3FANA

Crystal structure of chymotrypsin-like protease/proteinase (3clsp/nsp4) of porcine reproductive and respiratory syndrome virus (prrsv)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
197
structure length
192
Chain Sequence
FRTQKPSLNTVNVVGSSMGSGGVFTIDGKIKCVTAAHVLTGNSARVSGVGFNQMLDFDVKGDFAIADCPNWQGVAPKAQFCEDGWTGRAYWLTSSGVEPGVIGNGFAFCFTACGDSGSPVITEAGELVGVHTGGGIVTRPSGQFCNVKPIKLSELSEFFAGPKVPLGDVKIGSHIIKDTCEVPSDLCALLAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and cleavage specificity of the chymotrypsin-like serine protease (3CLSP/nsp4) of Porcine Reproductive and Respiratory Syndrome Virus (PRRSV).
pubmed doi rcsb
source organism Porcine respiratory and reproductive syndrome virus
molecule tags Hydrolase
molecule keywords Non-structural protein
total genus 45
structure length 192
sequence length 197
ec nomenclature ec 3.4.21.114: Equine arterivirus serine peptidase.
pdb deposition date 2008-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3fanA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3fanA02
3.30.40.20 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Chymotrypsin-like serine protease; domain 3 3fanA03
1O3BA 3P6ZB 3VEQB 4YT7H 2AFQB 1FY1A 1GBFA 3KQCA 3SJKA 1P01A 1ZZZA 1G32B 3VB3A 4YTAA 2M5TA 1O3KA 5GCHF 3GY8A 2ZGBH 1AVGH 4FU7A 1P02A 3PTBA 5HYOA 1CGIE 2BDYA 4X8TH 1TNLA 5LPEA 8ESTE 2P16A 3A81A 1EJNA 1O5CB 3VXFH 4LZ1H 2BYAX 2ZCHP 1O2YA 1QURH 1UCYH 1O2SA 1HCGA 4TPIZ 3T5FH 1DY8A 2GCTC 3TU7H 2TGDA 5FAHA 6GCHF 2XBXA 3RMLH 5A0BA 4NGAH 1C1VH 2FX4A 2CN0H 3TJOA 2V35A 1ZRBA 4YOJA 1BTZA 1O3CA 1D3DB 1LDTT 1SGTA 4X1PU 1Q2WA 1IQGA 1MQ5A 1SLVB 4R0IA 2FYRA 1GG6C 2HNTE 1S83A 1V2OT 2O8LA 2XBWA 1A0LA 3LGTA 4INLA 2W5EA 1W0ZU 3LONA 2FODA 1MKWK 6LPRA 3V0XA 1MKWH 1IQHA 1PPCE 4X2VA 1TX8A 2LPRA 3U8RH 2GT7A 3VGCB 1RJXB 1MZAA 4JYTA 5EODA 4FVDA 1PPEE 2A2QH 3TH3H 1DSTA 1TIOA 3PMJA 3PWBA 4AFSA 1FN6A 5C5NA 3GY5A 4F49A 3ZZBA 2GCHF 2ZZUH 1YLDA 2FLBH 2ZFQH 1LPGB 1XX9A 1C1RA 1GPZA 2VIOA 3M5LA 1G36A 5SGAE 1FN8A 1QR3E 1LHEH 4YOIA 1BTPA 2ZHWH 2GTBA 2XXLA 3PLKA 1VCWA 3EDXB 5ETXA 2ZP0H 4K1SA 4HZHA 3ITIA 4NCYA 4ZXXH 4A1TA 4Y8YA 1BJUA 2ZPSA 4XDEA 5I46H 3T26A 4LOYH 4LZ4B 1ZPZA 1LPKB 1SFIA 1P05A 3R3GB 3EQ0H 1TRMA 3BG4C 4K1EA 1AKSB 1J17T 5FHTA 5E0JA 1O3OA 1GBKA 2BY9X 5DP8A 3RXSA 5JB8S 1HAXB 3RMMH 2R2WU 4J1YA 1SLUB 2FM2A 3P8NA 1P9UA 3A7XA 1W7XH 1N1LA 1V2ST 1CT4E 1GJ8B 2FO9A 3EA7A 2UUKB 1N6YA 1YCPK 1Y5AT 1WQSA 2WV4A 4A7IB 3QLPH 1WU1A 2R3UA 1C5SA 2XC5A 4U2WA 2J4IA 1S6FA 4GCHF 3M3VA 4AFQA 2BY5X 2EC9H 1RTFB 3MNCA 1TQ0B 4UFFH 3SU1A 1ELCA 2VH6A 5E0GA 1GBIA 1T31A 3ZZDA 1N8OB 1DWBH 1ZTKA 1DOJA 3RU4E 4X8SH 1WSSH 5ESBA 3ZZ7A 1GHXH 1DFPA 3IG6B 4TY6A 1ESBA 3SN8A 1EQ9A 2Q6GA 1GMDF 3RXTA 2Y82A 4YOGA 1GHBF 1KDQA 1V2JT 1OOKB 4Q7ZA 1O2MA 1O3NA 3M7TA 2Z3EA 4HFPB 1DDJA 1BRBE 5JBAS 2HPQH 2QIQA 5FPTA 4BXSA 4IN1A 1WBGB 1HGTH 1O2OA 3P95A 1HJ9A 3NWUA 1HJAB 1UVUH 1BJVA 2QYIA 1NFXA 1HLTH 3ZVGA 4ABJA 2AGIX 1LTOA 1KY9A 1O2VA 3ATWA 1C9TA 2G8TA 2EI8A 3UWJH 5F03A 1O2JA 1O5EH 1ETSH 2ZGJA 3RM2H 3TIUA 3ENSB 5EQSA 4I7YH 3TPIZ 3CS0A 3ZVFA 3E16B 3BTFE 1HAPH 2K1QA 3MO9A 1ANEA 1N8OC 2BLWA 1SSXA 3ZZ4A 1ELGA 2Q1JA 3A8AA 3IWMA 1O36A 1QHRB 4MTBA 1AKSA 5PTPA 3MI4A 2VWLA 2A5AA 5C67A 3L33A 1C2KA 1NFWA 1A5HA 1W12U 1Q31A 4QT8C 2C4FH 3ZVCA 4MPUA 9ESTA 1G2LA 1SQTA 2FYQA 4CRCA 3I77A 1SGNE 3ATIA 1O3EA 1O2QA 2FX6A 3UOPA 5I25A 4DIIH 2QC2A 4TWYA 2Z94A 1BIOA 4INKA 4XSKU 1AU8A 1NRNH 2V0BA 4Y7AA 1Z7KA 1VCQA 4TPYA 4DCDA 1GL1A 3S0NA 1O31A 2GP9B 1VITH 3EAJA 3PO1C 5LPRA 3A7WA 1LKAA 2A1DB 2AERH 1E37B 1QQ4A 2C8XB 1SHHB 2FOGA 1QL8A 1W7GH 3MYWA 4Q80A 3S9AA 3UNRA 1YC0A 1TNGA 3A84A 3UWIA 2FOMB 5G4BA 3LDXH 4CRGA 1SL3A 3RC6A 2JH0D 1HAGE 3KCGH 5GDSH 1MTNC 1JWTA 1JBUH 8GCHF 1ZR0A 5EG4A 2ZDLA 3M3SA 3FP6E 4AZ2B 1GMDG 3F9HA 4O3TA 3A8BA 2GMTB 4NG9H 3N7OA 4MPWA 2PW8H 2BX4A 3ZZ3A 1Z8IB 1P2KA 1BRCE 1EXFA 3M5OA 1HB0B 2JETB 1AQ7A 1FUJA 2NU3E 4IW4E 1TNKA 4CBNA 1FY8E 2XCNA 1LQDB 3E90B 3BTQE 3SV7A 5FX6A 2FOHA 2KAIB 3A89A 1MMJN 5TCAA 3VGCC 1AFEH 2GDDA 1J9CH 1YGCH 1W11U 2CXVA 2PKSC 2XBVA 4R8TB 1GVLA 5F8TA 1O2UA 3BIVH 3MNXA 3ZVBA 1DITH 2ZHQH 2J9NA 2W3IA 1QRZA 2WPJS 5C5OA 3UFAA 1FPCH 3PO1B 1GJ4H 2Y81A 1MH0A 3O8DA 3BSQA 2B0FA 4Y11E 2OQ5A 2QXHA 1BQYA 4A1XA 4I31A 1OSSA 3T28A 3QUMP 3CP7A 3BIUH 1RFNA 1DLKB 5C2ZA 1C2JA 2GV7A 3MU8A 2GKVE 4FUHA 1TONA 2AIQA 1TGTA 1CVWH 4RSPA 4WMFA 4X1NU 1O39A 1AI8H 1SI5H 2JKHA 3ATMA 1NRPH 1SGEE 1AY6H 1EP6A 1F2SE 4KGAA 4OS7A 1BMAA 1GBHA 1O0DH 3UREA 3ELAH 1AO5A 1K9OE 2NWNA 3MU4A 1TB6H 2WPMS 3O8RA 1NM6A 1FY4A 1GI3A 4WH6A 1QBNA 2VU8E 1MTUA 2Z6BD 1WUNH 1UK4A 3SW2B 1QNJA 4D7GA 4BAOB 1J16A 4MPXA 3RXDA 1ZLRA 1CBWB 2OQUA 2Y5GA 4BAHB 1OXGA 2ZFPH 4SGBE 2ZC9H 3UR6A 4IBLH 2PWXA 3PMBB 3LU9B 3EGKH 2Z3CA 3A8CA 1AWFH 1XKAC 2VVCA 1J15A 1GBJA 2J38A 1SB1H 2Q6DA 4ISNA 4Q7XA 4FUIA 2FOAA 3EA8A 1GGDB 3SU3A 1MU6B 1L1JA 4J2YB 4ZMAH 5J4SA 3QZQA 4VGCC 1TRNA 3FP7E 2NU1E 1ZHMA 2Y5HA 2G5VA 1BDAA 4CBOA 2ZU4A 3SV6A 2BDIA 1GHAG 3RP2A 3PYHA 4ZKSU 1QB6A 3LGUA 4FUEA 2W7SA 1EASA 4H6TA 1AZZA 1K1JA 2W26A 1AVXA 4ABFA 1BRAA 1FLEE 4YM9A 2XWBI 1DT2A 2P8OC 1O2LA 1UTKA 1C1SA 1ZTJA 1OWJA 8GCHG 2DE8A 1AVWA 1BTXA 2UUYA 4A5TS 1H8DH 1CA0C 1ID5H 2VJ1A 2J2UA 1K1MA 1AGJA 1SGRE 1QRWA 5EXNA 3ESTA 2FP7B 3L3TA 1QJ6B 1UTMA 1OPHB 4E7NA 1H4WA 1TX6A 2BVSH 1HNEE 1P12E 1TA2A 3QGJA 1ELBA 1GHYH 1NU7B 4A1VA 2GVFA 1ZYOA 2SGEE 2WINI 1C5QA 1HYLA 1VITG 4F4OC 4FXGH 1O3DA 1CU1A 4IS5A 4GLYA 1BOQA 2BOKA 2ZGXH 3SBKA 4GHQA 2XBYA 1WV7H 1BMLA 5A0CA 5EW1H 1AUTC 2KAIA 2GX4A 1DY9A 3A7TA 2O8UA 3UNSA 3CS7A 4ZHAA 3E0NB 4CR5A 2PGBB 2PKAA 2H6MA 3RXRA 3ZV8A 2AEIH 1AB9B 4X6PA 1OWHA 3T27A 1SBWA 3D62A 1C9PA 3V7TA 1UK3A 5FBIA 1PPGE 1C5OH 3BTDE 2J94A 4Y79A 1TNJA 1GL0E 3SUGA 4DOQA 1D3QB 4NFFA 3AASA 3C27B 3SJ9A 1SPJA 3GY2A 2A45B 1V2PT 5C1UA 3O8BA 3SI3H 1JMOH 4CHAB 4MNWA 1SOTA 4DG4A 1GBLA 2SGPE 1ACBE 1UTOA 1RIWB 1Y59T 1C1UH 2XC0A 5EPYA 1ZPCA 2F9PA 1QY6A 1TBZH 3RMNH 1C5WB 1F5RA 3BEUA 1SGYE 4D76A 4MNVA 3KEEA 2AGGX 2HWLB 1C5XB 4NFEA 3ATKA 3T62A 1P3CA 1GJBB 4A6LA 1F0UA 4K60A 4BXWA 3TLOA 4TWWA 1O3GA 2HOBA 5CHAC 1NT1A 2V6NA 1ZSKA 3M7UA 5EU8A 1EPTB 1T7CA 1HAIH 2FTLE 2R2MB 3GCNA 1FAXA 4ABEA 1UHBA 5E2OA 1Z6EA 2JH6D 1P9SA 5BRRE 2HPPH 1MQ6A 2A5IA 1C5NH 1OS8A 3U8TH 2WV5A 2BD9A 3AVZA 3GYLB 1ETRH 1N6XA 1AHTH 2QAAA 2B8OH 4INHA 1S84A 4WMEA 1HXFH 2BB4A 3MH6A 1MKXH 1IQIA 4WVPE 3HATH 3TJUA 5EQQA 2AS9A 5T6GA 3A7YA 1O5DH 4I8JA 1MAXA 1M9UA 3BN9A 2D2DA 1TOCB 2C90B 5HGGA 3SUEA 4ZKOU 1Q3XA 3SNBA 1TMUH 1CO7E 3MU0A 5L2YH 1NO9H 2PKSB 1OWIA 4FU9A 4B1TA 2AH4X 4I32A 4YZUA 1PYTD 3VPKA 1TA6A 3TH4H 4UONA 1ELFA 4ZAEA 2D8WA 4Y8ZA 2ILNA 1BTWA 2CF9H 1O2PA 1ANBA 2D26C 1MTSA 2BXUH 2RA3A 4ABDA 2RG3A 4NWLA 1A7SA 1Z8JB 2ZHEH 3EA9A 1TPOA 2VIQA 2Z7FE 1W14U 2W7UA 3RLWH 2QV1A 3ZVAA 2SGDE 2HNTF 1D3TB 2PUQH 3U98H 3SQHE 3B8JA 4XBDA 2H9HA 1YPMH 1HAOH 1LHFH 2ANWA 2SFAA 1GBTA 1Y3YA 1F7ZA 3PM3A 3QX5H 4ZHMU 3MH5A 2I6QA 2OP9A 2BD8A 1ANDA 3U9AH 1GBCA 4DVAU 3KHVA 1EAWA 1S85A 4JK5A 3K2UA 1O3HA 1QBVH 2UWLA 3LH1A 3SHCH 1GJ9B 2WYGA 1RRKA 1AB9C 1TWXB 1HFDA 4MG3A 2ZI2H 3JZ2B 1MCVA 2BXTH 1XVMA 5AVDA 1DSUA 1GJ6A 4B73A 3URDA 1LO6A 2TGTA 3HPTB 2Z9LA 3BTME 4DGJA 1H9LB 3F68H 3NKKA 4Y8XA 1OYQA 3AW1A 4VGCB 1EATA 1AZ8A 3UOUA 3E1XB 4JZDH 1ZGVA 1MBQA 1KXDA 3BTKE 4B71A 3TGIE 5CHAB 3Q76A 2SNWA 1C2FA 4OGXA 4GVUA 3M5MA 1GI6A 2A4OA 3PTNA 2OC0A 1G3CA 1WAYB 1GBMA 1Y3UA 2ZF0H 1CBWC 4MPVA 1XMNB 3BTHE 2PV9B 4DT7B 1PPZA 4Y10E 3ODFA 1ELTA 2ZTYA 1OKXA 2O9QA 1T32A 4AGJA 5TCCA 2BTCE 1ELAA 2V3HH 4I8KA 3SORA 2F9NA 3P8GA 1PQ5A 1F92A 3VFEA 1C2IA 1HAVB 1GHAF 2OXSA 1P03A 2FS8A 2QXIA 1B0EA 2C3SA 1O5GH 3GY3A 3DHKH 1P2JA 1YPJH 3TK5A 4GCHG 2ZDVH 3BEIB 1YCPH 2OLGA 1WOFA 1HAHH 2RDLA 2OBQA 1BCUH 2V3OH 3LT3A 4JZIA 1P11E 1B0FA 3DA9B 3M7QA 3UNQA 3RU4D 5EW2H 1DXPA 3LC3A 1PQAA 2F91A 3K65B 2BZ6H 1IQEA 1YKTA 2AIPA 2G00A 3SNDA 1C5YB 1CSOE 1D4PB 1YLCA 2GD4B 1Y5BT 3LIWA 4HI3A 4HGCA 2QGRA 4Y76A 1V3XA 2WPKS 1C2MA 5FBEA 2ZDKA 4GSOA 2BD7A 1ELVA 3LGYA 1L1NA 1W10U 3FANA 2ANMH 2PTCE 1IQNA 4ISOA 4K5ZA 3P8FA 3LJJA 2UWOA 1XUIA 3GCTG 4KTSA 4WMDA 4ISIH 2PKAB 2TBSA 1FJSA 3MU1A 1P57B 5A2MH 1UK2A 3HKJB 3BTEE 3Q3XA 3F6UH 1BA8B 2ZA5A 5J4QA 1QA7A 4Z0KA 2SNVA 5E0HA 2ANYA 3KIDU 2OBOA 2VWOA 1NC6A 2NU2E 8KME2 4YO9A 5EXMA 3FAOA 3PMAB 1P0SH 5LH8A 5C1YA 4UDWH 4NIWA 3ZZ9A 1V2KT 1L4DA 1EX3A 1T4UH 3A80A 1QGFA 1H1BA 4JYUH 5C1XA 3QZRA 7LPRA 3GISB 4WH8A 1T8MA 1G3DA 1KLTA 5FX5A 1ARCA 3M37A 3A85A 1C5RA 1D6RA 5DP4A 4AOQA 2H9TH 1RS0A 1CHOG 1A61H 1YF4A 2STAE 1O2TA 1AUJA 4D7FA 2W3KA 4PROA 3FZDA 1G30B 2IJOB 1AFQB 2GDEH 1SGFG 3OY5U 3GCHC 1ELDE 2DE9A 3PLBA 1P3EA 1C1QA 3SV8A 1QFKH 3Q00A 1GMCG 3E91A 3MU5A 3UTUH 4UD9H 1A46H 1TFXA 1C5PA 3SQEE 3DD2H 1UCYK 2BMGB 1CGHA 2CHAC 3C1KA 3H7OA 1FY5A 4ABBA 4CH2B 3MFJA 2P94A 1GWAA 2OUAA 4NZLA 1TBQH 3SUDA 5EPNA 2ZG0H 3RXJA 5EGMA 1GI7B 2FOCA 1GJCB 1CA8B 2CV3A 4NIYA 2QA9E 1JRTA 1TNHA 2VIVA 2ZCKP 3P8OA 5F8XA 4O03A 2C8WB 5T6DA 3QGNB 2GCHG 4THNH 3NZIA 1LVYA 4X1SU 1DUAA 1UTLM 1OWDA 1O5BB 1FV9A 4GAWA 3UQVA 3SJOA 3S9CA 1ELEE 4ISLA 1AMHA 2FOEA 2CMYA 2ZGCA 1EUFA 2OC1A 3SNEA 2QN5T 5BPEA 1P2OA 1MU8B 3RXVA 3H5CB 3OY6U 4D9QA 5GWZA 3A8DA 2BVRH 3SU6A 3NPSA 4X1RU 1BTHH 6ESTA 1A5GH 1X7AC 1AIXH 5ESTE 5FCRA 5K7RA 4WJG2 3CENA 1P06A 1A5IA 1GI0A 1OP8A 1O2GH 2OC8A 3T29A 1O2NA 2ULLA 4BTTB 1DM4B 2F3CE 1O3MA 4KKDA 5JBBS 2WPIS 1C1OA 1O2IA 2QF0A 1Z1IA 3HGNA 5GIBA 2XRCA 1UTQA 3E8LA 1CHOF 3LKWA 3A7ZA 1K21H 2FMJA 4MQAA 1SR5C 1C4Y2 4DY7B 1P09A 2ZFRH 1HPGA 4B74A 5A8YA 8LPRA 4TYDA 1UVTH 2A32A 2H5CA 2HVXA 3DFJA 3TVJB 1NPMA 2DUCA 4TY7A 5C20A 1EB2A 1ZPBA 3NXPA 1Z8GA 4XE4A 4I8LA 1ZJKA 4WWYA 1SGIB 2FLRH 3TNSA 5GXPA 2CGAA 2EEKA 3SNCA 1JXPA 1C2LA 3MH4A 1E0FD 3I78A 1THSH 2PTNA 2P3FH 3LGVA 1DE7H 1G3BA 1L2EA 2I6SA 3I29A 1JIMA 3M5NA 3ZVDA 1QA0A 4UFDH 1KXCA 4CRBA 1BTUA 4O9VA 2ZDAH 3GCTF 1G3EA 3GICB 2HRVA 2BLQA 3A82A 3RXHA 4AFZA 1V6DA 2ZQ1A 1DXWA 4H4FA 1TBRH 1YP9A 1O34A 1HJAC 3IITA 1FXYA 3K9XB 3GOVB 4AG1A 1O3PB 5AFZH 3SU5A 1YPHE 2ZTZA 5DJ7A 1LMWB 4CRFA 3SV9A 2YNAA 4Y7BA 4YESB 3SU2A 1TGCA 1WTGH 3KQEA 1NFUA 1SMFE 2AGEX 1Y8TA 2TRMA 1K1OA 2A4QA 3MNSA 4BAQB 3S9BA 3F1SB 1O37A 1FY3A 2F9VA 3BTWE 2GCTB 3BG8A 4ASHA 4Y6DA 3RXQA 3SNAA 1ZGIA 2VB0A 3RXOA 3ZYDA 1PYTC 5EXLA 1SOZA 1EAIA 2BDAA 4B2CA 1RTLA 1UTJA 1C5VA 1EOLA 1UVSH 1K2I1 1TQ7B 4CR9A 2ZPRA 3D23A 3L6PA 3RDZA 4JZEH 3T25A 2PSYA 3FFGA 2Y7XA 1QTFA 4ZROA 1P2MA 3TJNA 1D6WA 3W94A 1UMAH 2AMQA 4KTUA 4AYVB 1C5LH 1LHDH 2VGCB 4MDSA 4KTCA 4I8HA 2F9UA 3AW0A 4BTIB 2VIWA 1O5AB 1ZOMA 4I33A 3ZZ6A 1LKBA 1GJDB 5DP5A 2O8WA 3V3MA 1IQMA 3RXKA 1V2WT 2ZQ2A 1EAUA 1ARBA 1O38A 1KDQB 1NS3A 1QB9A 1HAVA 1LHGH 1GBEA 2FZZA 1HIAB 1C5TA 1MTWA 1O2KA 3ZZ8A 1SLXB 3UQOA 1KLIH 5L2ZH 4X6MA 4ZHLU 3BG4B 1RD3B 1UCYE 1GHZA 5DP9A 5AFYH 1INCA 3HK3B 3SGAE 4KP0A 4K3JA 4NA8A 1BBRE 1H8IH 5IDKA 1RIWC 3V12A 1TALA 1QQUA 5HM2A 2PUXB 3GCOA 5A09A 4CREA 3D49H 2J95A 2WPLS 4OS1A 1PQ8A 5L6NH 1PQ7A 2ZDNA 2LNCA 4FU8A 1P2NA 1HAZB 2R0KA 3LGIA 1TMTH 4ESTE 1ZMNA 1SVPA 2GT8A 3BTGE 1AE5A 2ALVA 5A8ZA 1KXBA 2IN2A 2J34A 1DPOA 1EJMA 2J92A 3KN2A 2VINA 6CHAC 1Z6JH 3ODDA 4RN6A 4CRDA 1W0YH 1TRYA 4IGDA 1C1NA 1O3JA 1EZUC 1VJ9U 2OCVB 1E38B 2P59A 2PSXA 3RXMA 1GJAB 2FI3E 2XTTB 2HGTH 5DP7A 3MO3A 2F83A 1EAXA 1QB1A 2ZEBA 3S7KB 1ESTA 1ZMLA 2G51A 4Y71A 1Y5UT 1GMCF 2JH5D 1DX5M 1V2LT 1DANH 1KTTB 1MBMA 2TGPZ 2YNBA 1LCYA 2ODPA 1TPSA 2G5NA 1RGQA 5DKMA 4MVNA 2WUBA 5B6OA 2BHGA 1GCTC 1TPAE 1YM0A 5JPMH 1ZMJA 5T3HA 1F5LA 3HK6B 2XNIA 5DK1A 2H9EH 4NIXA 2SGQE 3NCLA 2ZFSA 3DFLA 1IAUA 1FDPA 1ZRKA 1EKBB 1L1GA 5JBCS 4U32A 2EI7A 1B5GH 1T4VH 4X0WU 4X6OA 4MNXA 2TPIZ 4FUBA 2ZDMA 3U69H 3AAVA 3R0FA 1GMHF 4FUGA 4JCNA 1KYNA 3TGKE 3TH2H 1ETTH 4UEHH 3S69A 2A4GA 2ZO3H 3QDZB 5JB9S 4BOHA 3BEFB 3S7HB 3GDSA 3BTTE 1ABJH 1D9IA 1F0SA 4FUJA 4WY3A 3UPEA 3P17H 1S81A 4DJZB 1BRUP 4NSVA 2Z9GA 2VVVA 1C1MA 3TK9A 2AYWA 1NRRH 4BTUB 3SJIA 3GDUA 3PWCA 4ZKRU 3OYPA 1IQKA 1KTSB 1FI8A 5DPAA 3RC5A 3ZZAA 5FCKA 3ZZCA 3TGJE 1Y3XA 2P3UB 2STBE 3RXEA 4AG2A 3E0PB 4GUXA 2FDAA 1GVKB 3KNXA 3OSYA 5E8EH 4AFUA 1O2XA 2GMTC 3RM0H 4UFGH 4ABGA 2G4TA 2H1UA 1XVOA 1YYY1 1BITA 1HIAA 2JETC 3QO6A 2Z9JA 2ZPQA 3NUMA 4O3UA 1EPTA 1FMGA 2H2ZA 4DW2U 3SHAH 3EYDA 5F8ZA 4X8VH 2BM2A 2XWAA 4YLUA 1TLDA 2Z9KA 4YT6H 1LQEA 2CHAB 1ZTLA 1EP5A 1B7XB 1V2RT 3KQBA 3KL6A 1SGPE 1KSNA 2B7DH 1YCPM 2TGAA 2BD2A 1GI4A 3M36A 1ZHRA 1SFQB 3PV4A 4IC6A 2ZHFH 1BBRK 1C2DA 2ZFTA 4H6SB 1O5FH 1AD8H 1IQLA 1HBTH 4NA9H 1VITF 1HAYB 3RXBA 3M35A 1SHYA 4X1QU 1HDTH 1YBWA 4XFQA 3SZNA 1C1TA 1VR1H 4ABAA 2ZCLP 3RXCA 5AF9H 4FVBA 5HXFA 1AWHB 2ZGHA 4GPGA 1GMHG 1OYTH 1DVAH 3VB4A 1XXDA 3A83A 1LPZB 3A88A 4XOJA 1MD7A 4FUDA 4JK6A 1DWEH 2GZ7A 1AN1E 3A86A 4SGAE 4B2BA 1TE0A 1WYKA 4ISHH 1YPGH 2FOFA 4U01A 3K6ZA 1GG6B 2GZ8A 2ESTE 2BD3A 3SGBE 3BV9B 3Q77A 4E7RG 1P04A 2ASUB 5DP6A 2UUJB 2THFB 2H5DA 4Q2KA 1NN6A 2WUCA 4K69A 1AFQC 1ZSJA 1KXAA 4OS5A 1GCTB 4A92A 3FZZA 4X2XA 1EZXC 3LH3A 2XYAA 3RXLA 4RKOB 1T8LA 5DP3A 4B75A 1T8NA 2VNTA 2HALA 3QK1A 1F5KU 5GJ4B 1GI8B 1P2QA 1H9IE 3B9FH 1E34B 5DG6A 3SV2H 7GCHG 2ODQA 5EOKA 1OWKA 2Q6FA 2G4UA 2FTMA 1EZQA 3LJOA 2ODYB 2FESH 2XC4A 3KF2A 3FVFB 1CGJE 1V2VT 1UTNA 1A3EH 3Q3KA 1V2QT 1VZQH 2BD4A 1PPBH 3TK6A 2TIOA 2D1JA 3A87A 1ORFA 1XUGA 3OX7U 3QTOH 4X8UH 1TAWA 1ZSLA 4B2AA 1YPKH 1KXFA 2BY7X 2YOLA 5DGJA 2QXGA 2FIRH 2CF8H 3LPRA 3O8CA 4JMYA 4GHTA 1S5SA 3NK8A 4CRAA 5JYIA 1FONA 1GHVH 1O35A 1MUEB 4I8GA 3SI4H 1A0JA 1YPHC 5CE1A 1HV7A 2XCFA 2OTVA 3K6YA 1OX1A 1FQ3A 1A2CH 3LOXA 1EB1H 3MOCA 1LVMA 2B9LA 1LVOA 1RXPA 3SUFA 3E3TA 5T6FA 1PFXC 1GI5A 1C4U2 2AMDA 2BQWB 1SLWB 5JDUB 1MCTA 2VGCC 4JYVH 1GBDA 3SO3A 1GCDA 3UY9A 1QL7A 1Z71A 4OGYA 2EA3A 1BZXE 3EE0B 4NZQA 2RCEA 1FAKH 3OU0A 5H4IB 1C4V2 1O30A 2R0LA 1XXFA 1QIXB 1GDQA 2Y6TA 1CE5A 2VWMA 5AHGH 3F9FA 1OWEA 3T2NA 1CHGA 4OS6A 1UVPA 2SGAA 5A0AE 1BB0B 1KLJH 3M3TA 1YPLH 3VB6A 1XUJA 4IC5A 1S0QA 2O8MA 1CT2E 1G2MA 3ZV9A 1TGSZ 1GDUA 3STJA 1A1RA 4AYYB 1CT0E 3MTYA 4KELA 2G81E 2ZTXA 1PJPA 3FP8E 2GV6A 3ZYEA 1GJ7B 3MNBA 4NWKA 4WF8A 1BUIA 2PGQB 1O2WA 1S6HA 3HKIB 2Z9IA 4NIVA 2P3TB 7ESTE 1HRTH 1XKBC 4WXVA 2A0QB 1CQQA 1JOUB 1NU9A 3U8OH 1QCPA 4Y0ZE 3ZVEA 2C8ZB 4Z6AH 2P95A 1K22H 1VGCC 4LXBH 1GHBG 2A31A 1NESE 3KQDA 3OTJE 4X6NA 3URCA 1ZJDA 3A7VA 3TNTA 2Z3DA 2O8TA 1OP0A 1DWCH 3PB1E 3BF6H 1F0TA 1O3IA 1Y3WA 5FPYA 1WTHD 3TJVA 1SC8U 3UIRA 1TABE 3RXFA 3UR9A 3RXIA 1SGFA 1W8BH 1XUKA 2RA0A 2BX3A 2ZU3A 4AORA 3MHWU 1EOJA 4BAMB 1U6QA 7KMEH 9LPRA 1QJ7B 1QRXA 1NFYA 1PPFE 2ZU5A 2B5TB 3RC4A 4Q7YA 3PLPA 3LGWA 1EZSC 2OD3B 1DICA 1K1PA 2QCYA 4K8BA 1MAYA 1NRQH 4FUFA 1OP2A 2IOTA 3P70B 1ESAA 1GHWH 1QJ1B 1TNIA 4NA7A 4UFEH 1HUTH 2R3YA 1C1PA 1GBBA 1MD8A 2QXJA 1O2HA 3MMGA 2PHBA 2XW9A 1RTKA 4XBBA 2ZFFH 1J14A 1JIRA 1BHXB 3RLYH 2GZ9A 1S0RA 4CHAC 3SGQE 4D8NA 2BDBA 3WY8A 2QY0B 2VIDA 1FIWA 2ZKSA 3Q3YA 4AGKA 1DWDH 3ATLA 3RUOA 1E35B 1KIGH 1T8OA 1F0RA 2C93B 2FOBA 1NROH 1MTVA 1A3BH 1TGBA 1O2ZA 1XUHA 2FEQH 1VCPA 4ZUHA 4UE7H 4JZFH 3VB5A 3SOSA 5EQRA 1QL9A 2VIPA 1AE8H 2FXRA 1UVOA 4RKJB 1NY22 2HNTC 2BQ6B 2ZWLH 3RXUA 1K1LA 4ZXYH 5CMXH 2ZHDA 1QBOA 1THPB 5ABWA 1XUFA 3STIA 3W95A 3RMOH 3P92A 5FPSA 3V13A 1MKXK 1O2RA 1LHCH 3KGPA 2NU4E 4AN7A 1JRSA 3DT0H 1BMMH 1THRH 2BLVA 5IYTA 5F6MA 1UHBB 4K1TA 2HLCA 3ZZ5A 2A5KA 1ANCA 2G52A 1IHSH 3DUXH 1GI1A 4BAKB 3QN7A 5DO4H 1SGDE 1FNIA 1V2TT 1NTPA 3PMHB 1TOMH 1ZHPA 1UO6A 1EJAA 2VVUA 1WQVH 3QWCH 2QF3A 1P10A 1SQAA 3M61U 2FI5E 1GJ5H 2BY8X 2PR3A 1S82A 1PPHE 5LPFA 1BBRH 3PROA 1L4ZA 2VWNA 1C2GA 2VH0A 4BANB 1C2HA 3F9GA 5K0HA 1DS2E 1C5MD 2F9OA 1EPTC 4BNRA 2FS9A 3RXGA 1YPEH 4E05H 2IPHA 1SQOA 4DURA 4YLQH 6CHAB 4XBCA 3MO6A 4M7GA 1C5ZB 2FWWA 5LGOA 3TITA 1L0ZA 1W3CA 1IHTH 4B76A 1GDNA 1LVBA 1GI2A 4CH8B 2OC7A 3GY4A 2C8YB 1BTYA 2BLOA 2WPHS 3F9EA 1HXEH 2AMPA 2WYJA 3GDVA 1HJ8A 4DIHH 4OS2A 3MH7A 1O33A 2F9BH 2PLXA 1IQJA 3MWIU 3HGPA 4HTCH 4U30A 3RXPA 4IMZA 1BMNH 2ZU1A 2BOHB 2BDHA 2PFEA 2Y7ZA 3E6PH 3RXAA 3VXEH 4IN2A 1C1WH 4NSYA 3SU0A 4ABIA 1FZZA 2BQ7B 1Y3VA 3JZ1B 5E2PA 7GCHF 2A7HA 3U1IB 2BVXH 4FUCA 2GGVB 1W13U 1TMBH 1TX7A 2P8OB 1A0HB 6GCHG 5HMAA 4AB9A 2UWPA 5A8XA 1IQFA 1DLEA 1O3AA 1GI9B 1Z8RA 3B23B 1P2IA 1TPPA 2NU0E 1H9HE 1DUEA 3UUZA 2ZNKH 3AAUA 4E06H 1SGCA 1O3FA 4H42U 4O97A 1BHXF 1MZDA 1G37A 1VGCB 4ZH8A 2R9PA 3GY7A 1KXEA 3RU4T 3GCHB 4K2YA 4OS4A 3QTVH 1XM1A 2FI4E 4MLFB 1CA0B 1NZQH 1UJ1A 4WXIA 1C2EA 1TGNA 3G01A 1D3PB 4X2YA 2P93A 4Y0YE 2ZU2A 1UTPA 2ALPA 2UUFB 1O32A 1V2UT 1SGQE 2ZIQH 2ANKH 1FIZA 1BT7A 2A7CA 2BD5A 4AX9H 3LC5A 3D65E 3SJ8A 2A4RA 1E36B 2A7JA 1GVZA 1K1IA 2Y5FA 1TYNA 1W2KH 1SG8B 5GCHG 1O3LA 1WCZA 1FPHH 2FPZA 1V2MT 1IOEA 2CJIA 5FXLA 2EI6A 3GY6A 2BZAA 2A2XH 4ABHA 5GPIB 4AB8A 5JBTA 1MTNB 4IMQA 3SU4A 1GGDC 2ZECA 5TJXA 2BDGA 1G9IE 4X2WA 5L30H 4JZ1A 4MNYA 3U1JB 2BDCA 1P8VC 1NRSH 1VJAU 2G55A 4LK4A 4D9RA 2Y80A 1K28D 1ABIH 4ZKNU 1V2NT 3H7TA 2OINA 1K1NA 1J8AA 5HM9A 1C5UA 1A4WH 1GBAA 3VB7A 2BY6X 3GYMA 2SGFE 5C3NA 4K8YA 1Z1JA
chains in the Genus database with same CATH superfamily
1O3BA 3P6ZB 3VEQB 4YT7H 3SOXA 2AFQB 2RR4A 1FY1A 5B79A 1GBFA 3KQCA 3SJKA 1P01A 1ZZZA 2I50A 1G32B 3VB3A 4YTAA 2M5TA 1O3KA 2QF5A 5GCHF 3GY8A 2ZGBH 1AVGH 5LKXA 4FU7A 3VG8A 1P02A 3PTBA 5HYOA 1CGIE 2BDYA 4A4BA 4X8TH 1TNLA 5LPEA 1WEEA 8ESTE 2P16A 3A81A 1EJNA 5KH3A 3CNRA 1O5CB 3VXFH 4LZ1H 3F0OA 2BYAX 2ZCHP 1O2YA 1QURH 4XD7D 1UCYH 1O2SA 3FN8A 2YT5A 2E6RA 1HCGA 4TPIZ 3T5FH 1DY8A 2GCTC 3TU7H 2TGDA 5FAHA 6GCHF 4BHWA 2XBXA 3RMLH 5A0BA 4NGAH 4XRNA 1C1VH 2FX4A 4O64A 2CN0H 3N9QA 3TJOA 2V35A 4I7CA 1ZRBA 4YOJA 1BTZA 1O3CA 1D3DB 1LDTT 2F42A 1SGTA 2OWAA 4X1PU 1Q2WA 1IQGA 1MQ5A 1SLVB 3KYFA 4R0IA 2FYRA 2IJD1 1GG6C 2EA6A 2HNTE 2WSSD 1S83A 1V2OT 2O8LA 2XBWA 1A0LA 3LGTA 4INLA 2W5EA 1W0ZU 3N9NA 4TKPB 3LONA 2L43A 2FODA 1MKWK 6LPRA 5H1UA 3V0XA 1MKWH 4FJCA 1IQHA 4UI9B 1PPCE 2CSYA 5IK2D 4X2VA 1TX8A 2LPRA 3U8RH 2GT7A 3VGCB 1RJXB 3LDYA 3OEHD 1MZAA 4JYTA 3OAAD 5F53A 5EODA 4FVDA 2WV9A 1CHCA 1PPEE 2HLDD 2A2QH 3TH3H 1DSTA 1TIOA 2JDID 3PMJA 3PWBA 1FN6A 4AFSA 5C5NA 1WILA 3GY5A 4F49A 3ZZBA 2GCHF 2ZZUH 3RPGB 1YLDA 2FLBH 2YHNA 2ZFQH 1LPGB 1XX9A 1C1RA 1GPZA 2VIOA 3M5LA 1G36A 5SGAE 1FN8A 1QR3E 1LHEH 4YOIA 3FM8C 1BTPA 2ZHWH 1Z2QA 2GTBA 2XXLA 3PLKA 2G43A 1VCWA 3EDXB 5ETXA 2ZP0H 4K1SA 4HZHA 3ITIA 4NCYA 4ZXXH 4A1TA 2B0OE 4Y8YA 1BJUA 2ZPSA 4XDEA 5I46H 3T26A 4LOYH 4LZ4B 1ZPZA 1LPKB 1SFIA 1P05A 3R3GB 3EQ0H 1TRMA 4A0CD 3BG4C 4K1EA 1AKSB 1J17T 5FHTA 5E0JA 2Y1MA 3OTPA 1O3OA 1GBKA 2BY9X 5DP8A 3RXSA 5JB8S 1U6GB 4WZ2A 1HAXB 2YSJA 3RMMH 2R2WU 4J1YA 1SLUB 2FM2A 3P8NA 3C6WA 1P9UA 3A7XA 2G45A 1W7XH 1N1LA 1V2ST 1CT4E 1GJ8B 2FO9A 3EA7A 2UUKB 1N6YA 1YCPK 1Y5AT 1WQSA 2WV4A 4A7IB 2YVRA 3QLPH 1WU1A 2R3UA 1C5SA 2XC5A 4U2WA 2J4IA 1S6FA 4GCHF 3M3VA 4AFQA 2BY5X 2EC9H 1RTFB 3MNCA 1TQ0B 4UFFH 3SU1A 1ELCA 2VH6A 5E0GA 1GBIA 1T31A 2KWJA 3ZZDA 1N8OB 1DWBH 3PV5A 1ZTKA 1DOJA 2VPGA 3RU4E 4X8SH 1WSSH 1YWUA 5ESBA 1GHXH 3ZZ7A 1DFPA 3IG6B 4TY6A 4L7XA 4NN2A 4AYCA 1ESBA 3SN8A 1EQ9A 2Q6GA 1GMDF 3RXTA 2Y82A 4YOGA 1GHBF 1KDQA 1V2JT 5HIYA 1OOKB 4Q7ZA 1O2MA 1JM7B 4AC9A 1O3NA 3M7TA 2Z3EA 4HFPB 1DDJA 1BRBE 4F1PA 5JBAS 3MDBC 2HPQH 2QIQA 5FPTA 4BXSA 4IN1A 1WBGB 1HGTH 1O2OA 3P95A 2LGGA 1HJ9A 2ECGA 3NWUA 2J98A 1HJAB 5GNDA 2LGKA 1UVUH 1BJVA 2QYIA 1NFXA 1HLTH 3ZVGA 4ABJA 2AGIX 1LTOA 1KY9A 1O2VA 3ATWA 1C9TA 2G8TA 2EI8A 4AP4A 3UWJH 5F03A 4LK9A 1O2JA 1O5EH 1ETSH 2ZGJA 1YY3A 3RM2H 5C0UA 1VYXA 3TIUA 3ENSB 2VPDA 5EQSA 4I7YH 3TPIZ 3CS0A 3ZVFA 3E16B 3BTFE 1HAPH 2K1QA 3MO9A 1ANEA 1X4UA 1N8OC 2BLWA 1SSXA 3ZZ4A 1ELGA 2Q1JA 3A8AA 3IWMA 1O36A 1SKYE 1QHRB 3ASLA 4MTBA 1AKSA 5PTPA 3MI4A 2VWLA 4YBTA 2A5AA 5C67A 3GS9A 3L33A 1C2KA 1NFWA 1A5HA 1W12U 1Q31A 4QT8C 2C4FH 3ZVCA 4MPUA 9ESTA 1G2LA 1SQTA 2FYQA 4CRCA 3I77A 2KGIA 1SGNE 3ATIA 1O3EA 1O2QA 2FX6A 3UOPA 5I25A 4DIIH 2QC2A 4TWYA 2Z94A 3RPGC 4F52B 1BIOA 4INKA 4XSKU 3ZPV1 3NG2A 1AU8A 1NRNH 2V0BA 4Y7AA 1Z7KA 1VCQA 4TPYA 4DCDA 1GL1A 3S0NA 1O31A 2GP9B 1VITH 3EAJA 3PO1C 5LPRA 3A7WA 1LKAA 2A1DB 2AERH 1E37B 1QQ4A 2C8XB 2RI7A 1SHHB 2FOGA 1QL8A 1W7GH 3MYWA 4B86C 4Q80A 3S9AA 5KECA 3UNRA 1YC0A 3H7HA 3V43A 3O47A 1TNGA 3A84A 3UWIA 2L5UA 2FOMB 2KWNA 5G4BA 3N7EA 3LDXH 4CRGA 1SL3A 1EFRD 3RC6A 2JH0D 1HAGE 3L1XA 3KCGH 4B6EA 5GDSH 2M2AA 1MTNC 5LKTA 4V3KC 1JWTA 2G6QA 1JBUH 8GCHF 1ZR0A 5EG4A 2ZDLA 3M3SA 4IC2A 3FP6E 4AZ2B 1GMDG 3F9HA 4O3TA 3A8BA 2NAAA 2GMTB 4NG9H 3N7OA 2DJAA 4FK5A 4MPWA 2PW8H 2BX4A 3ZZ3A 2LV9A 4Q6FA 1Z8IB 2RSDA 4R7EA 1P2KA 1BRCE 1EXFA 3M5OA 1HB0B 2YURA 2JETB 1AQ7A 1FUJA 2NU3E 4IW4E 1TNKA 1W0KD 4CBNA 2LGVA 2K0QA 2KKYA 5B6LA 1FY8E 2XCNA 1LQDB 3E90B 3BTQE 3SV7A 5FX6A 2FOHA 2KAIB 3A89A 1MMJN 5TCAA 3VGCC 1AFEH 2GDDA 5HKKD 1J9CH 1YGCH 1W11U 2CXVA 2PKSC 2XBVA 4R8TB 1GVLA 5F8TA 1O2UA 3BIVH 1WEPA 3MNXA 2K8IA 3ZVBA 1DITH 2ZHQH 2J9NA 2W3IA 1QRZA 2WPJS 5C5OA 3UFAA 1FPCH 3PO1B 1GJ4H 2Y81A 1MH0A 3O8DA 1K2FA 3BSQA 2B0FA 3RTRB 4Y11E 2OQ5A 2KR4A 2QXHA 1BQYA 4A1XA 4I31A 1OSSA 2V3MA 3T28A 4L58A 3QUMP 3CP7A 3BIUH 1RFNA 1DLKB 5C2ZA 1C2JA 2GV7A 3MU8A 5DN6D 2GKVE 4FUHA 1TONA 2AIQA 4Z0RA 1TGTA 1CVWH 4RSPA 2H0DB 4WMFA 4X1NU 1O39A 1AI8H 1SI5H 2JKHA 3ATMA 1MM2A 1NRPH 1SGEE 1AY6H 1EP6A 1F2SE 4KGAA 4OS7A 1BMAA 1GBHA 1O0DH 3UREA 3ELAH 1DCQA 1AO5A 1K9OE 1ZBDB 2NWNA 4S3OB 3SOUA 3MU4A 1TB6H 1WDIA 2WPMS 3O8RA 1NM6A 1FY4A 1GI3A 4WH6A 1QBNA 2VU8E 1MTUA 1VKYA 2D8SA 2Z6BD 1WUNH 1UK4A 3SW2B 1QNJA 4MVTA 4D7GA 4BAOB 1J16A 3SOWA 4MPXA 3RXDA 3HCTA 3ZVZB 1ZLRA 1CBWB 2OQUA 2Y5GA 4BAHB 2J98B 1OXGA 2ZFPH 2JRJA 4SGBE 2ZC9H 3WW7A 3UR6A 4IBLH 2PWXA 3PMBB 3LU9B 3EGKH 2Z3CA 3A8CA 1AWFH 1XKAC 2VVCA 1J15A 1GBJA 4B7YC 2J38A 2Q6DA 1SB1H 4ISNA 4Q7XA 1FP0A 1JM7A 4FUIA 2FOAA 3EA8A 1Z60A 1GGDB 3SU3A 4AUQB 1MU6B 1L1JA 4J2YB 4ZMAH 5J4SA 3QZQA 4VGCC 3MQKC 1TRNA 3FP7E 2Y43A 2NU1E 1ZHMA 2Y5HA 2G5VA 1BDAA 4CBOA 2ZU4A 3O33A 3SV6A 2BDIA 1GHAG 3RP2A 3PYHA 4ZKSU 1QB6A 3LGUA 4FUEA 2W7SA 1EASA 4H6TA 2KR7A 1AZZA 1K1JA 2W26A 1AVXA 4ABFA 3N9MA 4LADB 1BRAA 5H9MA 1FLEE 4YM9A 4FETA 2XWBI 1WXRA 3WWBA 2MT5A 1DT2A 1YLNA 2P8OC 5T1VA 1O2LA 1UTKA 1C1SA 1ZTJA 1OWJA 8GCHG 2DE8A 1AVWA 3DSPA 1BTXA 2UUYA 4A5TS 1H8DH 1CA0C 1ID5H 1K1MA 2J2UA 1AGJA 2VJ1A 1SGRE 1QRWA 5EXNA 3ESTA 2FP7B 3L3TA 1QJ6B 1UTMA 1OPHB 4E7NA 1H4WA 2J97A 1TX6A 2BVSH 1HNEE 3PURA 2FFWA 1P12E 1DVPA 1TA2A 2KM0A 4XI1A 3QGJA 1WENA 1ELBA 3N99A 1GHYH 2L80A 2PUYA 1NU7B 4A1VA 2GVFA 2QJ0A 1ZYOA 2SGEE 2WINI 1C5QA 1HYLA 1VITG 4F4OC 2YHOA 4FXGH 1O3DA 2KFTA 1CU1A 4IS5A 3U28C 5TBNA 4GLYA 1BOQA 2BOKA 1WEOA 2ZGXH 3SBKA 4GHQA 2XBYA 1WV7H 1BMLA 5A0CA 5EW1H 2EQNA 5LKZA 3KNVA 1AUTC 2KAIA 2GX4A 1DY9A 3A7TA 2O8UA 3UNSA 3CS7A 4ZHAA 3E0NB 4ACAA 4CR5A 2PGBB 2PKAA 4GNGA 2H6MA 4GNFA 3RXRA 3ZV8A 1RMDA 2AEIH 1AB9B 4X6PA 1OWHA 4RT1A 4GNDA 3T27A 2OXQC 1SBWA 3D62A 1C9PA 3V7TA 1UK3A 5FBIA 1PPGE 1C5OH 3BTDE 2J94A 4Y79A 1TNJA 1GL0E 3SUGA 4DOQA 3DSOA 1WESA 4YATA 1D3QB 4NFFA 3AASA 3C27B 2VJEA 3SJ9A 1SPJA 3GY2A 2A45B 1V2PT 5C1UA 3O8BA 3SI3H 1HYJA 1JMOH 5J3XA 4CHAB 4MNWA 1SOTA 2LAUA 4DG4A 1GBLA 2SGPE 1ACBE 1UTOA 1RIWB 1Y59T 1C1UH 2XC0A 5EPYA 1ZPCA 2F9PA 1QY6A 1TBZH 3DCLA 3RMNH 4A4CA 1C5WB 1F5RA 3BEUA 1SGYE 4D76A 4MNVA 3KEEA 2AGGX 2HWLB 1C5XB 4NFEA 3ATKA 3T62A 1XWHA 1P3CA 1GJBB 2CRRA 4A6LA 1F0UA 3L11A 4P02A 5KGOA 4K60A 4BXWA 3TLOA 4TWWA 1O3GA 2HOBA 5CHAC 1NT1A 4YABA 2V6NA 1ZSKA 3F2FA 3M7UA 5EU8A 1EPTB 1T7CA 1HAIH 2FTLE 2R2MB 3GCNA 1FAXA 4ABEA 1UHBA 5E2OA 1Z6EA 2JH6D 4FO9A 1WIMA 1P9SA 5BRRE 2HPPH 1MQ6A 2A5IA 1C5NH 1OS8A 5I3LA 2C2LA 3U8TH 2WV5A 2BD9A 3AVZA 3GYLB 1ETRH 1N6XA 1AHTH 2QAAA 2B8OH 4INHA 5D1LB 1S84A 4WMEA 1HXFH 2BB4A 3MH6A 5C13A 1MKXH 1IQIA 4WVPE 3HATH 3TJUA 5EQQA 2AS9A 2XP0A 5T6GA 3A7YA 1O5DH 4I8JA 4DT4A 1MAXA 1M9UA 3BN9A 2D2DA 1TOCB 1JOCA 2C90B 5HGGA 3SUEA 1X4JA 4ZKOU 3MHHA 1Q3XA 3SNBA 5FL7D 1TMUH 1CO7E 3MU0A 2E6SA 5L2YH 1NO9H 2PKSB 5C17A 1OWIA 4FU9A 4B1TA 2AH4X 5H1TA 4I32A 4YZUA 1PYTD 3VPKA 2KREA 3U5MA 1TA6A 3TH4H 3LVRE 4UONA 4MSXA 1ELFA 4TT3D 4ZAEA 2D8WA 4Y8ZA 2ILNA 1BTWA 2CF9H 1O2PA 1ANBA 3OE7D 2D26C 2KKXA 1FX0B 1MTSA 2BXUH 2RA3A 4ABDA 2RG3A 4NWLA 3M63A 1A7SA 1Z8JB 1VFYA 3NRLA 2ZHEH 2JJ2D 3KYGA 3EA9A 4YXWD 3SYJA 1TPOA 2VIQA 2Z7FE 1W14U 2W7UA 3RLWH 2QV1A 3ZVAA 2HDPA 2SGDE 2HNTF 1D3TB 2PUQH 3U98H 3SQHE 3B8JA 4XBDA 2H9HA 2PP6A 1YPMH 1HAOH 1LHFH 2ANWA 2SFAA 1GBTA 1Y3YA 4GB0A 1F7ZA 2CT2A 3PM3A 3QX5H 4ZHMU 3MH5A 2I6QA 1X4IA 3U5PA 2OP9A 2BD8A 1ANDA 2KCOA 3U9AH 1GBCA 4DVAU 3KHVA 1EAWA 1S85A 4JK5A 3K2UA 1O3HA 4UP0A 1QBVH 2UWLA 3LH1A 3SHCH 1GJ9B 2WYGA 1RRKA 1AB9C 1TWXB 1HFDA 4MG3A 4YADA 3F3BA 2ZI2H 3JZ2B 1MCVA 2BXTH 1XVMA 5AVDA 1DSUA 1GJ6A 4B73A 3URDA 1LO6A 2TGTA 5EJ1A 3IHPA 3FOAA 2Z9LA 3HPTB 3BTME 4DGJA 1H9LB 3F68H 3NKKA 4Y8XA 1OYQA 3F0PA 3AW1A 4VGCB 1EATA 1AZ8A 3UOUA 2XOYA 3PRDA 3E1XB 4JZDH 1ZGVA 3LQHA 2ECIA 1MBQA 1KXDA 3BTKE 4B71A 3PLWA 3TGIE 5CHAB 3Q76A 2SNWA 2JMJA 1C2FA 4OGXA 4GVUA 2HVYB 3M5MA 1GI6A 4WZ0A 2A4OA 3PTNA 2OC0A 2KE1A 3O7AA 1G3CA 1WAYB 1GBMA 1Y3UA 2ZF0H 4I7DA 2E61A 4O62A 3LQIA 1CBWC 4MPVA 1XMNB 3BTHE 2PV9B 4DT7B 1PPZA 2VBCA 3ODFA 1ELTA 4Y10E 2ECJA 1T1HA 2D8UA 2ZTYA 1OKXA 2O9QA 1T32A 4AGJA 5TCCA 2BTCE 1ELAA 2V3HH 4I8KA 3SORA 2F9NA 3P8GA 1PQ5A 1F92A 2EY4C 3VFEA 5FB1A 1C2IA 1FBVA 1HAVB 1GHAF 2OXSA 1K0HA 1P03A 2FS8A 2XEUA 2QXIA 1B0EA 2C3SA 1O5GH 3GY3A 3DHKH 1P2JA 3UB0A 1YPJH 2L75A 3TK5A 4GCHG 2HYED 2ZDVH 3BEIB 1YCPH 3T7LA 2OLGA 1WOFA 1HAHH 2RDLA 5LCWB 2EGMA 2OBQA 2KWKA 1BCUH 2V3OH 3LT3A 3DSGA 4JZIA 1P11E 1B0FA 3DA9B 3EE7A 3M7QA 3UNQA 2JMIA 3RU4D 5EW2H 3PUQA 1DXPA 3LC3A 1PQAA 2F91A 3K65B 1WEQA 5C0TA 5TDRA 2BZ6H 3ZNIA 2FUUA 1IQEA 1YKTA 2AIPA 2G00A 3SNDA 1C5YB 1CSOE 1D4PB 1YLCA 5KEDA 2GD4B 2YU4A 1Y5BT 2VJEB 3O37A 3LIWA 1G25A 3OFND 4HI3A 5G04B 3SUBA 4HGCA 2QGRA 3FEHA 3FL2A 4Y76A 1V3XA 2WPKS 1C2MA 5CHBA 5FBEA 2ZDKA 4GSOA 2BD7A 1ELVA 3N9LA 3LGYA 1L1NA 1W10U 3FANA 2ANMH 2PTCE 1IQNA 4ISOA 4K5ZA 3P8FA 3LJJA 2UWOA 1XUIA 3GCTG 4KTSA 4WMDA 4ISIH 2PKAB 2TBSA 1FJSA 3MU1A 1P57B 5A2MH 1UK2A 5TRBA 3HKJB 3BTEE 3Q3XA 5D1MB 3F6UH 1BA8B 2ZA5A 5J4QA 1QA7A 4Z0KA 2SNVA 5E0HA 2ANYA 3KIDU 2OBOA 2VWOA 2VPBA 1NC6A 2NU2E 8KME2 4YO9A 5EXMA 3FAOA 3N7DA 2AN6A 3PMAB 1P0SH 5LH8A 1OHHD 5C1YA 4UDWH 4NIWA 3ZZ9A 1V2KT 1L4DA 1EX3A 1T4UH 3A80A 1QGFA 1H1BA 4JYUH 5C1XA 5EYAF 3QZRA 1N87A 7LPRA 3GISB 4WH8A 1T8MA 1G3DA 1KLTA 3T9KA 5FX5A 1ARCA 3M37A 3A85A 1C5RA 1D6RA 2F43B 5DP4A 4AOQA 2H9TH 1RS0A 3O35A 1CHOG 1A61H 2K4DA 2YREA 1YF4A 2STAE 2CSZA 1O2TA 2F4LA 1AUJA 4D7FA 2W3KA 4PROA 3FZDA 2QICA 1G30B 2IJOB 1AFQB 2GDEH 1SGFG 3OY5U 1WEVA 3GCHC 1ELDE 2DE9A 3PLBA 4N3WA 1P3EA 1C1QA 1BMFD 3SV8A 4RT0A 1QFKH 3Q00A 1GMCG 3E91A 3MU5A 3UTUH 4UD9H 3ZPVE 1A46H 1BORA 1TFXA 1C5PA 3SQEE 3DD2H 1UCYK 2BMGB 1CGHA 2CHAC 3C1KA 3H7OA 5KH9A 1FY5A 4ABBA 4CH2B 2VJFB 3MFJA 3UAIC 2WZQA 2P94A 1GWAA 2OUAA 4NZLA 1TBQH 3SUDA 5EPNA 3DQVR 2ZG0H 3RXJA 5EGMA 2KGGA 1GI7B 2FOCA 1GJCB 1CA8B 4OGEA 2CV3A 2K1JA 4NIYA 2QA9E 1JRTA 1TNHA 2VIVA 2ZCKP 3P8OA 5F8XA 4O03A 2C8WB 5T6DA 3QGNB 3GL6A 1IYMA 2GCHG 4THNH 3HCSA 3NZIA 1LVYA 4X1SU 1DUAA 2EXUA 1UTLM 1OWDA 1O5BB 1FV9A 4GAWA 3UQVA 3SJOA 3S9CA 2CKLA 1ELEE 4ISLA 5FEYA 1AMHA 5JG6A 2FOEA 2CMYA 2ZGCA 1EUFA 2OC1A 3SNEA 2QN5T 5BPEA 1P2OA 1MU8B 3RXVA 3H5CB 3OY6U 4D9QA 5GWZA 2JIZD 3A8DA 2BVRH 3SU6A 3NPSA 4X1RU 1BTHH 6ESTA 1A5GH 1X7AC 1AIXH 5ESTE 5FCRA 5K7RA 4QF3A 1E4UA 4WJG2 1WFKA 3CENA 1P06A 1A5IA 1GI0A 1LDJB 1OP8A 1O2GH 2KZ4A 2OC8A 2CKLB 3T29A 3JUEA 1O2NA 3SZEA 2ULLA 4BTTB 1DM4B 2F3CE 1O3MA 4KKDA 5JBBS 2WPIS 1C1OA 1O2IA 2QF0A 1Z1IA 3HGNA 5GIBA 2XRCA 1UTQA 3E8LA 1CHOF 2QE7D 3LKWA 2KU3A 3A7ZA 1K21H 2FMJA 4MQAA 1SR5C 1C4Y2 4DY7B 1P09A 2ZFRH 1HPGA 4B74A 5A8YA 8LPRA 4AYCB 4TYDA 1UVTH 2A32A 2H5CA 2HVXA 3DFJA 3TVJB 1NPMA 2DUCA 4TY7A 5C20A 2FD4A 1EB2A 2BAYA 1ZPBA 3NXPA 1Z8GA 4XE4A 2FSAA 5K3QA 4I8LA 1ZJKA 4WWYA 2OK5A 1SGIB 2FLRH 3TNSA 5GXPA 2CGAA 2IDAA 2EEKA 3SNCA 1JXPA 3L1ZB 1C2LA 3MH4A 1E0FD 3I78A 1THSH 3H09A 2LP6A 2P3FH 2PTNA 3LGVA 1DE7H 2L6OA 1WEWA 2P57A 1G3BA 3DWDA 1L2EA 2I6SA 3I29A 1JIMA 3M5NA 1HYIA 3ZVDA 1QA0A 1NBME 4UFDH 1KXCA 4CRBA 1BTUA 4O9VA 2ZDAH 3GCTF 1G3EA 3U5NA 3GICB 2HRVA 2BLQA 3A82A 3RXHA 4AFZA 1V6DA 2ZQ1A 1DXWA 4H4FA 3QZVA 1TBRH 1YP9A 1O34A 1HJAC 3IITA 1FXYA 3K9XB 3GOVB 1Z6UA 4AG1A 1O3PB 4LJNA 5AFZH 3SU5A 5SVXA 1YPHE 2ZTZA 4UP5A 5DJ7A 1LMWB 4CRFA 3SV9A 2YNAA 4Y7BA 4YESB 3SU2A 1TGCA 1WTGH 3KQEA 1NFUA 1SMFE 2AGEX 1Y8TA 2TRMA 1K1OA 2A4QA 3MNSA 4BAQB 3S9BA 4WZ3B 3F1SB 1O37A 1FY3A 2F9VA 3BTWE 2GCTB 2MIQA 3BG8A 4ASHA 4Y6DA 3RXQA 3SNAA 1ZGIA 2VB0A 3RXOA 3ZYDA 1PYTC 5EXLA 2MD7B 1SOZA 4M9FA 2VNFA 1EAIA 2KFWA 2W6JD 2BDAA 4B2CA 1RTLA 1UTJA 1C5VA 1EOLA 1UVSH 1K2I1 1TQ7B 4R2YA 4CR9A 2ZPRA 4Z1MD 3D23A 3L6PA 3RDZA 4JZEH 1QZ8A 3T25A 2PSYA 4OM9A 3FFGA 2Y7XA 3W1EA 1QTFA 4ZROA 2JM3A 1P2MA 3TJNA 1D6WA 3W94A 1UMAH 2J5UA 2AMQA 2GJGA 2CK3D 4KTUA 4AYVB 1C5LH 1LHDH 2VGCB 4MDSA 4KTCA 4I8HA 2F9UA 3AW0A 4BTIB 4Q4LA 1WEMA 2VIWA 1O5AB 1ZOMA 4I33A 3ZZ6A 1LKBA 2XOCA 1GJDB 5DP5A 2O8WA 3V3MA 3FKSD 4FOUC 3O36A 1IQMA 3RXKA 1V2WT 2ZQ2A 1EAUA 1ARBA 4TSFD 1O38A 1KDQB 1NS3A 1QB9A 1HAVA 4FIPA 1LHGH 1GBEA 2FZZA 1HIAB 1C5TA 1MTWA 1O2KA 3ZZ8A 1SLXB 2L7PA 3LQJA 3UQOA 1KLIH 5L2ZH 4X6MA 4ZHLU 3BG4B 1RD3B 1UCYE 3M99A 1GHZA 5DP9A 5AFYH 1INCA 3HK3B 5EJZA 2JJ1D 4KP0A 3SGAE 4K3JA 4NA8A 2YW8A 3T6RA 1BBRE 1H8IH 5IDKA 2CSVA 1RIWC 2YSMA 3V12A 4CCGX 5KH7A 1TALA 1QQUA 5HM2A 2PUXB 2EODA 3GCOA 5A09A 4CREA 3D49H 2J95A 2WPLS 4OS1A 1PQ8A 5L6NH 3EB5A 1PQ7A 2ZDNA 2LNCA 4FU8A 4V3LC 1P2NA 1HAZB 2R0KA 3LGIA 1TMTH 4ESTE 1ZMNA 1SVPA 2GT8A 3BTGE 1AE5A 2ALVA 1UW7A 5A8ZA 1KXBA 2IN2A 2J34A 1DPOA 1EJMA 2J92A 3KN2A 5SVIB 2VINA 6CHAC 1Z6JH 3ODDA 4RN6A 4CRDA 1W0YH 1TRYA 4IGDA 1C1NA 1O3JA 1EZUC 1VJ9U 2KYUA 2OCVB 1E38B 2P59A 4QQ4A 2PSXA 3RXMA 1GJAB 2FI3E 2XTTB 2HGTH 5DP7A 2KIZA 3MO3A 2F83A 2KCYA 1EAXA 1QB1A 2ZEBA 3S7KB 1WE9A 3SHBA 1ESTA 1ZMLA 2G51A 4Y71A 1Y5UT 1GMCF 2L0BA 2K16A 3KV5A 3PRBA 2JH5D 1DX5M 1V2LT 1DANH 1KTTB 1MBMA 2TGPZ 2CONA 2YNBA 4YBSA 1LCYA 2ODPA 5G05B 2PNXA 1TPSA 2G5NA 1RGQA 5DKMA 4MVNA 2WUBA 5B6OA 2BHGA 4BBQA 1GCTC 1TPAE 1YM0A 5JPMH 1ZMJA 5T3HA 1F5LA 3HK6B 2XNIA 5DK1A 2H9EH 4NIXA 4AVXA 2SGQE 3NCLA 2ZFSA 3DFLA 1IAUA 4I86A 1FDPA 1ZRKA 1EKBB 1L1GA 4W4UA 5JBCS 2M13A 4U32A 1E1QD 2XB1A 2EI7A 1B5GH 1T4VH 4X0WU 4X6OA 4MNXA 2TPIZ 4FUBA 3LJUX 2ZDMA 4ACBA 3U69H 3EB6A 3AAVA 3R0FA 1GMHF 2AHME 4FUGA 4JCNA 5D1KB 1KYNA 3TGKE 3TH2H 1ETTH 2XOZA 2YYRA 3I2DA 4UEHH 3S69A 1LDKC 2A4GA 2ZO3H 3QDZB 5JB9S 4BOHA 3BEFB 3S7HB 5AITA 3GDSA 3BTTE 1ABJH 1D9IA 1F0SA 4FUJA 4WY3A 3UPEA 3P17H 1S81A 4DJZB 1BRUP 5DINA 4NSVA 2LXPC 2Z9GA 2VVVA 1C1MA 3TK9A 2AYWA 2K17A 1NRRH 4BTUB 3SJIA 3GDUA 3PWCA 4ZKRU 4YC9A 3OYPA 1IQKA 2KCAA 1KTSB 1FI8A 2XOKD 5DPAA 3RC5A 3ZZAA 5FCKA 3ZZCA 3TGJE 1Y3XA 2P3UB 2STBE 3RXEA 4AG2A 3E0PB 1WGMA 4GUXA 4H9DA 2FDAA 1GVKB 3KNXA 3OSYA 5E8EH 4AFUA 1O2XA 2GMTC 3RM0H 4UFGH 4ABGA 2G4TA 2H1UA 1XVOA 1YYY1 5EIYA 2YQMA 5B77A 1BITA 1HIAA 2JETC 3QO6A 2Z9JA 4P5OB 2ZPQA 3NUMA 4O3UA 1EPTA 1FMGA 2H2ZA 4DW2U 2ZETC 3SHAH 3EYDA 5F8ZA 4X8VH 2BM2A 2XWAA 4YLUA 1TLDA 5FERA 2Z9KA 4YT6H 1LQEA 2CHAB 1ZTLA 1EP5A 1B7XB 1V2RT 3KQBA 3KL6A 1SGPE 1KSNA 5CDFE 4A49A 2B7DH 1YCPM 2TGAA 2BD2A 1VD4A 1GI4A 3M36A 5LKUA 1ZHRA 1SFQB 3PV4A 4IC6A 3KV6A 3O70A 2ZHFH 1BBRK 1C2DA 2MNYA 2ZFTA 4H6SB 3E2DA 1O5FH 1AD8H 1IQLA 1HBTH 4NA9H 2VPEA 1VITF 1HAYB 3RXBA 3M35A 1SHYA 4X1QU 5C94A 1HDTH 1YBWA 4XFQA 2DSMA 3SZNA 1C1TA 4P00A 1VR1H 2VP7A 4ABAA 2LXHC 2ZCLP 3F2HA 3RXCA 5AF9H 4FVBA 5HXFA 1AWHB 2ZGHA 4GPGA 1GMHG 2LELA 1OYTH 1DVAH 3VB4A 1XXDA 3A83A 1LPZB 3A88A 4XOJA 1MD7A 4FUDA 4JK6A 1DWEH 2GZ7A 4ZUXU 3N9OA 1AN1E 3A86A 4SGAE 4B2BA 1TE0A 1WYKA 2WPDD 4ISHH 1YPGH 2FOFA 4U01A 3K6ZA 1GG6B 2GZ8A 2ESTE 2BD3A 3SGBE 3BV9B 3Q77A 5H1VA 4E7RG 1P04A 3MHSA 2ASUB 2YMSD 5DP6A 2UUJB 2THFB 2H5DA 4Q2KA 1NN6A 1S6LA 2WUCA 4K69A 1AFQC 1ZSJA 2YUCA 1KXAA 4OS5A 1GCTB 4A92A 3FZZA 2UZGA 4X2XA 1EZXC 3LH3A 2XYAA 3RXLA 4RKOB 2YQLA 1T8LA 4C9ZA 4LLBA 5DP3A 4B75A 1T8NA 2VNTA 2HALA 3QK1A 1F5KU 5GJ4B 1GI8B 1P2QA 1H9IE 3B9FH 1E34B 3FO8D 5DG6A 3SV2H 2M3HA 7GCHG 3PHDA 2ODQA 5EOKA 1OWKA 2Q6FA 2G4UA 2FTMA 1EZQA 3LJOA 2ODYB 2FESH 2XC4A 3KF2A 3FVFB 1CGJE 1V2VT 1UTNA 1A3EH 3Q3KA 1V2QT 1VZQH 2BD4A 1PPBH 3TK6A 2TIOA 2D1JA 5EJLA 2IPQX 3ZIAD 3A87A 1ORFA 1XUGA 3M62A 3DDTA 3OX7U 3QTOH 4X8UH 1TAWA 1ZSLA 5B78A 4B2AA 1YPKH 1KXFA 2BY7X 2YOLA 5DGJA 2QXGA 3O34A 2FIRH 2CF8H 3LPRA 3O8CA 4JMYA 4GHTA 1S5SA 3NK8A 4CRAA 5JYIA 1FONA 1GHVH 1O35A 1MUEB 4I8GA 2EGPA 3SI4H 1A0JA 1YPHC 5CE1A 1HV7A 2XCFA 2OTVA 3K6YA 1OX1A 2MA6A 4ASUD 1FQ3A 1A2CH 3LOXA 1EB1H 3MOCA 1LVMA 2B9LA 1LVOA 1RXPA 3SUFA 3E3TA 2MD8C 2M6MA 5T6FA 1PFXC 1GI5A 1C4U2 2AMDA 2BQWB 1SLWB 5JDUB 1MCTA 2VGCC 4JYVH 1GBDA 3SO3A 1GCDA 3UY9A 4PPEA 1QL7A 1Z71A 4OGYA 2EA3A 1BZXE 3EE0B 4NZQA 2RCEA 1FAKH 3OU0A 5H4IB 1C4V2 1O30A 2R0LA 1XXFA 5FB0A 1QIXB 1GDQA 2F6JA 2Y6TA 1CE5A 2VWMA 5AHGH 5SVIA 5TDWA 3F9FA 1OWEA 3T2NA 1H8HD 3KQIA 1CHGA 4OS6A 1UVPA 2SGAA 5A0AE 1BB0B 1KLJH 3M3TA 1YPLH 3VB6A 1XUJA 5C11A 4IC5A 1S0QA 2KCPA 2O8MA 1CT2E 4ZDTA 3PV2A 1G2MA 3ZV9A 1TGSZ 1GDUA 3STJA 1A1RA 4AYYB 1CT0E 3MTYA 4KELA 2G81E 2ZTXA 1PJPA 3FP8E 4YBMA 2GV6A 3ZYEA 1GJ7B 3MNBA 4NWKA 4WF8A 1BUIA 2PGQB 3GV4A 1O2WA 1S6HA 3HKIB 2Z9IA 3ZVYA 4NIVA 2P3TB 7ESTE 1HRTH 1XKBC 4WXVA 3KDEC 2A0QB 1CQQA 2H0DA 1JOUB 1NU9A 3U8OH 1QCPA 4Y0ZE 2CRWA 3ZYQA 3ZVEA 2C8ZB 4Z6AH 2P95A 4GNEA 1K22H 1VGCC 4LXBH 1GHBG 2A31A 1NESE 3KQDA 3OTJE 1KMHB 4X6NA 3URCA 1ZJDA 3A7VA 3TNTA 2Z3DA 2O8TA 1OP0A 1DWCH 3PB1E 3BF6H 1F0TA 1E79D 1O3IA 2MKEA 1Y3WA 5FPYA 1WTHD 3TJVA 1SC8U 2LDRA 4IC3A 3UIRA 1TABE 2VJFA 3RXFA 3UR9A 3RXIA 1SGFA 1W8BH 2C2VS 1XUKA 2KX4A 3WWFA 2RA0A 1MM3A 2BX3A 2ZU3A 4AORA 3MHWU 1EOJA 4BAMB 1U6QA 7KMEH 9LPRA 1QJ7B 1QRXA 1NFYA 1PPFE 2ZU5A 2B5TB 3RC4A 4Q7YA 3PLPA 3LGWA 1EZSC 2OD3B 1DICA 3Q1DA 1K1PA 2QCYA 4K8BA 1MAYA 1NRQH 4FUFA 1OP2A 3LRQA 2IOTA 3P70B 2FUIA 1ESAA 1GHWH 1QJ1B 1TNIA 4NA7A 4UFEH 2Y1NA 1HUTH 1WEUA 2R3YA 2ECTA 1C1PA 1GBBA 1MD8A 2QXJA 1O2HA 4F48B 3MMGA 2PHBA 4HG6A 2XW9A 1RTKA 4XBBA 2ZFFH 1J14A 1JIRA 1BHXB 3RLYH 3OEED 2GZ9A 1S0RA 4CHAC 4I7BA 4RI0A 3SGQE 4D8NA 2BDBA 3WY8A 2QY0B 2VIDA 1FIWA 2ZKSA 3Q3YA 4AGKA 1DWDH 3ATLA 3RUOA 4ZCNA 4PTBA 1E35B 5B75A 1KIGH 1T8OA 1F0RA 2C93B 2FOBA 3HTKC 1NROH 1MTVA 1A3BH 1TGBA 1O2ZA 2RFKC 5G0FA 5DKAA 1XUHA 2FEQH 1VCPA 2M85A 4ZUHA 4UE7H 4JZFH 2MNZA 3KQ5A 3VB5A 3SOSA 3FJUB 5EQRA 1QL9A 2VIPA 1AE8H 2FXRA 1UVOA 1SQRA 3F2GA 4RKJB 1NY22 2LRIC 2DX8A 2JMDA 2HNTC 2BQ6B 2ZWLH 3RXUA 1K1LA 4ZXYH 5CMXH 2KWOA 2ZHDA 1QBOA 1THPB 5ABWA 1XUFA 3STIA 3W95A 3RMOH 3P92A 5FPSA 3V13A 3LVQE 5DSFA 1MKXK 1O2RA 1LHCH 3KGPA 4Z0OA 3HCUA 2NU4E 4AN7A 1F62A 1JRSA 3DT0H 1BMMH 1THRH 2BLVA 5IYTA 5F6MA 1UHBB 4K1TA 2HLCA 3ZZ5A 2A5KA 1ANCA 2G52A 2ECVA 1IHSH 3DUXH 1GI1A 4BAKB 3QN7A 5DO4H 1SGDE 1FNIA 1V2TT 1NTPA 3PMHB 1TOMH 1ZHPA 2RDEA 3U5OA 1UO6A 1EJAA 2VVUA 1WQVH 3QWCH 2QF3A 1P10A 1SQAA 1W0JD 3M61U 2FI5E 1GJ5H 2BY8X 2PR3A 5B76A 1S82A 1PPHE 5LPFA 5B8DA 1BBRH 3PROA 1L4ZA 2VWNA 1C2GA 2VH0A 4R8PK 2WHXA 4BANB 4F55A 1C2HA 3M7KA 3F9GA 5K0HA 1DS2E 1C5MD 2F9OA 1EPTC 4BNRA 2FS9A 3RXGA 1YPEH 4E05H 2IPHA 1SQOA 4DURA 2M1RA 4YLQH 6CHAB 4N4FA 4XBCA 3C5KA 3MO6A 4M7GA 1C5ZB 2FWWA 5LGOA 3TITA 3N9PA 4LKAA 1L0ZA 1W3CA 1IHTH 4B76A 1GDNA 3AK5A 1LVBA 1GI2A 4CH8B 2OC7A 3GY4A 3DPLR 2C8YB 1BTYA 2BLOA 2LN0A 3VK6A 2WPHS 3F9EA 1HXEH 2AMPA 2L74A 2WYJA 3GDVA 4ZQLA 1HJ8A 4DIHH 4OS2A 3MH7A 1MABB 2ECWA 1O33A 2F9BH 2PLXA 1IQJA 3MWIU 3HGPA 4HTCH 5TABA 4U30A 3RXPA 4IMZA 1BMNH 2ZU1A 2IQJA 2BOHB 2BDHA 2PFEA 2Y7ZA 3E6PH 3RXAA 3VXEH 4IN2A 1C1WH 4NSYA 3SU0A 4ABIA 1FZZA 2BQ7B 1Y3VA 4YAXA 3JZ1B 5E2PA 7GCHF 2A7HA 3U1IB 2BVXH 4FUCA 2GGVB 1W13U 1E1RD 1TMBH 1TX7A 2W6ID 2P8OB 1A0HB 6GCHG 5HMAA 4AB9A 2UWPA 5A8XA 1IQFA 1DLEA 1O3AA 1GI9B 1Z8RA 3B23B 1P2IA 1TPPA 2NU0E 1H9HE 5SVYA 1DUEA 2MUMA 2JUNA 3UUZA 2ZNKH 3AAUA 4E06H 1SGCA 1O3FA 4H42U 4O97A 1BHXF 1MZDA 1G37A 1VGCB 1V87A 4ZH8A 2R9PA 3GY7A 1KXEA 2QIZA 3RU4T 3GCHB 4K2YA 4X3GA 4OS4A 3QTVH 1XM1A 2FI4E 4MLFB 1CA0B 1NZQH 1UJ1A 4WXIA 1C2EA 1TGNA 4WA6A 4B6FA 3G01A 4S3OC 1D3PB 4X2YA 2P93A 4Y0YE 3ZTGA 1NBMD 2ZU2A 1UTPA 2ALPA 2UUFB 1O32A 4QF2A 1V2UT 1SGQE 2ZIQH 2ANKH 1FIZA 1BT7A 2A7CA 2BD5A 4AX9H 1COWD 3LC5A 3D65E 3SJ8A 2A4RA 1E36B 2A7JA 1GVZA 1K1IA 2Y5FA 1TYNA 1W2KH 2QF4A 1SG8B 5GCHG 1O3LA 1WCZA 1FPHH 2FPZA 1V2MT 1IOEA 2CJIA 5FXLA 2EI6A 3GY6A 2BZAA 2A2XH 4ABHA 5GPIB 4AB8A 5JBTA 1MTNB 4IMQA 2LQ6A 2XNDD 3SU4A 1GGDC 2ZECA 5TJXA 5AIUA 2BDGA 1G9IE 2ECNA 4X2WA 5L30H 4JZ1A 4MNYA 3U1JB 2F6NA 2BDCA 2YMSC 1P8VC 1NRSH 4CA1A 1VJAU 2G55A 2YMSB 4LK4A 4D9RA 2Y80A 2MA5A 1K28D 1ABIH 2V7QD 5HIZA 4ZKNU 1V2NT 3H7TA 2OINA 1K1NA 1J8AA 5HM9A 1C5UA 1A4WH 1GBAA 3VB7A 2LGLA 4Q63A 2BY6X 3GYMA 2SGFE 5C3NA 4K8YA 1Z1JA 4OGCA 1H8ED
chains in the Genus database with same CATH topology
1O3BA 3P6ZB 3VEQB 4YT7H 2AFQB 1FY1A 1GBFA 3KQCA 3SJKA 1P01A 1ZZZA 1G32B 3VB3A 4YTAA 2M5TA 1O3KA 5GCHF 3GY8A 2ZGBH 1AVGH 4FU7A 1P02A 3PTBA 5HYOA 1CGIE 2BDYA 4X8TH 1TNLA 5LPEA 8ESTE 2P16A 3A81A 1EJNA 1O5CB 3VXFH 4LZ1H 2BYAX 2ZCHP 1O2YA 1QURH 1UCYH 1O2SA 1HCGA 4TPIZ 3T5FH 1DY8A 2GCTC 3TU7H 2TGDA 5FAHA 6GCHF 2XBXA 3RMLH 5A0BA 4NGAH 1C1VH 2FX4A 2CN0H 3TJOA 2V35A 1ZRBA 4YOJA 1BTZA 1O3CA 1D3DB 1LDTT 1SGTA 4X1PU 1Q2WA 1IQGA 1MQ5A 1SLVB 4R0IA 2FYRA 1GG6C 2HNTE 1S83A 1V2OT 2O8LA 2XBWA 1A0LA 3LGTA 4INLA 2W5EA 1W0ZU 3LONA 2FODA 1MKWK 6LPRA 3V0XA 1MKWH 1IQHA 1PPCE 4X2VA 1TX8A 2LPRA 3U8RH 2GT7A 3VGCB 1RJXB 1MZAA 4JYTA 5EODA 4FVDA 1PPEE 2A2QH 3TH3H 1DSTA 1TIOA 3PMJA 3PWBA 4AFSA 1FN6A 5C5NA 3GY5A 4F49A 3ZZBA 2GCHF 2ZZUH 1YLDA 2FLBH 2ZFQH 1LPGB 1XX9A 1C1RA 1GPZA 2VIOA 3M5LA 1G36A 5SGAE 1FN8A 1QR3E 1LHEH 4YOIA 1BTPA 2ZHWH 2GTBA 2XXLA 3PLKA 1VCWA 3EDXB 5ETXA 2ZP0H 4K1SA 4HZHA 3ITIA 4NCYA 4ZXXH 4A1TA 4Y8YA 1BJUA 2ZPSA 4XDEA 5I46H 3T26A 4LOYH 4LZ4B 1ZPZA 1LPKB 1SFIA 1P05A 3R3GB 3EQ0H 1TRMA 3BG4C 4K1EA 1AKSB 1J17T 5FHTA 5E0JA 1O3OA 1GBKA 2BY9X 5DP8A 3RXSA 5JB8S 1HAXB 3RMMH 2R2WU 4J1YA 1SLUB 2FM2A 3P8NA 1P9UA 3A7XA 1W7XH 1N1LA 1V2ST 1CT4E 1GJ8B 2FO9A 3EA7A 2UUKB 1N6YA 1YCPK 1Y5AT 1WQSA 2WV4A 4A7IB 3QLPH 1WU1A 2R3UA 1C5SA 2XC5A 4U2WA 2J4IA 1S6FA 4GCHF 3M3VA 4AFQA 2BY5X 2EC9H 1RTFB 3MNCA 1TQ0B 4UFFH 3SU1A 1ELCA 2VH6A 5E0GA 1GBIA 1T31A 3ZZDA 1N8OB 1DWBH 1ZTKA 1DOJA 3RU4E 4X8SH 1WSSH 5ESBA 3ZZ7A 1GHXH 1DFPA 3IG6B 4TY6A 1ESBA 3SN8A 1EQ9A 2Q6GA 1GMDF 3RXTA 2Y82A 4YOGA 1GHBF 1KDQA 1V2JT 1OOKB 4Q7ZA 1O2MA 1O3NA 3M7TA 2Z3EA 4HFPB 1DDJA 1BRBE 5JBAS 2HPQH 2QIQA 5FPTA 4BXSA 4IN1A 1WBGB 1HGTH 1O2OA 3P95A 1HJ9A 3NWUA 1HJAB 1UVUH 1BJVA 2QYIA 1NFXA 1HLTH 3ZVGA 4ABJA 2AGIX 1LTOA 1KY9A 1O2VA 3ATWA 1C9TA 2G8TA 2EI8A 3UWJH 5F03A 1O2JA 1O5EH 1ETSH 2ZGJA 3RM2H 3TIUA 3ENSB 5EQSA 4I7YH 3TPIZ 3CS0A 3ZVFA 3E16B 3BTFE 1HAPH 2K1QA 3MO9A 1ANEA 1N8OC 2BLWA 1SSXA 3ZZ4A 1ELGA 2Q1JA 3A8AA 3IWMA 1O36A 1QHRB 4MTBA 1AKSA 5PTPA 3MI4A 2VWLA 2A5AA 5C67A 3L33A 1C2KA 1NFWA 1A5HA 1W12U 1Q31A 4QT8C 2C4FH 3ZVCA 4MPUA 9ESTA 1G2LA 1SQTA 2FYQA 4CRCA 3I77A 1SGNE 3ATIA 1O3EA 1O2QA 2FX6A 3UOPA 5I25A 4DIIH 2QC2A 4TWYA 2Z94A 1BIOA 4INKA 4XSKU 1AU8A 1NRNH 2V0BA 4Y7AA 1Z7KA 1VCQA 4TPYA 4DCDA 1GL1A 3S0NA 1O31A 2GP9B 1VITH 3EAJA 3PO1C 5LPRA 3A7WA 1LKAA 2A1DB 2AERH 1E37B 1QQ4A 2C8XB 1SHHB 2FOGA 1QL8A 1W7GH 3MYWA 4Q80A 3S9AA 3UNRA 1YC0A 1TNGA 3A84A 3UWIA 2FOMB 5G4BA 3LDXH 4CRGA 1SL3A 3RC6A 2JH0D 1HAGE 3KCGH 5GDSH 1MTNC 1JWTA 1JBUH 8GCHF 1ZR0A 5EG4A 2ZDLA 3M3SA 3FP6E 4AZ2B 1GMDG 3F9HA 4O3TA 3A8BA 2GMTB 4NG9H 3N7OA 4MPWA 2PW8H 2BX4A 3ZZ3A 1Z8IB 1P2KA 1BRCE 1EXFA 3M5OA 1HB0B 2JETB 1AQ7A 1FUJA 2NU3E 4IW4E 1TNKA 4CBNA 1FY8E 2XCNA 1LQDB 3E90B 3BTQE 3SV7A 5FX6A 2FOHA 2KAIB 3A89A 1MMJN 5TCAA 3VGCC 1AFEH 2GDDA 1J9CH 1YGCH 1W11U 2CXVA 2PKSC 2XBVA 4R8TB 1GVLA 5F8TA 1O2UA 3BIVH 3MNXA 3ZVBA 1DITH 2ZHQH 2J9NA 2W3IA 1QRZA 2WPJS 5C5OA 3UFAA 1FPCH 3PO1B 1GJ4H 2Y81A 1MH0A 3O8DA 3BSQA 2B0FA 4Y11E 2OQ5A 2QXHA 1BQYA 4A1XA 4I31A 1OSSA 3T28A 3QUMP 3CP7A 3BIUH 1RFNA 1DLKB 5C2ZA 1C2JA 2GV7A 3MU8A 2GKVE 4FUHA 1TONA 2AIQA 1TGTA 1CVWH 4RSPA 4WMFA 4X1NU 1O39A 1AI8H 1SI5H 2JKHA 3ATMA 1NRPH 1SGEE 1AY6H 1EP6A 1F2SE 4KGAA 4OS7A 1BMAA 1GBHA 1O0DH 3UREA 3ELAH 1AO5A 1K9OE 2NWNA 3MU4A 1TB6H 2WPMS 3O8RA 1NM6A 1FY4A 1GI3A 4WH6A 1QBNA 2VU8E 1MTUA 2Z6BD 1WUNH 1UK4A 3SW2B 1QNJA 4D7GA 4BAOB 1J16A 4MPXA 3RXDA 1ZLRA 1CBWB 2OQUA 2Y5GA 4BAHB 1OXGA 2ZFPH 4SGBE 2ZC9H 3UR6A 4IBLH 2PWXA 3PMBB 3LU9B 3EGKH 2Z3CA 3A8CA 1AWFH 1XKAC 2VVCA 1J15A 1GBJA 2J38A 1SB1H 2Q6DA 4ISNA 4Q7XA 4FUIA 2FOAA 3EA8A 1GGDB 3SU3A 1MU6B 1L1JA 4J2YB 4ZMAH 5J4SA 3QZQA 4VGCC 1TRNA 3FP7E 2NU1E 1ZHMA 2Y5HA 2G5VA 1BDAA 4CBOA 2ZU4A 3SV6A 2BDIA 1GHAG 3RP2A 3PYHA 4ZKSU 1QB6A 3LGUA 4FUEA 2W7SA 1EASA 4H6TA 1AZZA 1K1JA 2W26A 1AVXA 4ABFA 1BRAA 1FLEE 4YM9A 2XWBI 1DT2A 2P8OC 1O2LA 1UTKA 1C1SA 1ZTJA 1OWJA 8GCHG 2DE8A 1AVWA 1BTXA 2UUYA 4A5TS 1H8DH 1CA0C 1ID5H 2VJ1A 2J2UA 1K1MA 1AGJA 1SGRE 1QRWA 5EXNA 3ESTA 2FP7B 3L3TA 1QJ6B 1UTMA 1OPHB 4E7NA 1H4WA 1TX6A 2BVSH 1HNEE 1P12E 1TA2A 3QGJA 1ELBA 1GHYH 1NU7B 4A1VA 2GVFA 1ZYOA 2SGEE 2WINI 1C5QA 1HYLA 1VITG 4F4OC 4FXGH 1O3DA 1CU1A 4IS5A 4GLYA 1BOQA 2BOKA 2ZGXH 3SBKA 4GHQA 2XBYA 1WV7H 1BMLA 5A0CA 5EW1H 1AUTC 2KAIA 2GX4A 1DY9A 3A7TA 2O8UA 3UNSA 3CS7A 4ZHAA 3E0NB 4CR5A 2PGBB 2PKAA 2H6MA 3RXRA 3ZV8A 2AEIH 1AB9B 4X6PA 1OWHA 3T27A 1SBWA 3D62A 1C9PA 3V7TA 1UK3A 5FBIA 1PPGE 1C5OH 3BTDE 2J94A 4Y79A 1TNJA 1GL0E 3SUGA 4DOQA 1D3QB 4NFFA 3AASA 3C27B 3SJ9A 1SPJA 3GY2A 2A45B 1V2PT 5C1UA 3O8BA 3SI3H 1JMOH 4CHAB 4MNWA 1SOTA 4DG4A 1GBLA 2SGPE 1ACBE 1UTOA 1RIWB 1Y59T 1C1UH 2XC0A 5EPYA 1ZPCA 2F9PA 1QY6A 1TBZH 3RMNH 1C5WB 1F5RA 3BEUA 1SGYE 4D76A 4MNVA 3KEEA 2AGGX 2HWLB 1C5XB 4NFEA 3ATKA 3T62A 1P3CA 1GJBB 4A6LA 1F0UA 4K60A 4BXWA 3TLOA 4TWWA 1O3GA 2HOBA 5CHAC 1NT1A 2V6NA 1ZSKA 3M7UA 5EU8A 1EPTB 1T7CA 1HAIH 2FTLE 2R2MB 3GCNA 1FAXA 4ABEA 1UHBA 5E2OA 1Z6EA 2JH6D 1P9SA 5BRRE 2HPPH 1MQ6A 2A5IA 1C5NH 1OS8A 3U8TH 2WV5A 2BD9A 3AVZA 3GYLB 1ETRH 1N6XA 1AHTH 2QAAA 2B8OH 4INHA 1S84A 4WMEA 1HXFH 2BB4A 3MH6A 1MKXH 1IQIA 4WVPE 3HATH 3TJUA 5EQQA 2AS9A 5T6GA 3A7YA