0H 4BAMB 3O8DA 3RXQA 1UTKA 1ZHRA 2SGDE 4FU9A 3UUZA 2BVSH 1CQQA 1AE8H 2AGGX 2F9VA 5C2ZA 2GDDA 1MKXK 1D3PB 2ANMH 2W26A 3GY8A 3PB1E 5FX6A 3MHWU 3SGAE 2D1JA 1BDAA 5EQRA 4JZDH 5F8TA 1O30A 1BCUH 4K2YA 4FUGA 4X1SU 4K1TA 4WJG2 1H9IE 1ZMJA 1MBMA 3FZDA 2C4FH 4GLYA 5ETXA 2FTMA 3UTUH 1BJUA 2D8WA 1O2ZA 2ODPA 1S6FA 1ZHPA 3BTWE 3ZZ5A 3A87A 1JRTA 2H9HA 3A86A 2FX4A 3RXAA 1C5LH 2XXLA 1IQIA 1GBHA 1O3FA 2NWNA 2PLXA 2SGEE 4Y11E 3QWCH 2QC2A 5JBBS 2VWMA 3LJJA 4J1YA 1HJ9A 2ZNKH 4Y8XA 1W12U 1N6XA 4MG3A 5H4IB 3U1JB 1TGTA 3OSYA 2ILNA 3I78A 1UHBA 1SGQE 4U32A 2W3KA 3NWUA 2B0FA 2HPQH 2V6NA 1WBGB 5EPYA 3FZZA 1O2TA 2ZFTA 1A3EH 4Q2KA 1FAXA 3QGNB 1N8OC 4H4FA 3VEQB 1O5DH 2VU8E 1GJBB 6ESTA 2BY8X 5EG4A 1TQ0B 4DURA 1OKXA 1SL3A 5CHAC 1PPCE 1S83A 2R9PA 3VB6A 1TAWA 1B0FA 2Z9LA 3VB5A 2Q6FA 1L1GA 2J4IA 3GCOA 4YTAA 1IHTH 4BAOB 1O36A 3RXCA 4AGJA 3E0PB 5JBCS 1GHWH 1TGNA 2AMQA 1B0EA 1P3CA 4O9VA 1G3CA 1ZSJA 5JB9S 2OINA 1O31A 1O3BA 2ZGBH 2BD8A 4ABJA 1F0SA 2UWLA 4B73A 4NIVA 4ZMAH 1C5ZB 2A5IA 1G32B 1XMNB 1O2WA 4XBCA 3AASA 4YT6H 1FAKH 1FN8A 2QXJA 1WQSA 1C5OH 2ZG0H 3SNEA 1VGCB 1O37A 3SOSA 1DWEH 3UQVA 2UUYA 3STIA 1AI8H 2BDIA 1GBDA 2C8XB 2G52A 5L2ZH 1XUGA 2GMTC 4J2YB 4YM9A 3VPKA 1JOUB 3AW0A 1EX3A 3QGJA 4FUBA 2VJ1A 1PPBH 1GMDF 5CE1A 2VVUA 3GCTF 2FMJA 5FAHA 2F9BH 5BRRE 5C1UA 1P9UA 3T62A 1GBAA 5L2YH 1SGNE 2F83A 4BAHB 4JZ1A 3UQOA 3HK3B 4VGCB 3LIWA 3BTQE 2GZ9A 4WH8A 3RXEA 2XBXA 1ZMNA 1EAUA 1MTUA 1MD8A 1MQ6A 4I7YH 3P95A 1QGFA 1FUJA 1L1NA 4SGAE 4OS7A 4JYVH 2OC7A 1ANBA 4CBNA 2D26C 1GCTB 2NU0E 4WXVA 1DUEA 3QTVH 2C8YB 1GCTC 3RU4D 1C5NH 1TX7A 1C1MA 4AG1A 1DSUA 1VR1H 2OC0A 3BTKE 1G3BA 1O2GH 2UWOA 2VGCB 1B7XB 4MPVA 2ZU3A 1O5FH 1O32A 3ZVEA 1A1RA 2F9NA 1XUFA 2J94A 3VFEA 5FPTA 4WWYA 4A7IB 3P6ZB 5HM2A 4B2CA 1HAIH 4B1TA 3VXFH 1OP2A 3HGNA 1O3JA 1SR5C 1FONA 2H2ZA 1KXAA 1A0HB 1C5UA 1S85A 4UEHH 1GI7B 2ZFFH 1RTKA 1GG6B 1NO9H 2OD3B 2PGBB 4KGAA 1CBWC 1GG6C 1PYTD 3HPTB 5DGJA 1KLTA 4Y10E 2J38A 3PWBA 1EJAA 1TGCA 1ACBE 1RRKA 5IDKA 3T5FH 3K65B 2V3HH 4OS4A 5T3HA 2Z9IA 3PYHA 5FXLA 1AZ8A 1TYNA 4MNXA 3U69H 2BXUH 3RXGA 2VIVA 2BY9X 4TPYA 3SU0A 3QK1A 4HFPB 2A31A 4NZQA 2PGQB 1C1SA 1HPGA 3MU8A 3FFGA 4MNWA 3TPIZ 1XUHA 2F9UA 3L33A 4IS5A 1GMDG 1ELFA 3SUDA 3GCTG 1EAXA 3ESTA 1UJ1A 3SO3A 1FJSA 1NRRH 2C8ZB 2HNTE 2VIQA 1K21H 2ZDKA 1UTQA 1UTLM 3BTHE 1OOKB 1P01A 2P8OB 4IGDA 1SFQB 4X1RU 5E0JA 2Z9GA 4YZUA 3AVZA 1C2KA 1IQKA 2ESTE 2FEQH 3LGYA 1F5RA 1S84A 2ZDLA 2THFB 1RGQA 2R2MB 1YLCA 1O33A 1D4PB 3SV9A 1G30B 2WUBA 3L3TA 3RXBA 4ABGA 2CF9H 1NY22 3Q3XA 4U2WA 1QQUA 4UD9H 5F6MA 1C5YB 5JDUB 4K8BA 1QJ1B 3C27B 3VGCC 1FPHH 3M5MA 1K9OE 2R3YA 1C1QA 3A84A 1L4ZA 4JYUH 3TNSA 1GBLA 1O5AB 1LQDB 3UNRA 5FX5A 5FCKA 1DXWA 1TIOA 1GVLA 1D6WA 1YPHC 2AEIH 1YYY1 3F1SB 8KME2 1P02A 4H6SB 1FMGA 2ZGXH 3MO3A 3T25A 3GDSA 3LKWA 3OYPA 2ODQA 1SLXB 3SNAA 2C8WB 1NU7B 3VXEH 2ZWLH 3Q77A 1OS8A 3E3TA 2ZDVH 4CR9A 1YPLH 1KXFA 2GV6A 1D9IA 1CT0E 5EXMA 1AWHB 3UY9A 1ELAA 3B8JA 2VH0A 1A5GH 1N6YA 1WAYB 2HOBA 4NSVA 1SFIA 1EUFA 1F2SE 2BZ6H 2VIPA 1EQ9A 1A0JA 1H4WA 1DDJA 1LHGH 4Y0YE 4QT8C 3M61U 5ABWA 3EQ0H 2ZC9H 3RC5A 4AFZA 1C2EA 2F9OA 1AVGH 3FP6E 1K1NA 1O2NA 3A7TA 3IG6B 5HM9A 2GZ7A 1P2KA 3HGPA 1DSTA 1WU1A 2PV9B 1C4U2 4BTTB 1MKXH 3RXSA 1NT1A 1W7XH 1PJPA 2VNTA 3EAJA 1Z1IA 1AKSB 2OC8A 1KLIH 1ZMLA 2QF0A 1P03A 1T31A 5DP7A 4CHAB 3RXIA 1BHXB 2H5CA 1RD3B 4CHAC 1MAYA 4ISIH 1HAXB 1SHYA 2LPRA 3SV2H 1C1OA 1Y5UT 4M7GA 1ELTA 1AQ7A 4Y7AA 2FS8A 3A7WA 5DG6A 4ZXXH 1TONA 1O3PB 3SV7A 2BOHB 1GJ7B 4FVBA 1P05A 2QGRA 1HJAB 1YM0A 1W14U 1MAXA 3SU3A 5C3NA 3F9EA 3PLBA 4JZFH 3S9BA 1ELGA 3A8BA 4KTUA 4BAQB 1W0YH 4X2XA 4ISHH 2ZDAH 9ESTA 2Y5HA 3LU9B 4D7FA 1CT2E 1LVMA 7KMEH 3LPRA 4ISNA 1LPZB 1FDPA 4WVPE 1C5XB 4LK4A 2SGFE 5GIBA 3KQDA 4JYTA 1FI8A 3FP7E 1T4UH 1O5CB 1V2JT 4X0WU 1P2QA 4FUFA 4I8GA 5EPNA 1EKBB 2A2QH 4AZ2B 2JH6D 3ZZCA 4IC6A 8GCHF 1QURH 1CSOE 3ATIA 1KXCA 3TK6A 1F5LA 1FV9A 3A81A 4RSPA 2YNAA 1NRQH 5F8XA 2W7SA 4ABBA 1MTWA 2OQ5A 1LHDH 3GICB 5FHTA 1TBRH 1ZPZA 3A88A 3M5NA 2PKSB 4AB9A 1C9TA 1QQ4A 1Y8TA 4R0IA 2WV4A 4HI3A 1C1RA 1L2EA 2NU2E 5AF9H 1NFXA 2FOBA 2Y5FA 5PTPA 1ABJH 2GZ8A 7ESTE 2TIOA 4AN7A 2SGPE 2XRCA 4NG9H 3LDXH 4FU8A 4X2YA 2PTCE 1YCPK 1ETSH 2I6QA 1TRYA 5AHGH 1O3LA 4B74A 3CS7A 1T7CA 4CRFA 1BTPA 3UOPA 3P8GA 1DWBH 4BNRA 3NZIA 3SQEE 1QA0A 1LKAA 1ORFA 1UVPA 4O3UA 3BG4C 4UONA 4D76A 1GI6A 2P3UB 1YPHE 5FCRA 4CRGA 3MH6A 5C1XA 2CF8H 2ZFQH 4A1XA 2OCVB 1W13U 1O3IA 2GDEH 4ESTE 5C5NA 2Y7ZA 3SJKA 3S7KB 4IN2A 4CRDA 1CO7E 1MMJN 4YT7H 2BTCE 4NWKA 1XUKA 1O3AA 5LGOA 1YPGH 1GPZA 1EZQA 2QN5T 1CHGA 2FI5E 3EA8A 1Y3XA 1ZJDA 2Z6BD 2ZP0H 5DO4H 1L0ZA 1BTYA 3RC4A 2OP9A 1G37A 4OS2A 2NU4E 4XSKU 1BQYA 3OY5U 3M3VA 1AFQB 2ZGCA 1HAPH 3S69A 4MLFB 1SOTA 1ESAA 2GCHF 3GY4A 3FAOA 1AFQC 1GJ4H 3PO1C 4XBBA 3TK9A 1WQVH 1K1PA 3C1KA 2A1DB 5HMAA 2ANKH 1ZGVA 4D7GA 4X1PU 5ESBA 1F7ZA 2WV5A 1FY3A 2STBE 1HIAA 4THNH 2I6SA 4NIWA 3T26A 1GDUA 3OU0A 1IQLA 4MTBA 2A4QA 4BTUB 1CA0B 1HJ8A 1DM4B 1SQAA 5EXNA 1NTPA 1QB1A 4ZXYH 2BD5A 2FOAA 1C2MA 4BXSA 1NRSH 2ZPRA 1S0RA 3A80A 3URDA 3EA9A 1O3HA 1IHSH 1P8VC 1VJ9U 1Z7KA 2W3IA 1NRPH 1O34A 5EU8A 5DP4A 2CGAA 1E38B 5AFZH 4K3JA 2PSYA 2Z7FE 5AFYH 1WCZA 2B7DH 1LHEH 4YOIA 3SU2A 1BTWA 1SGTA 2Y5GA 3OTJE 1QJ7B 2DE8A 3DHKH 4HTCH 3BTDE 3DD2H 3TGIE 4F49A 1P12E 1BUIA 1SLVB 1YPJH 1LDTT 1ZYOA 1MTVA 4X6MA 4SGBE 3B23B 3M7QA 2HNTF 3TH2H 1ZOMA 1O5BB 1INCA 1O2VA 1O3DA 4D9RA 3RXRA 3GOVB 1KDQB 2ZFPH 4FUCA 1CGJE 1EP6A 2BVXH 2WPHS 3SV6A 4TY7A 1V2PT 1X7AC 1GBBA 2QYIA 3M5LA 5FBEA 4E06H 1HDTH 1DICA 1GI5A 3QO6A 2J92A 2IN2A 1J9CH 5A8YA 3LGVA 1SB1H 3RXPA 1H1BA 3VB4A 3ZVAA 2IPHA 1LCYA 2ZU2A 4GVUA 1SGDE 1HB0B 4ABFA 2BMGB 1KLJH 1YCPM 1TNKA 4NZLA 3ZZ6A 3N7OA 1NU9A 1BRAA 3ZVFA 3U8RH 2R0KA 2PR3A 4NA9H 1AHTH 5HGGA 1ABIH 4FUJA 2BHGA 1N8OB 2A7HA 4FUDA 2ZEBA 3TH4H 3ODFA 1MTSA 4RN6A 4Y76A 1ELEE 3MH4A 3E16B 1T8LA 1V2KT 4ZKNU 3SHAH 5CHAB 2Z9KA 4K5ZA 2FWWA 3PWCA 1Y59T 2XCNA 1EB2A 3SUGA 3QDZB 3SNBA 1EOJA 1G36A 3H5CB 1BMMH 1PQAA 2WYJA 2VIWA 3PMHB 5E0HA 3O8CA 1HAVB 2ZF0H 1AMHA 2P95A 1SHHB 2SGQE 3BF6H 4OS5A 6GCHF 1QFKH 5G4BA 2ZU4A 2FOMB 2QIQA 2BDYA 1A4WH 4B76A 1K1MA 1DWCH 1EJMA 1OWEA 1UO6A 5DP9A 1HAOH 1ANEA 1C4Y2 1O2HA 2HVXA 3HKIB 4A5TS 1ZSKA 3B9FH 1FY1A 2OBOA 1PQ7A 2O8TA 2R2WU 1EJNA 5LPRA 1QBVH 2H6MA 4Y0ZE 2BQWB 3SQHE 3GISB 3KIDU 1J15A 3RXKA 1GI0A 2GMTB 1MCTA 4GHTA 4K1EA 4WMFA 4X1QU 1ARCA 3GDUA 1ELVA 1DUAA 1C2LA 4UFEH 2FIRH 1GGDC 4JZEH 3TJUA 2RCEA 3BEUA 1GCDA 1V6DA 1IQEA 3M3SA 4DT7B 2PUXB 2HPPH 2EI7A 3SN8A 1AE5A 5A8ZA 4YO9A 2XBWA 1QJ6B 3DT0H 3GCHC 2FO9A 1SPJA 2PKAB 1P09A 4Z0KA 3MYWA 1SMFE 1CHOF 1HFDA 3ZYEA 4TWWA 1SLWB 1O0DH 3UNQA 2KAIB 1KTSB 1DY9A 1GDQA 4NSYA 1YC0A 1UVSH 4FUEA 1ESBA 2VINA 2FODA 1W3CA 4CH8B 4LOYH 1MBQA 1EZSC 5DP6A 3FVFB 1TA2A 4DJZB 1S0QA 1WUNH 1GHZA 1H8DH 3P17H 1O3KA 1ZTJA 3ATLA 1VITF 1V2LT 2AIQA 4X2WA 5EODA 4K60A 2PWXA 3RLWH 4NGAH 5T6GA 4XOJA 3TJOA 5GCHF 1O3GA 1G9IE 2Y82A 3RM2H 3BIUH 1QIXB 1TFXA 3E8LA 1S81A 1AB9C 1HAGE 1IQNA 1O3MA 1CBWB 1ETRH 2D2DA 4X8VH 3ZV9A 1K1LA 3U9AH 1C1PA 4GCHF 3QTOH 1THSH 2B5TB 2Z94A 3PROA 4YLQH 1O5EH 1NRNH 1GI2A 1Y5AT 3ZVGA 1SGEE 2GCTB 1GMCF 1RTLA 3GY2A 1C1WH 1ANDA 2WPMS 1O3OA 2ZA5A 1Y3WA 3ZZDA 3QZRA 1AGJA 1GI9B 1ZPBA 2GCTC 1UCYK 1TRNA 4AFSA 1ZZZA 2ZDNA 4Q7ZA 2O8UA 4XBDA 1YCPH 1UVUH
chains in the Genus database with same CATH superfamily
1OWHA 2JDID 1OX1A 4X6NA 1K22H 3TU7H 1HGTH 4BAKB 3KQCA 3PMJA 3H7HA 1E0FD 2GV7A 1FPCH 3WWBA 1Z1JA 3RP2A 1CGIE 1FXYA 5H1VA 2FYQA 3MU0A 1DE7H 2G51A 1C2FA 1CHOG 1ELDE 3O70A 3SHCH 1FY8E 2XNIA 1Q31A 5DN6D 5KECA 3V13A 1GMHF 1O2IA 2ZFRH 4AG2A 1GBTA 3KL6A 2BX4A 1QBOA 2XC4A 2BY6X 5T1VA 2ZHQH 1OWIA 3QX5H 3QZQA 2KU3A 2PKAA 1ZLRA 3HTKC 1O3CA 1PFXC 1G2LA 3M37A 3OX7U 3VGCB 3PMAB 2CV3A 1BZXE 3CS0A 2ECNA 1PPHE 1GHBF 1EZUC 1LO6A 2BB4A 4MNYA 1HXFH 1CE5A 1AUTC 1GBJA 1WEWA 4B2AA 1A5HA 1BIOA 4O97A 5FPSA 1S6HA 4WMDA 1VITG 3EGKH 3PUQA 2VWLA 3HKJB 1QY6A 2LXPC 1GBEA 1K2FA 1FNIA 2XWAA 1VKYA 1OP8A 2Z3CA 5GCHG 3MNSA 1QA7A 1V2NT 2F9PA 2P16A 3CENA 3KNXA 1OYTH 1OSSA 1JXPA 2A45B 2YMSB 2A5KA 4D8NA 5FB0A 1OYQA 1O2QA 2PUQH 1TLDA 4Y79A 4F1PA 1DY8A 5KEDA 2UUKB 1LTOA 3K9XB 3F68H 1ZJKA 3BTFE 5TJXA 1PPGE 4IMQA 1LPGB 1LQEA 1A3BH 2FOCA 4CR5A 1G3EA 5SVIB 3O34A 4QQ4A 2A7CA 5B77A 1W2KH 2PHBA 2BD7A 3KHVA 1THRH 4O64A 3GY3A 1P06A 2YUCA 3SHBA 4B71A 4DIIH 4Z0OA 6CHAC 4DG4A 1GMCG 1ZRBA 2EI8A 2XBYA 4INKA 2DUCA 1YPKH 3PTBA 5TCCA 1J14A 1LVOA 2HRVA 1DITH 4Y71A 3L11A 4X8TH 2B0OE 1GJ8B 1O2YA 2RR4A 3KNVA 5DK1A 3NK8A 2EI6A 1BHXF 2BY7X 4I31A 1O3EA 1LHCH 5HXFA 1OXGA 3A8CA 5EW1H 2VBCA 1BB0B 1QR3E 2BLQA 3DA9B 1MQ5A 1QRWA 2F91A 2ZHWH 4CRCA 1D3DB 2H5DA 1WTGH 4FUIA 1O2RA 1O2OA 3BV9B 1EATA 3RPGC 2KWOA 3K6YA 3UFAA 2XYAA 1TQ7B 1OWJA 2ZGHA 2G00A 1C5MD 3KEEA 1NROH 3M5OA 3CP7A 3ZYDA 1GHVH 4BBQA 2YSMA 7LPRA 3M35A 3PLWA 5DKAA 2NU1E 4IBLH 2GGVB 4MQAA 2TBSA 1WDIA 2VPBA 1DCQA 1WYKA 4H42U 3ZVCA 1HAYB 4JCNA 5L6NH 4INLA 1K1OA 1TPAE 2ZCLP 3A7ZA 3VB3A 4AP4A 1V2WT 3RXTA 4AFUA 1WEMA 4YXWD 3BTEE 4I86A 3N7DA 1GHBG 3U98H 5IK2D 1GBIA 2UWPA 3Q3KA 1CA8B 2VVVA 3F9HA 5HIYA 3I29A 3MWIU 1MTNB 1E36B 5F8ZA 3E1XB 5JPMH 1W0ZU 2IQJA 5I46H 1MTNC 2D8SA 2Q1JA 3A85A 1ZTKA 3ELAH 3F6UH 3GDVA 4LLBA 1O2MA 3SGQE 3TGJE 3SU6A 1XXFA 1P0SH 3SJ9A 1FLEE 3PV4A 4KTCA 2AERH 3S0NA 2FZZA 3S7HB 4K8YA 1D6RA 3T28A 3TNTA 4CCGX 2VP7A 4I33A 1CGHA 4IW4E 2YU4A 1AWFH 1DPOA 1JIRA 4DY7B 2M13A 2CK3D 5C1YA 3EYDA 3ITIA 2G5NA 2CHAC 1AFEH 3U8OH 1SGRE 2Y7XA 3T29A 1GVKB 1MCVA 2AMPA 4B86C 3GCNA 1TOMH 2ANYA 3RMLH 4IN1A 2LN0A 5EQSA 3AW1A 1QHRB 3PRDA 2DSMA 4RT0A 1TPPA 5JBAS 2MD8C 4ZUXU 1C5SA 2Y6TA 2HWLB 2VVCA 5C20A 1PPFE 4Y8YA 1C5QA 1OWKA 4FXGH 1JRSA 3SJ8A 2CSVA 5SVIA 1PPEE 3LC5A 1RS0A 3LJUX 1TX6A 1O2SA 1O2UA 1P11E 1EZXC 2WPJS 2A4OA 2GD4B 5J4SA 3SZEA 4I8KA 2P94A 2OTVA 1WILA 1S5SA 7GCHF 2QF4A 1BTHH 4X8SH 2QAAA 4IMZA 4A49A 4X1NU 1ZSLA 1FBVA 1QNJA 1EPTB 3LVRE 1NN6A 1W0KD 4TY6A 3SUFA 5JYIA 1SC8U 4Y7BA 1EPTC 2CKLA 2ECVA 5A8XA 1Y3VA 4ZHLU 5GWZA 2CSZA 2HYED 5IYTA 2ZI2H 3TK5A 1ZR0A 4B6EA 1P3EA 2VH6A 3MU4A 1FQ3A 1GL0E 4BANB 2VJEB 1AKSA 1ELBA 1HBTH 1AZZA 3BG4B 1XVMA 1J17T 4ZKRU 4ABIA 1GI4A 1EAIA 4Z0RA 1H9HE 1TNHA 2RA3A 1K1IA 1W11U 4B75A 3O47A 1RIWC 3U8TH 3TIUA 5FBIA 3MFJA 2WINI 3JZ2B 4JK5A 5JB8S 2LELA 1F5KU 2FI3E 4JMYA 3M7TA 4ZROA 1IQGA 2KWJA 1FN6A 1UMAH 4Z6AH 5J4QA 1PQ8A 1BRCE 1DFPA 2MA6A 1TGBA 3SOUA 1GL1A 2V0BA 4A1TA 5C67A 1P04A 1P2OA 5K3QA 4C9ZA 1F0UA 1LHFH 4MPXA 3HCTA 3NPSA 5A0AE 3SW2B 4ABEA 1A7SA 3SNDA 1ETTH 3SI4H 2LGLA 1VZQH 4I8JA 1B5GH 1O38A 3TLOA 1O2XA 5SGAE 4WXIA 1G25A 4S3OB 1H8IH 3V12A 1PYTC 1EAWA 2BLWA 5EOKA 1A61H 2TGPZ 2RG3A 3PO1B 1VCPA 3VB7A 2VB0A 3BEIB 4S3OC 4A6LA 4XFQA 3UNSA 2KWNA 1UVTH 4WMEA 2GKVE 1O2KA 8GCHG 1K2I1 9LPRA 1THPB 3ATWA 4X6OA 5BPEA 1J8AA 2BLOA 4N3WA 2YOLA 1UHBB 2YNBA 1Q2WA 1UTMA 3LGTA 5C94A 4OS1A 2AH4X 1BTUA 1H8ED 3F9FA 4NFEA 3MQKC 1O5GH 1FIZA 3NCLA 5DP3A 7GCHG 2XW9A 1CHCA 2CJIA 4AYVB 1KSNA 2FP7B 4FIPA 4K69A 4DVAU 4TSFD 1K28D 2VIOA 1TALA 4WZ2A 4WZ3B 2EGPA 3BTTE 2G8TA 2PP6A 2CRRA 1ESTA 5E0GA 1XKBC 1GHAF 4ZCNA 1PQ5A 4DOQA 1VD4A 1SGFA 2ZPQA 1BMFD 1UK2A 2BZAA 2P59A 1HXEH 3N9PA 8LPRA 2ZU1A 3LONA 3V43A 4AYYB 1UCYH 1C2DA 2TGDA 3BN9A 3BTGE 3MU1A 1TNIA 3T2NA 3S9CA 2JRJA 1HV7A 3FP8E 1P2NA 2OBQA 3M3TA 1KTTB 2BQ6B 3GYMA 3PMBB 2RDEA 1E35B 2XCFA 3PLPA 4OS6A 4GNDA 2TGAA 5FB1A 4MPWA 3EDXB 1MUEB 2AHME 1AO5A 4YOJA 2XOZA 1C1TA 2JH0D 2SNVA 4WF8A 1QBNA 4OGYA 1LKBA 5LH8A 2K17A 2E6RA 2WV9A 1FY4A 2RA0A 2WZQA 5K7RA 1UTPA 3LC3A 2JMDA 1U6QA 5A09A 4KELA 2YMSD 3MH5A 4INHA 1Q3XA 3SI3H 1HAHH 2ZHEH 1WEUA 2K0QA 3LJOA 3ZVBA 2H1UA 1BBRK 2ZHFH 2ZTZA 2L80A 2I50A 3KF2A 1IQHA 1TNGA 3KN2A 1T4VH 4OM9A 1TBQH 2TRMA 4KP0A 4HZHA 2LV9A 5SVYA 1BRBE 1TNJA 2A5AA 2J95A 1NPMA 4BTIB 1L1JA 4FOUC 1JMOH 5GPIB 1C1UH 1HYLA 1WIMA 3RLYH 4NIXA 4ZKSU 5EJ1A 4DIHH 3UR9A 3MU5A 2GCHG 2QE7D 2BD2A 1MU8B 4KKDA 1FIWA 3U1IB 1FY5A 2ZKSA 5HKKD 1LPKB 3NG2A 3W94A 1HNEE 1JWTA 4GPGA 5EQQA 2ALVA 3SBKA 2TPIZ 3P92A 4L7XA 4ASUD 1YF4A 3ZZ3A 2FOGA 1BTZA 1XUJA 2BM2A 1SQOA 2QF3A 5HYOA 3O33A 2YVRA 1NFYA 3WWFA 2BQ7B 2M1RA 3F3BA 4LZ4B 3K2UA 2TGTA 2GTBA 3QUMP 1E37B 2AGEX 3LOXA 4I8LA 4FK5A 2QY0B 2VWNA 5DINA 3TJNA 1V2TT 3LT3A 4U30A 3SU5A 4H6TA 2GT7A 5TDWA 4PROA 1K1JA 2XTTB 2HNTC 2UUJB 1GHAG 3KGPA 2Y43A 4NFFA 2FLBH 1M9UA 3P8OA 2GVFA 4F52B 1LVBA 1EASA 4IC2A 4TKPB 1GHXH 3RDZA 2QCYA 3RU4E 4FUHA 5GJ4B 1NM6A 2YSJA 3RXVA 1Z8GA 1MKWK 5K0HA 3LGWA 3FJUB 5I25A 1C2HA 1T8MA 4ABHA 3Q3YA 2QJ0A 3WY8A 2PW8H 3RXHA 2C3SA 2GT8A 4BOHA 1AVWA 3GY5A 2JIZD 3UREA 3LRQA 2HLCA 2ZTYA 1O2LA 1TPOA 2BOKA 4UP0A 1NFWA 4YOGA 3FANA 1LVYA 1W8BH 5T6FA 1E34B 5A2MH 4LXBH 2FI4E 1DVAH 2ZO3H 1G2MA 2NU3E 3UWIA 4AGKA 1SQTA 1RJXB 2OUAA 5DKMA 2LXHC 3MNBA 2J34A 2WPIS 3TVJB 2O9QA 1GWAA 1EXFA 2FOEA 4CRBA 3I77A 1GGDB 2G45A 5JBTA 1SGCA 1BRUP 2A7JA 3A8DA 4MVTA 3DWDA 4WY3A 2BD3A 2F3CE 2G4TA 4ZAEA 4ABAA 1TA6A 3LQHA 1C5VA 3GCHB 4W4UA 3F2GA 1HCGA 4AFQA 3BSQA 2Q6DA 1TMUH 2YREA 2W6JD 2FTLE 3SJIA 3RMNH 1GI8B 1NESE 3O8BA 1UCYE 2MUMA 3M99A 2KCAA 5F03A 2ZCKP 4DW2U 5B8DA 3TITA 1KDQA 1AIXH 1WV7H 3IWMA 1L4DA 3RXMA 5LKUA 1VGCC 4XRNA 1IQMA 3UPEA 5L30H 4IC3A 2WPDD 2RDLA 3SNCA 5DPAA 1QL8A 2OQUA 3R0FA 1X4UA 4LZ1H 2HDPA 4CREA 4ABDA 1BOQA 3ENSB 1LMWB 1UVOA 1E79D 2ZQ1A 1BMAA 1WSSH 3BIVH 4GB0A 2ZQ2A 4F48B 2AMDA 2JH5D 3A7XA 4Q7YA 4RKOB 3SGBE 1P2IA 1RTFB 2BY5X 3IHPA 1ANCA 2FLRH 1TE0A 2DE9A 1GBKA 4AB8A 2AGIX 1J16A 3PTNA 4UFFH 3ZZ4A 2P93A 3BG8A 2KCYA 1SSXA 2WPKS 2PFEA 2ZECA 3RXUA 4YLUA 2CSYA 2G43A 4VGCC 3RC6A 4JK6A 1V2OT 4GSOA 1ID5H 2L43A 4QF2A 2EA6A 1AN1E 5DJ7A 3ZVDA 1AB9B 2BYAX 1YPMH 1T8OA 4YC9A 6GCHG 3DFJA 3MO9A 1BMLA 3GYLB 4Q6FA 2GX4A 2JETB 5GXPA 3V7TA 1CT4E 4GAWA 1CVWH 5EIYA 3PHDA 1NBME 2JETC 2VGCC 5LKTA 1HAVA 3A7VA 1QZ8A 1WGMA 4DCDA 3T6RA 3AK5A 3S9AA 1GJ9B 1T8NA 3V0XA 1DXPA 1JIMA 1XVOA 2J98A 1W7GH 1SLUB 4F4OC 2KR7A 1H9LB 1TGSZ 2XB1A 4D9QA 2BAYA 3RXLA 5A0CA 2FPZA 3HATH 1SGPE 3NXPA 1GI3A 1RFNA 4HGCA 4I8HA 3T27A 4WH6A 5C0TA 1N1LA 2BLVA 4ASHA 3KV5A 2Z9JA 3DFLA 2B8OH 3DUXH 2ZTXA 1IAUA 3A83A 2BDGA 5D1LB 1SGYE 3DSGA 3ZZ7A 5DP8A 3E0NB 1HYJA 1GJDB 2O8LA 2A32A 2DJAA 2PSXA 2WPLS 3SUEA 2CMYA 2OLGA 3FL2A 5B76A 3LGIA 1VCQA 4E05H 2O8MA 1O2PA 3Q00A 1TABE 4LADB 1SI5H 5DP5A 2C90B 1C5RA 3H7OA 3SORA 4A4CA 1XUIA 3NUMA 2ZCHP 3RMOH 3UWJH 4Q4LA 1JBUH 5AVDA 1ZGIA 5KGOA 1ARBA 2FESH 1OPHB 2EODA 1EP5A 1Z8RA 4X6PA 3RTRB 1TWXB 4MVNA 3SZNA 3LH3A 3R3GB 2KAIA 4GHQA 5SVXA 1QB9A 4JZIA 4NIYA 1O39A 2FS9A 3EE0B 1QL7A 4XDEA 1VCWA 2BVRH 4YESB 1KIGH 2AYWA 4Y6DA 1P2JA 1Z6EA 1ZRKA 2P8OC 3ATKA 3M36A 1VITH 1D3QB 1WOFA 3DQVR 4XE4A 1CU1A 2F43B 3BTME 1UW7A 3MNCA 1TBZH 1A2CH 4AOQA 1K0HA 1JM7A 1BMNH 4MPUA 2FM2A 2ZHDA 2AN6A 1RXPA 4R2YA 4WA6A 1C1VH 1BA8B 1D3TB 1HRTH 3RU4T 3MMGA 1C5PA 5A0BA 1UTOA 3UOUA 2AS9A 1FZZA 1LDKC 4GCHG 2QXIA 2ZIQH 3PV2A 3RM0H 2V35A 2AFQB 6CHAB 1TOCB 2ZU5A 3ZZAA 4E7RG 2H9EH 2Y81A 1ELCA 2Q6GA 5TDRA 1MZAA 2OWAA 1WTHD 1F0TA 1GVZA 1ZTLA 6LPRA 2Y1NA 1YGCH 1GBMA 3OEED 2A4GA 2EA3A 1UTNA 4NWLA 2C93B 5C13A 1HAZB 1TMTH 4NCYA 1C4V2 1QTFA 2BX3A 2K1QA 2MA5A 4TWYA 2ANWA 1C5WB 3TH3H 4RI0A 3QN7A 2P3FH 1BTXA 4ZHMU 4OGXA 3RPGB 3D23A 2ODYB 5E2PA 2PTNA 3RUOA 1IQFA 4ISLA 1GBCA 3C5KA 1UTJA 3ZVZB 4FVDA 3UIRA 2HALA 1BJVA 5GDSH 1BT7A 1IQJA 5FL7D 1AU8A 2IJOB 4X8UH 2BDCA 3W95A 1GMHG 1S82A 2XWBI 4RKJB 2FOFA 2PNXA 1G3DA 1GHYH 1C5TA 2BDAA 3D62A 1DLEA 4A1VA 1GJCB 4I7DA 2ECJA 2VIDA 1GBFA 3GS9A 5B6LA 1BBRH 3MI4A 2KWKA 3AAUA 3KQBA 2J97A 3L1ZB 2FDAA 2G6QA 1GJ5H 3PM3A 1DT2A 3ZV8A 3QLPH 1S6LA 2FX6A 4MDSA 2B9LA 1YP9A 1KXEA 2ASUB 3ODDA 3ATMA 2J2UA 4UFDH 5B6OA 4KTSA 2IPQX 1SBWA 2HGTH 2OC1A 2V3OH 3MOCA 5CMXH 4NA8A 4CBOA 3H7TA 4UFGH 3F9GA 2EGMA 1SGIB 2JKHA 2R0LA 2ZDMA 3UR6A 4Q80A 1WESA 2IOTA 4OGCA 2XC0A 2L75A 3LH1A 1XKAC 2CHAB 1ZHMA 4UE7H 2UZGA 2YHOA 1KY9A 5J3XA 2P3TB 2BDHA 5EW2H 2WUCA 4B2BA 1A46H 5LPEA 3A8AA 2W7UA 2W5EA 3F0OA 1YPEH 1DX5M 1ZPCA 5ESTE 1HJAC 3IITA 2A2XH 4TYDA 2ECTA 3N9QA 1QRZA 1MZDA 2WHXA 1O35A 2ZPSA 4K1SA 4O62A 2J9NA 1UK3A 2BD9A 3HCUA 2M5TA 5T6DA 2DX8A 2GP9B 1V2QT 3D49H 3T9KA 2YYRA 4CH2B 2C2VS 3RXDA 1V2UT 1DOJA 4AX9H 3F0PA 3GV4A 4UI9B 5D1KB 3EA7A 2F6NA 2UUFB 2O8WA 3OY6U 1SG8B 3G01A 3P70B 4YBSA 2H9TH 1MKWH 2EC9H 3NKKA 3RXJA 4BXWA 1C1NA 2L6OA 1C2IA 3K6ZA 3ZZBA 1MU6B 1Z8JB 1OWDA 1BITA 1HIAB 4V3KC 4QF3A 1DWDH 4UDWH 2KKXA 3SOXA 1KYNA 1Y3UA 2Z3DA 2ECWA 2FYRA 1V2ST 3P8NA 5E8EH 3MO6A 1TB6H 3AAVA 4ZUHA 1T32A 4V3LC 1AD8H 1P57B 2STAE 3MH7A 3E91A 4ISOA 3N99A 1YBWA 2F42A 5TABA 2QXGA 2EQNA 4CRAA 1Y5BT 1MD7A 4ZH8A 5E2OA 4FU7A 1XX9A 3A82A 3O8RA 4ZKOU 1TMBH 2A4RA 1TX8A 2CRWA 1C2JA 1P9SA 1V2VT 3A7YA 1Z6JH 2CXVA 1DLKB 2PKSC 2Z3EA 1RIWB 1EOLA 4X2VA 1P10A 3KQ5A 1VJAU 5TCAA 1WXRA 1DANH 4ZHAA 2A0QB 3L6PA 3PLKA 1QRXA 1HUTH 2LNCA 5EGMA 1GDNA 4A4BA 1AY6H 3ZVYA 1UK4A 4HG6A 3EE7A 3KCGH 1YWUA 2GJGA 3Q76A 4A92A 3SV8A 2ZGJA 1Z8IB 4O3TA 2AIPA 1O3NA 2EEKA 2OXSA 2JUNA 3GY6A 4FJCA 1MH0A 1KXDA 4Y8ZA 2SGAA 4AYCB 1Z71A 3MTYA 3JZ1B 3A89A 2Y80A 3STJA 5EXLA 2ULLA 2QXHA 1TPSA 1SGFG 2R3UA 1W0JD 3RXOA 4IC5A 4O03A 1AVXA 3MNXA 1XM1A 3GY7A 1P2MA 1BBRE 4TPIZ 1GI1A 4LJNA 4DGJA 1NZQH 4I32A 4XD7D 1EB1H 2QV1A 1W10U 2ECIA 1F0RA 3LGUA 1Y3YA 1XXDA 1V2RT 4AORA 2G5VA 1JOCA 3SJOA 1GJAB 1HLTH 4AUQB 3SU1A 3M7KA 1OP0A 1C9PA 3E90B 2VWOA 3HK6B 3RXFA 5C5OA 2SNWA 2XC5A 1C2GA 2G4UA 2CT2A 2YQMA 5H1UA 2FOHA 1WEEA 1GJ6A 5FPYA 2ZFSA 2G81E 1A0LA 2ALPA 1DS2E 3D65E 2BDBA 1PPZA 2SFAA 3BEFB 1F92A 4E7NA 1IOEA 2MKEA 2QA9E 1TNLA 3KQEA 1WEQA 1NC6A 1VYXA 2ZZUH 3M7UA 1AUJA 2FXRA 2M3HA 4Q7XA 4GUXA 4U01A 3U5PA 4R8TB 1V3XA 3ZZ8A 4ACBA 1VFYA 3URCA 1MM3A 1V2MT 3V3MA 3RMMH 1COWD 2MD7B 1YLDA 4MNVA 1EPTA 2BD4A 2M2AA 1SVPA 1QB6A 2WYGA 2BXTH 1TRMA 3SU4A 3P8FA 3ZZ9A 2G55A 2VPGA 3E6PH 1CA0C 4NA7A 2XBVA 5LPFA 3TJVA 1NFUA 1QCPA 1SOZA 3U28C 3TGKE 1YKTA 1NS3A 1QL9A 2D8UA 8ESTE 4ACAA 1A5IA 1KXBA 1O2JA 1MABB 2CN0H 4BAMB 2KREA 2VJEA 2YT5A 1Z60A 3O8DA 3RXQA 1UTKA 1ZHRA 2SGDE 4FU9A 3UUZA 2BVSH 1CQQA 1AE8H 3N9OA 3ZTGA 2AGGX 2F9VA 5C2ZA 2GDDA 2KYUA 1MKXK 1D3PB 2ANMH 2W26A 3GY8A 3PB1E 2ZETC 5FX6A 3MHWU 3SGAE 1BORA 2D1JA 1Z6UA 1BDAA 5EQRA 4JZDH 5F8TA 4I7BA 1O30A 3W1EA 1BCUH 4K2YA 4FUGA 4X1SU 4L58A 4K1TA 4WJG2 1H9IE 1ZMJA 1MBMA 3FZDA 2C4FH 4GLYA 5ETXA 1WFKA 2FTMA 3UTUH 1BJUA 2D8WA 1O2ZA 2ODPA 1S6FA 1ZHPA 3BTWE 3ZZ5A 3O7AA 3A87A 1JRTA 2H9HA 3A86A 2FX4A 3RXAA 2PUYA 4AVXA 1C5LH 2MNZA 2XXLA 1IQIA 1GBHA 1O3FA 2NWNA 2PLXA 2SGEE 4Y11E 3QWCH 2QC2A 5JBBS 1IYMA 2VWMA 3LJJA 4J1YA 1HJ9A 2ZNKH 4Y8XA 1T1HA 1W12U 1N6XA 3FKSD 4MG3A 3M63A 5H4IB 3U1JB 1TGTA 3OSYA 2ILNA 3I78A 1UHBA 1SGQE 4U32A 2W3KA 3NWUA 2B0FA 3FEHA 2HPQH 2V6NA 1WBGB 5EPYA 3FZZA 2FUUA 1O2TA 2ZFTA 1A3EH 4Q2KA 3ZYQA 3U5OA 1FAXA 3QGNB 1N8OC 4H4FA 3VEQB 3ZNIA 1O5DH 3UAIC 3FOAA 2VU8E 1GJBB 6ESTA 2BY8X 5EG4A 1TQ0B 4DURA 3U5NA 1OKXA 1SL3A 2F6JA 5H1TA 5CHAC 1PPCE 1S83A 2R9PA 3VB6A 2RI7A 1TAWA 1B0FA 3PV5A 5FERA 2Z9LA 3VB5A 2Q6FA 1L1GA 2J4IA 3GCOA 4YTAA 1IHTH 3OTPA 4BAOB 1O36A 3RXCA 4AGJA 4N4FA 1WENA 2VJFB 3E0PB 3N9NA 3OEHD 5JBCS 5AIUA 1GHWH 1TGNA 2AMQA 1B0EA 1P3CA 4O9VA 1G3CA 1ZSJA 5JB9S 2OINA 1O31A 1O3BA 2ZGBH 2BD8A 4ABJA 1F0SA 2UWLA 4B73A 4NIVA 4ZMAH 1WEOA 1C5ZB 2A5IA 1G32B 1XMNB 1O2WA 4XBCA 3GL6A 3AASA 4YT6H 1FAKH 3FM8C 1FN8A 2QXJA 1WQSA 1C5OH 2ZG0H 3SNEA 1VGCB 1O37A 3SOSA 1DWEH 3UQVA 2UUYA 3STIA 1AI8H 2BDIA 1GBDA 2C8XB 2G52A 5L2ZH 1XUGA 2GMTC 2KCPA 2NAAA 4J2YB 4YM9A 3VPKA 1JOUB 3CNRA 3AW0A 1EX3A 3QGJA 4FUBA 4OGEA 3ZPV1 3DSPA 2VJ1A 1PPBH 1GMDF 5CE1A 1U6GB 4LK9A 2VVUA 3GCTF 2KIZA 2FMJA 5FAHA 2F9BH 5BRRE 5C1UA 1P9UA 3T62A 5TRBA 1GBAA 5L2YH 1SGNE 2F83A 4BAHB 4JZ1A 3UQOA 3SYJA 3HK3B 4VGCB 3LIWA 3BTQE 2GZ9A 4WH8A 3RXEA 2XBXA 1ZMNA 1EAUA 1MTUA 1MD8A 1MQ6A 4XI1A 4I7YH 3P95A 1QGFA 5C17A 1FUJA 1L1NA 4SGAE 4OS7A 4JYVH 2OC7A 1ANBA 4CBNA 2D26C 1GCTB 2NU0E 4WXVA 1DUEA 3QTVH 2C8YB 4R8PK 1GCTC 3RU4D 1C5NH 2VNFA 1TX7A 1C1MA 3DSOA 1DSUA 4AG1A 1VR1H 2OC0A 3BTKE 1G3BA 1O2GH 2UWOA 2VGCB 1B7XB 4MPVA 3UB0A 2ZU3A 1O5FH 1O32A 3ZVEA 1A1RA 2F9NA 1XUFA 2J94A 3VFEA 5FPTA 4WWYA 4A7IB 5B78A 3P6ZB 5HM2A 4B2CA 1HAIH 4B1TA 3VXFH 1OP2A 3HGNA 1O3JA 1SR5C 1FONA 2H2ZA 1KXAA 1KMHB 1A0HB 1C5UA 1S85A 4UEHH 1GI7B 2FFWA 2ZFFH 1RTKA 1GG6B 1NO9H 2V7QD 2K16A 2OD3B 2PGBB 2IJD1 4KGAA 1CBWC 1V87A 1GG6C 1PYTD 3HPTB 5DGJA 1KLTA 2OK5A 2YURA 4Y10E 3LVQE 2J38A 3ZPVE 3PWBA 1EJAA 1TGCA 2VJFA 1ACBE 1RRKA 5IDKA 3T5FH 5EJZA 3K65B 2V3HH 4OS4A 5T3HA 2Z9IA 3PYHA 5FXLA 1AZ8A 1TYNA 2EXUA 4MNXA 3U69H 2BXUH 3RXGA 2VIVA 2BY9X 4TPYA 3SU0A 3QK1A 4HFPB 2A31A 4NZQA 2PGQB 1C1SA 1HPGA 3MU8A 3FFGA 4MNWA 3TPIZ 1XUHA 2F9UA 3L33A 4IS5A 1GMDG 1ELFA 4NN2A 3SUDA 3GCTG 1EAXA 3EB5A 3ESTA 1UJ1A 3SO3A 1FJSA 1NRRH 2V3MA 1FX0B 2C8ZB 2HNTE 2VIQA 1K21H 2ZDKA 1UTQA 1UTLM 1X4JA 3BTHE 1OOKB 3NRLA 1P01A 2P8OB 4IGDA 1SFQB 4X1RU 5E0JA 2K4DA 2Z9GA 4YZUA 3AVZA 3OAAD 1C2KA 1IQKA 2ESTE 2FEQH 3LGYA 1F5RA 1S84A 2ZDLA 2THFB 1RGQA 2R2MB 1YLCA 1O33A 3PURA 1D4PB 3SV9A 1G30B 2WUBA 3L3TA 3RXBA 4ABGA 2CF9H 2YQLA 5JG6A 3KYGA 1NY22 3Q3XA 4U2WA 1QQUA 4UD9H 5F6MA 1C5YB 5JDUB 4K8BA 1QJ1B 3C27B 3VGCC 1FPHH 4Z1MD 4X3GA 3SUBA 3M5MA 1K9OE 2R3YA 1C1QA 3A84A 1L4ZA 4JYUH 3KV6A 4R7EA 3TNSA 2L0BA 1GBLA 1O5AB 1LQDB 3UNRA 3OE7D 1NBMD 5FX5A 5FCKA 1DXWA 1TIOA 1GVLA 1D6WA 1YPHC 2AEIH 1YYY1 3F1SB 8KME2 1P02A 4H6SB 1FMGA 2ZGXH 3ZIAD 3F2FA 3MO3A 3T25A 2LGVA 3GDSA 3LKWA 3OYPA 2ODQA 1SLXB 2YMSC 3SNAA 2C8WB 1NU7B 3VXEH 2ZWLH 3Q77A 2K8IA 1OS8A 3E3TA 2ZDVH 4CR9A 2L74A 1YPLH 1KXFA 2GV6A 1D9IA 1CT0E 5EXMA 1AWHB 3UY9A 1ELAA 3B8JA 2VH0A 2L5UA 4BHWA 1A5GH 1N6YA 4PTBA 1WAYB 2C2LA 1YLNA 2HOBA 4NSVA 1SFIA 1EUFA 1F2SE 2BZ6H 2MNYA 2VIPA 1EQ9A 4YBTA 1A0JA 1H4WA 1EFRD 1DDJA 1LHGH 4Y0YE 4QT8C 3M61U 5ABWA 3EQ0H 2ZC9H 3RC5A 2XOYA 4AFZA 2CKLB 1C2EA 2F9OA 1AVGH 3FP6E 1K1NA 1O2NA 3A7TA 3IG6B 5HM9A 2GZ7A 1P2KA 5EJLA 2LRIC 3HGPA 1DSTA 1WU1A 2PV9B 1C4U2 4BTTB 1MKXH 3RXSA 3M62A 1NT1A 4TT3D 1W7XH 1PJPA 2VNTA 3EAJA 1Z1IA 3SOWA 1AKSB 5AITA 1SKYE 2OC8A 1KLIH 1ZMLA 1HYIA 2QF0A 1P03A 1T31A 5DP7A 2QICA 1X4IA 3MHSA 5LKZA 2MT5A 4CHAB 5HIZA 3RXIA 2Y1MA 2JM3A 1BHXB 2H5CA 4LKAA 1RD3B 4CHAC 1MAYA 4ISIH 4F55A 1HAXB 1SHYA 2KCOA 2LPRA 3SV2H 2ECGA 1C1OA 1Y5UT 4M7GA 5G0FA 1ELTA 1AQ7A 4Y7AA 4ZDTA 2FS8A 3A7WA 5DG6A 4ZXXH 1TONA 1O3PB 3SV7A 2BOHB 1GJ7B 4FVBA 3MHHA 1P05A 2J5UA 2QGRA 1HJAB 1YM0A 1W14U 1MAXA 1N87A 5D1MB 3SU3A 3Q1DA 5C3NA 3F9EA 4DT4A 3PLBA 4JZFH 3S9BA 1ELGA 1Z2QA 3A8BA 4KTUA 5EYAF 4BAQB 2JJ1D 1W0YH 4X2XA 4ISHH 2ZDAH 9ESTA 2Y5HA 3LU9B 4D7FA 3LQIA 4P5OB 1CT2E 1LVMA 3FO8D 3LPRA 4ISNA 7KMEH 1LPZB 3H09A 1FDPA 4WVPE 1C5XB 4AC9A 2FSAA 4LK4A 2SGFE 5GIBA 3KQDA 4JYTA 1FI8A 3FP7E 1T4UH 1O5CB 1V2JT 4X0WU 3VG8A 1P2QA 4FUFA 4I8GA 5EPNA 1EKBB 2A2QH 4AZ2B 2JH6D 3ZZCA 4IC6A 8GCHF 1QURH 1CSOE 3ATIA 1KXCA 1WEPA 1ZBDB 3TK6A 1F5LA 3O36A 2KE1A 1FV9A 3A81A 4RSPA 5TBNA 2YNAA 1OHHD 1NRQH 2F4LA 5F8XA 2W7SA 4GNGA 4ABBA 1MTWA 2OQ5A 1LHDH 3GICB 4FO9A 5FHTA 1TBRH 1ZPZA 3A88A 3M5NA 2PKSB 4AB9A 5DSFA 4YABA 1C9TA 3N9MA 1QQ4A 3MDBC 1Y8TA 4R0IA 2WV4A 4HI3A 1C1RA 1L2EA 4GNFA 5B79A 4YBMA 3E2DA 2NU2E 5AF9H 1NFXA 2FOBA 2Y5FA 5PTPA 1ABJH 2GZ8A 7ESTE 2TIOA 4AN7A 2SGPE 2XRCA 2YW8A 4NG9H 3LDXH 4FU8A 4X2YA 2PTCE 2XNDD 1YCPK 4WZ0A 1ETSH 2I6QA 4RT1A 1TRYA 3LDYA 5AHGH 1O3LA 4B74A 3CS7A 1T7CA 3N7EA 2KGIA 4CRFA 1BTPA 3UOPA 3P8GA 1DWBH 4BNRA 3NZIA 3SQEE 1QA0A 2JJ2D 2KFTA 1LKAA 1ORFA 1UVPA 4O3UA 3BG4C 4UONA 4D76A 1GI6A 2P3UB 1YPHE 5FCRA 3DCLA 4CRGA 3MH6A 5G04B 2W6ID 5C1XA 2CF8H 2ZFQH 4A1XA 2XP0A 2OCVB 1W13U 1O3IA 2GDEH 4ESTE 1WE9A 5C5NA 2Y7ZA 3SJKA 3S7KB 4IN2A 4CRDA 1CO7E 1MMJN 4YT7H 2BTCE 4NWKA 1XUKA 1O3AA 5LGOA 2YHNA 1YPGH 2M85A 1E1QD 1GPZA 1EZQA 2FD4A 2XOKD 2XEUA 5GNDA 2QN5T 4GNEA 5G05B 1CHGA 2FI5E 3EA8A 1Y3XA 1ZJDA 2Z6BD 2ZP0H 5DO4H 1L0ZA 5C11A 1BTYA 3RC4A 2OP9A 4FETA 1G37A 4OS2A 2NU4E 2JMJA 4Q63A 4XSKU 4M9FA 1BQYA 3OY5U 3M3VA 1AFQB 2ZGCA 1HAPH 3S69A 4MLFB 2HLDD 1SOTA 1ESAA 2GCHF 3GY4A 3FAOA 1AFQC 1GJ4H 3PO1C 4XBBA 3LQJA 3TK9A 1WQVH 1K1PA 3C1KA 2VPEA 2A1DB 3T7LA 5HMAA 2ANKH 1ZGVA 5LCWB 2LDRA 4D7GA 4X1PU 5B75A 5ESBA 5CDFE 4CA1A 1F7ZA 2WV5A 5F53A 1FY3A 2STBE 1HIAA 4THNH 2I6SA 4NIWA 1E4UA 5FEYA 3T26A 3QZVA 2E6SA 1GDUA 3OU0A 1IQLA 4MTBA 2A4QA 4BTUB 1CA0B 1HJ8A 2KGGA 1DM4B 1SQAA 5EXNA 1NTPA 1QB1A 4ZXYH 2BD5A 2FOAA 1C2MA 5H9MA 5I3LA 4BXSA 1NRSH 2ZPRA 1S0RA 3A80A 3URDA 3EA9A 1O3HA 2WSSD 1IHSH 2H0DB 1P8VC 1VJ9U 1Z7KA 2W3IA 1NRPH 1O34A 5EU8A 5DP4A 4B6FA 2CGAA 1E38B 2KX4A 2QF5A 5AFZH 3HCSA 4K3JA 2PSYA 4P02A 3DPLR 5LKXA 2Z7FE 5AFYH 1WCZA 2RSDA 2B7DH 1LHEH 4YOIA 3SU2A 1BTWA 1SGTA 2Y5GA 3OTJE 1QJ7B 2DE8A 3DHKH 4HTCH 3BTDE 3DD2H 3TGIE 4F49A 1P12E 2IDAA 1BUIA 1SLVB 1YPJH 1LDTT 1ZYOA 1MTVA 4A0CD 4X6MA 4SGBE 1MM2A 3B23B 3M7QA 2HNTF 3TH2H 1ZOMA 1O5BB 1INCA 4AYCA 1O2VA 2M6MA 4H9DA 1O3DA 4D9RA 3RXRA 3GOVB 1KDQB 2ZFPH 4FUCA 3U5MA 1CGJE 1EP6A 2BVXH 2WPHS 3SV6A 4TY7A 1SQRA 1V2PT 1X7AC 1GBBA 2QYIA 2LP6A 3M5LA 5FBEA 4E06H 2KM0A 1HDTH 1DICA 1GI5A 3QO6A 5CHBA 2J92A 2XOCA 2IN2A 2HVYB 1J9CH 5A8YA 2L7PA 3LGVA 1SB1H 3RXPA 1H1BA 3VB4A 3ZVAA 1FP0A 1WEVA 2IPHA 1LCYA 2KR4A 2ZU2A 1E1RD 4GVUA 1SGDE 1HB0B 4ABFA 2CONA 2BMGB 4YAXA 1KLJH 1YCPM 1TNKA 4NZLA 3ZZ6A 3N7OA 3L1XA 1NU9A 1BRAA 3ZVFA 3U8RH 2R0KA 2PR3A 4NA9H 3I2DA 1AHTH 5HGGA 1ABIH 4FUJA 2BHGA 1N8OB 2A7HA 4FUDA 2EY4C 2ZEBA 3TH4H 2LAUA 3ODFA 3ASLA 1MTSA 4RN6A 3PRBA 4Y76A 1ELEE 3MH4A 3E16B 1T8LA 1V2KT 4ZKNU 3SHAH 5CHAB 2Z9KA 4K5ZA 2VPDA 2FWWA 3PWCA 1Y59T 2XCNA 2MIQA 1EB2A 3WW7A 3SUGA 3QDZB 3SNBA 1EOJA 1G36A 3H5CB 1BMMH 1PQAA 2WYJA 2VIWA 3PMHB 5E0HA 3O8CA 1HAVB 2ZF0H 1AMHA 2K1JA 2P95A 1SHHB 2SGQE 3BF6H 4OS5A 6GCHF 1QFKH 4UP5A 3O35A 5G4BA 2ZU4A 2FOMB 2J98B 2QIQA 2BDYA 2OXQC 1A4WH 4MSXA 4B76A 1K1MA 1DWCH 1EJMA 1OWEA 1UO6A 5DP9A 1HAOH 1ANEA 2H0DA 1C4Y2 1O2HA 2HVXA 3HKIB 2JMIA 1DVPA 4A5TS 3O37A 1ZSKA 3B9FH 2RFKC 2LQ6A 1FY1A 2OBOA 1PQ7A 2O8TA 2R2WU 1EJNA 5LPRA 1QBVH 2H6MA 4Y0ZE 2P57A 2BQWB 3SQHE 3GISB 3KIDU 1J15A 3RXKA 4ZQLA 1LDJB 3FN8A 1GI0A 2GMTB 1MCTA 4GHTA 4K1EA 4WMFA 4X1QU 1ARCA 3GDUA 1ELVA 1DUAA 1C2LA 4UFEH 2FIRH 1GGDC 4JZEH 3TJUA 2RCEA 3BEUA 1GCDA 1V6DA 1IQEA 3M3SA 4DT7B 2PUXB 2HPPH 2EI7A 3SN8A 2E61A 1AE5A 5C0UA 5A8ZA 4YO9A 2XBWA 1QJ6B 3DT0H 3GCHC 4PPEA 2FO9A 1SPJA 2PKAB 3N9LA 1P09A 4Z0KA 3MYWA 1SMFE 2FUIA 4B7YC 1CHOF 1HFDA 3ZYEA 1XWHA 4TWWA 1SLWB 1O0DH 1RMDA 3UNQA 2KAIB 1KTSB 1DY9A 3DDTA 3KYFA 1GDQA 5KH9A 4NSYA 1YC0A 4YADA 1UVSH 1F62A 4FUEA 5KH7A 1ESBA 3OFND 2KFWA 2VINA 2LGGA 2FODA 1W3CA 3F2HA 3JUEA 2LGKA 4CH8B 4LOYH 1MBQA 1EZSC 4I7CA 3KDEC 5DP6A 3FVFB 4P00A 1TA2A 1H8HD 4DJZB 1JM7B 1S0QA 1WUNH 1GHZA 1H8DH 3P17H 1O3KA 1ZTJA 3ATLA 1VITF 1V2LT 2AIQA 4X2WA 5EODA 3C6WA 4K60A 5KH3A 2PWXA 3RLWH 4NGAH 5T6GA 4XOJA 3TJOA 5GCHF 1O3GA 1G9IE 1YY3A 2Y82A 3RM2H 3VK6A 3BIUH 1QIXB 1TFXA 3E8LA 1S81A 1AB9C 1HAGE 1IQNA 1O3MA 1CBWB 1ETRH 2D2DA 4X8VH 3ZV9A 1K1LA 3U9AH 1C1PA 4GCHF 3EB6A 3QTOH 1THSH 2B5TB 2Z94A 3PROA 4YLQH 1O5EH 1NRNH 1GI2A 1Y5AT 2KZ4A 3ZVGA 1SGEE 2GCTB 1GMCF 1RTLA 3GY2A 1C1WH 2QIZA 1ANDA 2WPMS 1O3OA 2ZA5A 1Y3WA 3ZZDA 3QZRA 1AGJA 1GI9B 1ZPBA 2GCTC 4YATA 1UCYK 1TRNA 4AFSA 1ZZZA 3KQIA 2ZDNA 4Q7ZA 2O8UA 4XBDA 1YCPH 2KKYA 1UVUH
chains in the Genus database with same CATH topology
1OWHA 1OX1A 4X6NA 1K22H 3TU7H 1HGTH 4BAKB 3KQCA 3PMJA 1E0FD 2GV7A 1FPCH 1Z1JA 3RP2A 1CGIE 1FXYA 2FYQA 3MU0A 1DE7H 2G51A 1C2FA 1CHOG 1ELDE 3SHCH 1FY8E 2XNIA 1Q31A 3V13A 1GMHF 1O2IA 2ZFRH 4AG2A 1GBTA 3KL6A 2BX4A 1QBOA 2XC4A 2BY6X 2ZHQH 1OWIA 3QX5H 3QZQA 2PKAA 1ZLRA 1O3CA 1PFXC 1G2LA 3M37A 3OX7U 3VGCB 3PMAB 2CV3A 1BZXE 3CS0A 1PPHE 1GHBF 1EZUC 1LO6A 2BB4A 4MNYA 1HXFH 1CE5A 1AUTC 1GBJA 4B2AA 1A5HA 1BIOA 4O97A 5FPSA 1S6HA 4WMDA 1VITG 3EGKH 2VWLA 3HKJB 1QY6A 1GBEA 1FNIA 2XWAA 1OP8A 2Z3CA 5GCHG 3MNSA 1QA7A 1V2NT 2F9PA 2P16A 3CENA 3KNXA 1OYTH 1OSSA 1JXPA 2A45B 2A5KA 4D8NA 1OYQA 1O2QA 2PUQH 1TLDA 4Y79A 1DY8A 2UUKB 1LTOA 3K9XB 3F68H 1ZJKA 3BTFE 5TJXA 1PPGE 4IMQA 1LPGB 1LQEA 1A3BH 2FOCA 4CR5A 1G3EA 2A7CA 1W2KH 2PHBA 2BD7A 3KHVA 1THRH 3GY3A 1P06A 4B71A 4DIIH 6CHAC 4DG4A 1GMCG 1ZRBA 2EI8A 2XBYA 4INKA 2DUCA 1YPKH 3PTBA 5TCCA 1J14A 1LVOA 2HRVA 1DITH 4Y71A 4X8TH 1GJ8B 1O2YA 5DK1A 3NK8A 2EI6A 1BHXF 2BY7X 4I31A 1O3EA 1LHCH 5HXFA 1OXGA 3A8CA 5EW1H 1BB0B 1QR3E 2BLQA 3DA9B 1MQ5A 1QRWA 2F91A 2ZHWH 4CRCA 1D3DB 2H5DA 1WTGH 4FUIA 1O2RA 1O2OA 3BV9B 1EATA 3K6YA 3UFAA 2XYAA 1TQ7B 1OWJA 2ZGHA 2G00A 1C5MD 3KEEA 1NROH 3M5OA 3CP7A 3ZYDA 1GHVH 7LPRA 3M35A 2NU1E 4IBLH 2GGVB 4MQAA 2TBSA 1WYKA 4H42U 3ZVCA 1HAYB 4JCNA 5L6NH 4INLA 1K1OA 1TPAE 2ZCLP 3A7ZA 3VB3A 1V2WT 3RXTA 4AFUA 3BTEE 1GHBG 3U98H 1GBIA 2UWPA 3Q3KA 1CA8B 2VVVA 3F9HA 3I29A 3MWIU 1MTNB 1E36B 5F8ZA 3E1XB 5JPMH 1W0ZU 5I46H 1MTNC 2Q1JA 3A85A 1ZTKA 3ELAH 3F6UH 3GDVA 1O2MA 3SGQE 3TGJE 3SU6A 1XXFA 1P0SH 3SJ9A 1FLEE 3PV4A 4KTCA 2AERH 3S0NA 2FZZA 3S7HB 4K8YA 1D6RA 3T28A 3TNTA 4I33A 1CGHA 4IW4E 1AWFH 1DPOA 1JIRA 4DY7B 5C1YA 3EYDA 3ITIA 2G5NA 2CHAC 1AFEH 3U8OH 1SGRE 2Y7XA 3T29A 1GVKB 1MCVA 2AMPA 3GCNA 1TOMH 2ANYA 3RMLH 4IN1A 5EQSA 3AW1A 1QHRB 1TPPA 5JBAS 1C5SA 2Y6TA 2HWLB 2VVCA 5C20A 1PPFE 4Y8YA 1C5QA 1OWKA 4FXGH 1JRSA 3SJ8A 1PPEE 3LC5A 1RS0A 1TX6A 1O2SA 1O2UA 1P11E 1EZXC 2WPJS 2A4OA 2GD4B 5J4SA 4I8KA 2P94A 2OTVA 1S5SA 7GCHF 1BTHH 4X8SH 2QAAA 4IMZA 4X1NU 1ZSLA 1QNJA 1EPTB 1NN6A 4TY6A 3SUFA 5JYIA 1SC8U 4Y7BA 1EPTC 5A8XA 1Y3VA 4ZHLU 5GWZA 5IYTA 2ZI2H 3TK5A 1ZR0A 1P3EA 2VH6A 3MU4A 1FQ3A 1GL0E 4BANB 1AKSA 1ELBA 1HBTH 1AZZA 3BG4B 1XVMA 1J17T 4ZKRU 4ABIA 1GI4A 1EAIA 1H9HE 1TNHA 2RA3A 1K1IA 1W11U 4B75A 1RIWC 3U8TH 3TIUA 5FBIA 3MFJA 2WINI 3JZ2B 4JK5A 5JB8S 1F5KU 2FI3E 4JMYA 3M7TA 4ZROA 1IQGA 1FN6A 1UMAH 4Z6AH 5J4QA 1PQ8A 1BRCE 1DFPA 1TGBA 1GL1A 2V0BA 4A1TA 5C67A 1P04A 1P2OA 1F0UA 1LHFH 4MPXA 3NPSA 5A0AE 3SW2B 4ABEA 1A7SA 3SNDA 1ETTH 3SI4H 1VZQH 4I8JA 1B5GH 1O38A 3TLOA 1O2XA 5SGAE 4WXIA 1H8IH 3V12A 1PYTC 1EAWA 2BLWA 5EOKA 1A61H 2TGPZ 2RG3A 3PO1B 1VCPA 3VB7A 2VB0A 3BEIB 4A6LA 4XFQA 3UNSA 1UVTH 4WMEA 2GKVE 1O2KA 8GCHG 1K2I1 9LPRA 1THPB 3ATWA 4X6OA 5BPEA 1J8AA 2BLOA 2YOLA 1UHBB 2YNBA 1Q2WA 1UTMA 3LGTA 4OS1A 2AH4X 1BTUA 3F9FA 4NFEA 1O5GH 1FIZA 3NCLA 5DP3A 7GCHG 2XW9A 2CJIA 4AYVB 1KSNA 2FP7B 4K69A 4DVAU 1K28D 2VIOA 1TALA 3BTTE 2G8TA 1ESTA 5E0GA 1XKBC 1GHAF 1PQ5A 4DOQA 1SGFA 2ZPQA 1UK2A 2BZAA 2P59A 1HXEH 8LPRA 2ZU1A 3LONA 4AYYB 1UCYH 1C2DA 2TGDA 3BN9A 3BTGE 3MU1A 1TNIA 3T2NA 3S9CA 1HV7A 3FP8E 1P2NA 2OBQA 3M3TA 1KTTB 2BQ6B 3GYMA 3PMBB 1E35B 2XCFA 3PLPA 4OS6A 2TGAA 4MPWA 3EDXB 1MUEB 1AO5A 4YOJA 1C1TA 2JH0D 2SNVA 4WF8A 1QBNA 4OGYA 1LKBA 5LH8A 1FY4A 2RA0A 5K7RA 1UTPA 3LC3A 1U6QA 5A09A 4KELA 3MH5A 4INHA 1Q3XA 3SI3H 1HAHH 2ZHEH 3ZVBA 3LJOA 2H1UA 1BBRK 2ZHFH 2ZTZA 3KF2A 1IQHA 1TNGA 3KN2A 1T4VH 1TBQH 2TRMA 4KP0A 4HZHA 1BRBE 1TNJA 2A5AA 2J95A 1NPMA 4BTIB 1L1JA 1JMOH 5GPIB 1C1UH 1HYLA 3RLYH 4NIXA 4ZKSU 4DIHH 3UR9A 3MU5A 2GCHG 2BD2A 1MU8B 4KKDA 1FIWA 3U1IB 1FY5A 2ZKSA 1LPKB 3W94A 1HNEE 1JWTA 4GPGA 5EQQA 2ALVA 3SBKA 2TPIZ 3P92A 1YF4A 3ZZ3A 2FOGA 1BTZA 1XUJA 2BM2A 1SQOA 2QF3A 5HYOA 1NFYA 2BQ7B 4LZ4B 3K2UA 2TGTA 2GTBA 3QUMP 1E37B 2AGEX 3LOXA 4I8LA 2QY0B 2VWNA 3TJNA 1V2TT 3LT3A 4U30A 3SU5A 4H6TA 2GT7A 4PROA 1K1JA 2XTTB 2HNTC 2UUJB 1GHAG 3KGPA 4NFFA 2FLBH 1M9UA 3P8OA 2GVFA 1LVBA 1EASA 1GHXH 3RDZA 2QCYA 3RU4E 4FUHA 5GJ4B 1NM6A 3RXVA 1Z8GA 1MKWK 5K0HA 3LGWA 5I25A 1C2HA 1T8MA 4ABHA 3Q3YA 3WY8A 2PW8H 3RXHA 2C3SA 2GT8A 4BOHA 1AVWA 3GY5A 3UREA 2HLCA 2ZTYA 1O2LA 1TPOA 2BOKA 1NFWA 4YOGA 3FANA 1LVYA 1W8BH 5T6FA 1E34B 5A2MH 4LXBH 2FI4E 1DVAH 2ZO3H 1G2MA 2NU3E 3UWIA 4AGKA 1SQTA 1RJXB 2OUAA 5DKMA 3MNBA 2J34A 2WPIS 3TVJB 2O9QA 1GWAA 1EXFA 2FOEA 4CRBA 3I77A 1GGDB 5JBTA 1SGCA 1BRUP 2A7JA 3A8DA 4WY3A 2BD3A 2F3CE 2G4TA 4ZAEA 4ABAA 1TA6A 1C5VA 3GCHB 1HCGA 4AFQA 3BSQA 2Q6DA 1TMUH 2FTLE 3SJIA 3RMNH 1GI8B 1NESE 3O8BA 1UCYE 5F03A 2ZCKP 4DW2U 3TITA 1KDQA 1AIXH 1WV7H 3IWMA 1L4DA 3RXMA 1VGCC 1IQMA 3UPEA 5L30H 2RDLA 3SNCA 5DPAA 1QL8A 2OQUA 3R0FA 4LZ1H 4CREA 4ABDA 1BOQA 3ENSB 1LMWB 1UVOA 2ZQ1A 1BMAA 1WSSH 3BIVH 2ZQ2A 2AMDA 2JH5D 3A7XA 4Q7YA 4RKOB 3SGBE 1P2IA 1RTFB 2BY5X 1ANCA 2FLRH 1TE0A 2DE9A 1GBKA 4AB8A 2AGIX 1J16A 3PTNA 4UFFH 3ZZ4A 2P93A 3BG8A 1SSXA 2WPKS 2PFEA 2ZECA 3RXUA 4YLUA 4VGCC 3RC6A 4JK6A 1V2OT 4GSOA 1ID5H 1AN1E 5DJ7A 3ZVDA 1AB9B 2BYAX 1YPMH 1T8OA 6GCHG 3DFJA 3MO9A 1BMLA 3GYLB 2GX4A 2JETB 5GXPA 3V7TA 1CT4E 4GAWA 1CVWH 2JETC 2VGCC 1HAVA 3A7VA 4DCDA 3S9AA 1GJ9B 1T8NA 3V0XA 1DXPA 1JIMA 1XVOA 1W7GH 1SLUB 4F4OC 1H9LB 1TGSZ 4D9QA