2JMJA

Nmr solution structure of the phd domain from the yeast yng1 protein in complex with h3(1-9)k4me3 peptide
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
60
structure length
60
Chain Sequence
QEEVYCFCRNVSYGPMVACDNPACPFEWFHYGCVGLKQAPKGKWYCSKDCKEIANQRSKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein YNG1
publication title Yng1 PHD finger binding to H3 trimethylated at K4 promotes NuA3 HAT activity at K14 of H3 and transcription at a subset of targeted ORFs
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 3
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2006-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2jmjA00
1RMDA 2YYRA 3FL2A 2KGIA 2KU3A 5TBNA 2MT5A 2G45A 3M63A 2MD8C 1WFKA 1K2FA 2JMDA 4NN2A 4YATA 2ECWA 4YBMA 4R2YA 5B75A 2YT5A 1Z6UA 2RI7A 2LGKA 3LRQA 1WEVA 1LDJB 5D1LB 1WEWA 1X4IA 3U5PA 4MVTA 4A4CA 3U5OA 2YREA 3QZVA 2C2VS 4C9ZA 2VJEA 2VPEA 2VJEB 4I7CA 2M3HA 4V3LC 3ZVYA 3ASLA 1T1HA 1DVPA 4AYCA 4AYCB 3O36A 5G05B 3N9QA 1WE9A 5H1VA 4FO9A 3M62A 3N9LA 5H1TA 4QF2A 5D1KB 3ZYQA 3O33A 3O35A 3SOXA 5B76A 1WEUA 2FUUA 3LQIA 3NG2A 4WZ3B 2LGGA 2L75A 2K1JA 1MM2A 4WA6A 3DQVR 2E6RA 2M85A 2LGVA 4WZ0A 3KV5A 5JG6A 2M1RA 2EA6A 2KWNA 2JRJA 2KE1A 1U6GB 4P5OB 1FP0A 1Z60A 2KGGA 2QICA 1XWHA 3C5KA 2G43A 2L0BA 5EYAF 2F6NA 5KH9A 2K4DA 4LADB 2YUCA 3KQIA 4PTBA 3ZPV1 2PNXA 3RPGC 4R7EA 3O37A 2KWKA 4F52B 2PUYA 4QF3A 3SOWA 2YSMA 3LQHA 3SOUA 2CSYA 2IDAA 3V43A 4CCGX 1X4JA 4I7BA 4X3GA 4O64A 3MHSA 1HYIA 3ZNIA 1MM3A 5J3XA 2LN0A 2ECIA 5TDWA 1VYXA 2C2LA 1WESA 4IC3A 4S3OC 2Y1MA 1BORA 2FUIA 1WEMA 2MD7B 1G25A 3N9NA 4FIPA 4ZDTA 2K16A 2ZETC 5LKUA 5LKTA 1JM7A 2LGLA 2Y43A 3KNVA 2VPGA 4N4FA 3HCTA 2UZGA 3PURA 4AVXA 2JMIA 2HDPA 1F62A 3DPLR 3KV6A 4GNGA 2MNYA 3PHDA 4GNEA 2AN6A 2L80A 2MNZA 3ZTGA 4LK9A 5DINA 4ZQLA 3SHBA 2RSDA 3I2DA 4FK5A 5G0FA 1JOCA 4YADA 3ZPVE 5AIUA 4YBTA 2CKLA 2CKLB 2MIQA 4GNFA 4CA1A 5G04B 2LQ6A 2YSJA 5KH3A 4Q6FA 3ZVZB 5H9MA 4FJCA 5LKZA 4B86C 2YQMA 2DX8A 3EB6A 5B79A 4UI9B 1WILA 4TKPB 3U5NA 5B78A 2M6MA 2KWOA 3O34A 5KH7A 1IYMA 4IC2A 4WZ2A 5AITA 4UP5A 2G6QA 3RPGB 2JMJA 1WENA 2YURA 3GL6A 2VPDA 2XB1A 4N3WA 1VD4A 4L7XA 2XEUA 2ECNA 4A49A 3LQJA 2D8SA 1WEEA 1WEQA 1CHCA 5TRBA 2ECVA 2L43A 1VFYA 4UP0A 4A0CD 3L1ZB 1Z2QA 3MHHA 2Y1NA 4W4UA 1HYJA 4S3OB 4LLBA 4YABA 4GB0A 4AUQB 5FB1A 4MSXA 4BBQA 4LJNA 1JM7B 4YAXA 4XI1A 2NAAA 3M99A 3EB5A 2VP7A 3U5MA 5H1UA 5TDRA 5TABA 4AP4A 1ZBDB 2ECTA 2EODA 4LKAA 1V87A 3O7AA 3PUQA 3VK6A 2VNFA 5FB0A 2ECJA 1WGMA 5C13A 2F6JA 1FBVA 2F42A 1WEPA 5LCWB 2QJ0A 3C6WA 2CSZA 2KYUA 5B8DA 4R8PK 3N9MA 4L58A 2KIZA 4B7YC 1WIMA 2HYED 5FERA 4GNDA 1N87A 2VPBA 3L1XA 1X4UA 2E6SA 2FSAA 2VJFA 3N9OA 1LDKC 2VJFB 2QIZA 5I3LA 2LRIC 2LDRA 5D1MB 4ZUXU 2L5UA 1WEOA 2YHNA 3RTRB 2KR4A 3O70A 2KREA 2MA5A 2YQLA 3N9PA 2LXHC 2MUMA 5FEYA 3T6RA 2BAYA 4A4BA 2YW8A 4YBSA 1E4UA 4PPEA 2KWJA 3T7LA 2YU4A 4V3KC 5B77A 3HTKC 4BHWA 2MA6A 3HCUA 2EGPA 2ECGA 2K17A 3L11A 2YHOA 3GV4A 3IHPA 2H0DA 2OXQC 2LXPC 3HCSA 2H0DB 4I7DA 4YC9A 2LV9A 2KFTA 2I50A 5DKAA 5C11A 2CT2A 5LKXA
chains in the Genus database with same CATH superfamily
1RMDA 2YYRA 3FL2A 2KGIA 2KU3A 5TBNA 2MT5A 2XOZA 2G45A 3M63A 4OGEA 2MD8C 1WFKA 1K2FA 2JMDA 4NN2A 4YATA 2ECWA 4YBMA 4R2YA 2DSMA 5B75A 2CRWA 2YT5A 2OWAA 1Z6UA 2RI7A 2LGKA 3LRQA 1WEVA 2LAUA 1LDJB 5D1LB 3KDEC 1WEWA 1X4IA 2XOYA 3U5PA 4MVTA 2XP0A 4A4CA 3U5OA 2YREA 3QZVA 2C2VS 4C9ZA 2VJEA 2VPEA 2VJEB 4I7CA 2M3HA 4V3LC 3ZVYA 3ASLA 1T1HA 1DVPA 4AYCA 4AYCB 3O36A 5G05B 3N9QA 1WE9A 2JM3A 5SVXA 5H1VA 4FO9A 3M62A 3N9LA 5H1TA 4QF2A 5D1KB 3ZYQA 3O33A 3O35A 3SOXA 5B76A 1WEUA 2FUUA 3LQIA 3NG2A 2DJAA 4WZ3B 3LDYA 2LGGA 3LJUX 2L75A 2KKXA 2K1JA 1MM2A 5SVYA 4WA6A 3DQVR 2E6RA 2M85A 2IQJA 2LGVA 4WZ0A 3KV5A 5JG6A 2M1RA 2EA6A 2KWNA 2P57A 2JRJA 2KE1A 1U6GB 4P5OB 3FEHA 1FP0A 1Z60A 3FANA 2KGGA 2QICA 4QQ4A 1XWHA 3C5KA 2G43A 2L0BA 5EYAF 2F6NA 3DDTA 5KH9A 3LVQE 3MDBC 2K4DA 4LADB 2YUCA 3KQIA 2EGMA 4PTBA 3ZPV1 3Q1DA 2PNXA 4H9DA 3RPGC 4R7EA 3O37A 2KWKA 4F52B 2PUYA 4QF3A 4OGCA 2L7PA 3SOWA 2YSMA 3LQHA 3SOUA 2CSYA 2IDAA 3V43A 4CCGX 1X4JA 4I7BA 4X3GA 4O64A 3MHSA 1HYIA 3ZNIA 1MM3A 2E61A 5J3XA 2LN0A 2ECIA 5TDWA 3T9KA 1VYXA 2C2LA 4Z0OA 1WESA 4IC3A 4S3OC 2Y1MA 1BORA 2FUIA 1WEMA 2MD7B 1G25A 3N9NA 4FIPA 4ZDTA 2K16A 2ZETC 5LKUA 5LKTA 1JM7A 2LGLA 2Y43A 3KNVA 2VPGA 4N4FA 3HCTA 3SUBA 2UZGA 3PURA 4AVXA 2JMIA 2HDPA 1F62A 3FM8C 3DWDA 3DPLR 3KV6A 4GNGA 2MNYA 3PHDA 4GNEA 2AN6A 3LVRE 2L80A 2MNZA 3ZTGA 4LK9A 5DINA 4ZQLA 3SHBA 2RSDA 3I2DA 4FK5A 5G0FA 1JOCA 4YADA 3ZPVE 5AIUA 4YBTA 2CKLA 2CKLB 3O47A 2MIQA 4GNFA 4CA1A 5G04B 2LQ6A 2YSJA 5KH3A 4Q6FA 3ZVZB 4Z0RA 5H9MA 2KKYA 4FJCA 5LKZA 4B86C 2YQMA 3FJUB 2DX8A 3EB6A 5B79A 4UI9B 1WILA 4TKPB 5K3QA 3U5NA 5B78A 2M6MA 3E2DA 2KWOA 3O34A 5KH7A 1IYMA 4IC2A 4WZ2A 5AITA 4UP5A 2G6QA 3RPGB 2MKEA 2XOCA 2JMJA 1WENA 2YURA 3GL6A 2VPDA 2JUNA 2XB1A 2FD4A 4N3WA 1VD4A 4L7XA 2YVRA 2XEUA 2FFWA 2ECNA 4A49A 3LQJA 2D8SA 1WEEA 2CRRA 1WEQA 1CHCA 5TRBA 2ECVA 2L43A 1VFYA 4UP0A 4A0CD 3L1ZB 1Z2QA 3MHHA 2Y1NA 4W4UA 1HYJA 4S3OB 4LLBA 4YABA 4GB0A 1MBMA 4AUQB 2D8UA 5FB1A 4MSXA 2CONA 4BBQA 4LJNA 1JM7B 4YAXA 4XI1A 2NAAA 3M99A 3EB5A 2VP7A 3U5MA 5H1UA 5TDRA 5TABA 4AP4A 1ZBDB 2ECTA 2EODA 4LKAA 1V87A 3O7AA 3PUQA 3VK6A 2VNFA 3M7KA 5FB0A 2ECJA 1WGMA 5C13A 2F6JA 1FBVA 2F42A 1WEPA 5LCWB 2QJ0A 3C6WA 2CSZA 2KYUA 5B8DA 4R8PK 3N9MA 4L58A 4F1PA 2KIZA 4B7YC 1WIMA 2HYED 5FERA 4GNDA 1N87A 2VPBA 2RR4A 3L1XA 1X4UA 2E6SA 2FSAA 2VJFA 3N9OA 1LDKC 2VJFB 2QIZA 5I3LA 2LRIC 2LDRA 5D1MB 4ZUXU 2L5UA 4O62A 1DCQA 1WEOA 2M13A 2YHNA 3RTRB 3PLWA 2KR4A 3O70A 2KREA 2MA5A 2YQLA 3N9PA 2LXHC 2MUMA 2EXUA 5FEYA 3T6RA 2BAYA 4A4BA 2CSVA 2YW8A 4YBSA 1E4UA 4PPEA 2KWJA 3T7LA 3JUEA 2YU4A 3H7HA 4V3KC 5B77A 3HTKC 4BHWA 2MA6A 3HCUA 2EGPA 2ECGA 2K17A 3L11A 2YHOA 3GV4A 3IHPA 2H0DA 2OXQC 2LXPC 3HCSA 2H0DB 3FAOA 4I7DA 4YC9A 5SVIA 5SVIB 2LV9A 2KFTA 2I50A 5DKAA 5C11A 2B0OE 2CT2A 5LKXA
chains in the Genus database with same CATH topology
1RMDA 2YYRA 3FL2A 2KGIA 2KU3A 5TBNA 2MT5A 2G45A 3M63A 2MD8C 1WFKA 1K2FA 2JMDA 4NN2A 4YATA 2ECWA 4YBMA 4R2YA 5B75A 2YT5A 1Z6UA 2RI7A 2LGKA 3LRQA 1WEVA 1LDJB 5D1LB 1WEWA 1X4IA 3U5PA 4MVTA 4A4CA 3U5OA 2YREA 3QZVA 2C2VS 4C9ZA 2VJEA 2VPEA 2VJEB 4I7CA 2M3HA 4V3LC 3ZVYA 3ASLA 1T1HA 1DVPA 4AYCA 4AYCB 3O36A 5G05B 3N9QA 1WE9A 5H1VA 4FO9A 3M62A 3N9LA 5H1TA 4QF2A 5D1KB 3ZYQA 3O33A 3O35A 3SOXA 5B76A 1WEUA 2FUUA 3LQIA 3NG2A 4WZ3B 2LGGA 2L75A 2K1JA 1MM2A 4WA6A 3DQVR 2E6RA 2M85A 2LGVA 4WZ0A 3KV5A 5JG6A 2M1RA 2EA6A 2KWNA 2JRJA 2KE1A 1U6GB 4P5OB 1FP0A 1Z60A 2KGGA 2QICA 1XWHA 3C5KA 2G43A 2L0BA 5EYAF 2F6NA 5KH9A 2K4DA 4LADB 2YUCA 3KQIA 4PTBA 3ZPV1 2PNXA 3RPGC 4R7EA 3O37A 2KWKA 4F52B 2PUYA 4QF3A 3SOWA 2YSMA 3LQHA 3SOUA 2CSYA 2IDAA 3V43A 4CCGX 1X4JA 4I7BA 4X3GA 4O64A 3MHSA 1HYIA 3ZNIA 1MM3A 5J3XA 2LN0A 2ECIA 5TDWA 1VYXA 2C2LA 1WESA 4IC3A 4S3OC 2Y1MA 1BORA 2FUIA 1WEMA 2MD7B 1G25A 3N9NA 4FIPA 4ZDTA 2K16A 2ZETC 5LKUA 5LKTA 1JM7A 2LGLA 2Y43A 3KNVA 2VPGA 4N4FA 3HCTA 2UZGA 3PURA 4AVXA 2JMIA 2HDPA 1F62A 3DPLR 3KV6A 4GNGA 2MNYA 3PHDA 4GNEA 2AN6A 2L80A 2MNZA 3ZTGA 4LK9A 5DINA 4ZQLA 3SHBA 2RSDA 3I2DA 4FK5A 5G0FA 1JOCA 4YADA 3ZPVE 5AIUA 4YBTA 2CKLA 2CKLB 2MIQA 4GNFA 4CA1A 5G04B 2LQ6A 2YSJA 5KH3A 4Q6FA 3ZVZB 5H9MA 4FJCA 5LKZA 4B86C 2YQMA 2DX8A 3EB6A 5B79A 4UI9B 1WILA 4TKPB 3U5NA 5B78A 2M6MA 2KWOA 3O34A 5KH7A 1IYMA 4IC2A 4WZ2A 5AITA 4UP5A 2G6QA 3RPGB 2JMJA 1WENA 2YURA 3GL6A 2VPDA 2XB1A 4N3WA 1VD4A 4L7XA 2XEUA 2ECNA 4A49A 3LQJA 2D8SA 1WEEA 1WEQA 1CHCA 5TRBA 2ECVA 2L43A 1VFYA 4UP0A 4A0CD 3L1ZB 1Z2QA 3MHHA 2Y1NA 4W4UA 1HYJA 4S3OB 4LLBA 4YABA 4GB0A 4AUQB 5FB1A 4MSXA 4BBQA 4LJNA 1JM7B 4YAXA 4XI1A 2NAAA 3M99A 3EB5A 2VP7A 3U5MA 5H1UA 5TDRA 5TABA 4AP4A 1ZBDB 2ECTA 2EODA 4LKAA 1V87A 3O7AA 3PUQA 3VK6A 2VNFA 5FB0A 2ECJA 1WGMA 5C13A 2F6JA 1FBVA 2F42A 1WEPA 5LCWB 2QJ0A 3C6WA 2CSZA 2KYUA 5B8DA 4R8PK 3N9MA 4L58A 2KIZA 4B7YC 1WIMA 2HYED 5FERA 4GNDA 1N87A 2VPBA 3L1XA 1X4UA 2E6SA 2FSAA 2VJFA 3N9OA 1LDKC 2VJFB 2QIZA 5I3LA 2LRIC 2LDRA 5D1MB 4ZUXU 2L5UA 1WEOA 2YHNA 3RTRB 2KR4A 3O70A 2KREA 2MA5A 2YQLA 3N9PA 2LXHC 2MUMA 5FEYA 3T6RA 2BAYA 4A4BA 2YW8A 4YBSA 1E4UA 4PPEA 2KWJA 3T7LA 2YU4A 4V3KC 5B77A 3HTKC 4BHWA 2MA6A 3HCUA 2EGPA 2ECGA 2K17A 3L11A 2YHOA 3GV4A 3IHPA 2H0DA 2OXQC 2LXPC 3HCSA 2H0DB 4I7DA 4YC9A 2LV9A 2KFTA 2I50A 5DKAA 5C11A 2CT2A 5LKXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RMD A;  2YYR A;  3FL2 A;  2KGI A;  2KU3 A;  5TBN A;  2MT5 A;  2G45 A;  3M63 A;  2MD8 C;  1WFK A;  1K2F A;  2JMD A;  4NN2 A;  4YAT A;  2ECW A;  4YBM A;  4R2Y A;  5B75 A;  2YT5 A;  1Z6U A;  2RI7 A;  2LGK A;  3LRQ A;  1WEV A;  1LDJ B;  5D1L B;  1WEW A;  1X4I A;  3U5P A;  4MVT A;  4A4C A;  3U5O A;  2YRE A;  3QZV A;  2C2V S;  4C9Z A;  2VJE A;  2VPE A;  2VJE B;  4I7C A;  2M3H A;  4V3L C;  3ZVY A;  3ASL A;  1T1H A;  1DVP A;  4AYC A;  4AYC B;  3O36 A;  5G05 B;  3N9Q A;  1WE9 A;  5H1V A;  4FO9 A;  3M62 A;  3N9L A;  5H1T A;  4QF2 A;  5D1K B;  3ZYQ A;  3O33 A;  3O35 A;  3SOX A;  5B76 A;  1WEU A;  2FUU A;  3LQI A;  3NG2 A;  4WZ3 B;  2LGG A;  2L75 A;  2K1J A;  1MM2 A;  4WA6 A;  3DQV R;  2E6R A;  2M85 A;  2LGV A;  4WZ0 A;  3KV5 A;  5JG6 A;  2M1R A;  2EA6 A;  2KWN A;  2JRJ A;  2KE1 A;  1U6G B;  4P5O B;  1FP0 A;  1Z60 A;  2KGG A;  2QIC A;  1XWH A;  3C5K A;  2G43 A;  2L0B A;  5EYA F;  2F6N A;  5KH9 A;  2K4D A;  4LAD B;  2YUC A;  3KQI A;  4PTB A;  3ZPV 1;  2PNX A;  3RPG C;  4R7E A;  3O37 A;  2KWK A;  4F52 B;  2PUY A;  4QF3 A;  3SOW A;  2YSM A;  3LQH A;  3SOU A;  2CSY A;  2IDA A;  3V43 A;  4CCG X;  1X4J A;  4I7B A;  4X3G A;  4O64 A;  3MHS A;  1HYI A;  3ZNI A;  1MM3 A;  5J3X A;  2LN0 A;  2ECI A;  5TDW A;  1VYX A;  2C2L A;  1WES A;  4IC3 A;  4S3O C;  2Y1M A;  1BOR A;  2FUI A;  1WEM A;  2MD7 B;  1G25 A;  3N9N A;  4FIP A;  4ZDT A;  2K16 A;  2ZET C;  5LKU A;  5LKT A;  1JM7 A;  2LGL A;  2Y43 A;  3KNV A;  2VPG A;  4N4F A;  3HCT A;  2UZG A;  3PUR A;  4AVX A;  2JMI A;  2HDP A;  1F62 A;  3DPL R;  3KV6 A;  4GNG A;  2MNY A;  3PHD A;  4GNE A;  2AN6 A;  2L80 A;  2MNZ A;  3ZTG A;  4LK9 A;  5DIN A;  4ZQL A;  3SHB A;  2RSD A;  3I2D A;  4FK5 A;  5G0F A;  1JOC A;  4YAD A;  3ZPV E;  5AIU A;  4YBT A;  2CKL A;  2CKL B;  2MIQ A;  4GNF A;  4CA1 A;  5G04 B;  2LQ6 A;  2YSJ A;  5KH3 A;  4Q6F A;  3ZVZ B;  5H9M A;  4FJC A;  5LKZ A;  4B86 C;  2YQM A;  2DX8 A;  3EB6 A;  5B79 A;  4UI9 B;  1WIL A;  4TKP B;  3U5N A;  5B78 A;  2M6M A;  2KWO A;  3O34 A;  5KH7 A;  1IYM A;  4IC2 A;  4WZ2 A;  5AIT A;  4UP5 A;  2G6Q A;  3RPG B;  2JMJ A;  1WEN A;  2YUR A;  3GL6 A;  2VPD A;  2XB1 A;  4N3W A;  1VD4 A;  4L7X A;  2XEU A;  2ECN A;  4A49 A;  3LQJ A;  2D8S A;  1WEE A;  1WEQ A;  1CHC A;  5TRB A;  2ECV A;  2L43 A;  1VFY A;  4UP0 A;  4A0C D;  3L1Z B;  1Z2Q A;  3MHH A;  2Y1N A;  4W4U A;  1HYJ A;  4S3O B;  4LLB A;  4YAB A;  4GB0 A;  4AUQ B;  5FB1 A;  4MSX A;  4BBQ A;  4LJN A;  1JM7 B;  4YAX A;  4XI1 A;  2NAA A;  3M99 A;  3EB5 A;  2VP7 A;  3U5M A;  5H1U A;  5TDR A;  5TAB A;  4AP4 A;  1ZBD B;  2ECT A;  2EOD A;  4LKA A;  1V87 A;  3O7A A;  3PUQ A;  3VK6 A;  2VNF A;  5FB0 A;  2ECJ A;  1WGM A;  5C13 A;  2F6J A;  1FBV A;  2F42 A;  1WEP A;  5LCW B;  2QJ0 A;  3C6W A;  2CSZ A;  2KYU A;  5B8D A;  4R8P K;  3N9M A;  4L58 A;  2KIZ A;  4B7Y C;  1WIM A;  2HYE D;  5FER A;  4GND A;  1N87 A;  2VPB A;  3L1X A;  1X4U A;  2E6S A;  2FSA A;  2VJF A;  3N9O A;  1LDK C;  2VJF B;  2QIZ A;  5I3L A;  2LRI C;  2LDR A;  5D1M B;  4ZUX U;  2L5U A;  1WEO A;  2YHN A;  3RTR B;  2KR4 A;  3O70 A;  2KRE A;  2MA5 A;  2YQL A;  3N9P A;  2LXH C;  2MUM A;  5FEY A;  3T6R A;  2BAY A;  4A4B A;  2YW8 A;  4YBS A;  1E4U A;  4PPE A;  2KWJ A;  3T7L A;  2YU4 A;  4V3K C;  5B77 A;  3HTK C;  4BHW A;  2MA6 A;  3HCU A;  2EGP A;  2ECG A;  2K17 A;  3L11 A;  2YHO A;  3GV4 A;  3IHP A;  2H0D A;  2OXQ C;  2LXP C;  3HCS A;  2H0D B;  4I7D A;  4YC9 A;  2LV9 A;  2KFT A;  2I50 A;  5DKA A;  5C11 A;  2CT2 A;  5LKX A; 
#chains in the Genus database with same CATH topology
 1RMD A;  2YYR A;  3FL2 A;  2KGI A;  2KU3 A;  5TBN A;  2MT5 A;  2XOZ A;  2G45 A;  3M63 A;  4OGE A;  2MD8 C;  1WFK A;  1K2F A;  2JMD A;  4NN2 A;  4YAT A;  2ECW A;  4YBM A;  4R2Y A;  2DSM A;  5B75 A;  2CRW A;  2YT5 A;  2OWA A;  1Z6U A;  2RI7 A;  2LGK A;  3LRQ A;  1WEV A;  2LAU A;  1LDJ B;  5D1L B;  3KDE C;  1WEW A;  1X4I A;  2XOY A;  3U5P A;  4MVT A;  2XP0 A;  4A4C A;  3U5O A;  2YRE A;  3QZV A;  2C2V S;  4C9Z A;  2VJE A;  2VPE A;  2VJE B;  4I7C A;  2M3H A;  4V3L C;  3ZVY A;  3ASL A;  1T1H A;  1DVP A;  4AYC A;  4AYC B;  3O36 A;  5G05 B;  3N9Q A;  1WE9 A;  2JM3 A;  5SVX A;  5H1V A;  4FO9 A;  3M62 A;  3N9L A;  5H1T A;  4QF2 A;  5D1K B;  3ZYQ A;  3O33 A;  3O35 A;  3SOX A;  5B76 A;  1WEU A;  2FUU A;  3LQI A;  3NG2 A;  2DJA A;  4WZ3 B;  3LDY A;  2LGG A;  3LJU X;  2L75 A;  2KKX A;  2K1J A;  1MM2 A;  5SVY A;  4WA6 A;  3DQV R;  2E6R A;  2M85 A;  2IQJ A;  2LGV A;  4WZ0 A;  3KV5 A;  5JG6 A;  2M1R A;  2EA6 A;  2KWN A;  2P57 A;  2JRJ A;  2KE1 A;  1U6G B;  4P5O B;  3FEH A;  1FP0 A;  1Z60 A;  3FAN A;  2KGG A;  2QIC A;  4QQ4 A;  1XWH A;  3C5K A;  2G43 A;  2L0B A;  5EYA F;  2F6N A;  3DDT A;  5KH9 A;  3LVQ E;  3MDB C;  2K4D A;  4LAD B;  2YUC A;  3KQI A;  2EGM A;  4PTB A;  3ZPV 1;  3Q1D A;  2PNX A;  4H9D A;  3RPG C;  4R7E A;  3O37 A;  2KWK A;  4F52 B;  2PUY A;  4QF3 A;  4OGC A;  2L7P A;  3SOW A;  2YSM A;  3LQH A;  3SOU A;  2CSY A;  2IDA A;  3V43 A;  4CCG X;  1X4J A;  4I7B A;  4X3G A;  4O64 A;  3MHS A;  1HYI A;  3ZNI A;  1MM3 A;  2E61 A;  5J3X A;  2LN0 A;  2ECI A;  5TDW A;  3T9K A;  1VYX A;  2C2L A;  4Z0O A;  1WES A;  4IC3 A;  4S3O C;  2Y1M A;  1BOR A;  2FUI A;  1WEM A;  2MD7 B;  1G25 A;  3N9N A;  4FIP A;  4ZDT A;  2K16 A;  2ZET C;  5LKU A;  5LKT A;  1JM7 A;  2LGL A;  2Y43 A;  3KNV A;  2VPG A;  4N4F A;  3HCT A;  3SUB A;  2UZG A;  3PUR A;  4AVX A;  2JMI A;  2HDP A;  1F62 A;  3FM8 C;  3DWD A;  3DPL R;  3KV6 A;  4GNG A;  2MNY A;  3PHD A;  4GNE A;  2AN6 A;  3LVR E;  2L80 A;  2MNZ A;  3ZTG A;  4LK9 A;  5DIN A;  4ZQL A;  3SHB A;  2RSD A;  3I2D A;  4FK5 A;  5G0F A;  1JOC A;  4YAD A;  3ZPV E;  5AIU A;  4YBT A;  2CKL A;  2CKL B;  3O47 A;  2MIQ A;  4GNF A;  4CA1 A;  5G04 B;  2LQ6 A;  2YSJ A;  5KH3 A;  4Q6F A;  3ZVZ B;  4Z0R A;  5H9M A;  2KKY A;  4FJC A;  5LKZ A;  4B86 C;  2YQM A;  3FJU B;  2DX8 A;  3EB6 A;  5B79 A;  4UI9 B;  1WIL A;  4TKP B;  5K3Q A;  3U5N A;  5B78 A;  2M6M A;  3E2D A;  2KWO A;  3O34 A;  5KH7 A;  1IYM A;  4IC2 A;  4WZ2 A;  5AIT A;  4UP5 A;  2G6Q A;  3RPG B;  2MKE A;  2XOC A;  2JMJ A;  1WEN A;  2YUR A;  3GL6 A;  2VPD A;  2JUN A;  2XB1 A;  2FD4 A;  4N3W A;  1VD4 A;  4L7X A;  2YVR A;  2XEU A;  2FFW A;  2ECN A;  4A49 A;  3LQJ A;  2D8S A;  1WEE A;  2CRR A;  1WEQ A;  1CHC A;  5TRB A;  2ECV A;  2L43 A;  1VFY A;  4UP0 A;  4A0C D;  3L1Z B;  1Z2Q A;  3MHH A;  2Y1N A;  4W4U A;  1HYJ A;  4S3O B;  4LLB A;  4YAB A;  4GB0 A;  1MBM A;  4AUQ B;  2D8U A;  5FB1 A;  4MSX A;  2CON A;  4BBQ A;  4LJN A;  1JM7 B;  4YAX A;  4XI1 A;  2NAA A;  3M99 A;  3EB5 A;  2VP7 A;  3U5M A;  5H1U A;  5TDR A;  5TAB A;  4AP4 A;  1ZBD B;  2ECT A;  2EOD A;  4LKA A;  1V87 A;  3O7A A;  3PUQ A;  3VK6 A;  2VNF A;  3M7K A;  5FB0 A;  2ECJ A;  1WGM A;  5C13 A;  2F6J A;  1FBV A;  2F42 A;  1WEP A;  5LCW B;  2QJ0 A;  3C6W A;  2CSZ A;  2KYU A;  5B8D A;  4R8P K;  3N9M A;  4L58 A;  4F1P A;  2KIZ A;  4B7Y C;  1WIM A;  2HYE D;  5FER A;  4GND A;  1N87 A;  2VPB A;  2RR4 A;  3L1X A;  1X4U A;  2E6S A;  2FSA A;  2VJF A;  3N9O A;  1LDK C;  2VJF B;  2QIZ A;  5I3L A;  2LRI C;  2LDR A;  5D1M B;  4ZUX U;  2L5U A;  4O62 A;  1DCQ A;  1WEO A;  2M13 A;  2YHN A;  3RTR B;  3PLW A;  2KR4 A;  3O70 A;  2KRE A;  2MA5 A;  2YQL A;  3N9P A;  2LXH C;  2MUM A;  2EXU A;  5FEY A;  3T6R A;  2BAY A;  4A4B A;  2CSV A;  2YW8 A;  4YBS A;  1E4U A;  4PPE A;  2KWJ A;  3T7L A;  3JUE A;  2YU4 A;  3H7H A;  4V3K C;  5B77 A;  3HTK C;  4BHW A;  2MA6 A;  3HCU A;  2EGP A;  2ECG A;  2K17 A;  3L11 A;  2YHO A;  3GV4 A;  3IHP A;  2H0D A;  2OXQ C;  2LXP C;  3HCS A;  2H0D B;  3FAO A;  4I7D A;  4YC9 A;  5SVI A;  5SVI B;  2LV9 A;  2KFT A;  2I50 A;  5DKA A;  5C11 A;  2B0O E;  2CT2 A;  5LKX A; 
#chains in the Genus database with same CATH homology
 1RMD A;  2YYR A;  3FL2 A;  2KGI A;  2KU3 A;  5TBN A;  2MT5 A;  2G45 A;  3M63 A;  2MD8 C;  1WFK A;  1K2F A;  2JMD A;  4NN2 A;  4YAT A;  2ECW A;  4YBM A;  4R2Y A;  5B75 A;  2YT5 A;  1Z6U A;  2RI7 A;  2LGK A;  3LRQ A;  1WEV A;  1LDJ B;  5D1L B;  1WEW A;  1X4I A;  3U5P A;  4MVT A;  4A4C A;  3U5O A;  2YRE A;  3QZV A;  2C2V S;  4C9Z A;  2VJE A;  2VPE A;  2VJE B;  4I7C A;  2M3H A;  4V3L C;  3ZVY A;  3ASL A;  1T1H A;  1DVP A;  4AYC A;  4AYC B;  3O36 A;  5G05 B;  3N9Q A;  1WE9 A;  5H1V A;  4FO9 A;  3M62 A;  3N9L A;  5H1T A;  4QF2 A;  5D1K B;  3ZYQ A;  3O33 A;  3O35 A;  3SOX A;  5B76 A;  1WEU A;  2FUU A;  3LQI A;  3NG2 A;  4WZ3 B;  2LGG A;  2L75 A;  2K1J A;  1MM2 A;  4WA6 A;  3DQV R;  2E6R A;  2M85 A;  2LGV A;  4WZ0 A;  3KV5 A;  5JG6 A;  2M1R A;  2EA6 A;  2KWN A;  2JRJ A;  2KE1 A;  1U6G B;  4P5O B;  1FP0 A;  1Z60 A;  2KGG A;  2QIC A;  1XWH A;  3C5K A;  2G43 A;  2L0B A;  5EYA F;  2F6N A;  5KH9 A;  2K4D A;  4LAD B;  2YUC A;  3KQI A;  4PTB A;  3ZPV 1;  2PNX A;  3RPG C;  4R7E A;  3O37 A;  2KWK A;  4F52 B;  2PUY A;  4QF3 A;  3SOW A;  2YSM A;  3LQH A;  3SOU A;  2CSY A;  2IDA A;  3V43 A;  4CCG X;  1X4J A;  4I7B A;  4X3G A;  4O64 A;  3MHS A;  1HYI A;  3ZNI A;  1MM3 A;  5J3X A;  2LN0 A;  2ECI A;  5TDW A;  1VYX A;  2C2L A;  1WES A;  4IC3 A;  4S3O C;  2Y1M A;  1BOR A;  2FUI A;  1WEM A;  2MD7 B;  1G25 A;  3N9N A;  4FIP A;  4ZDT A;  2K16 A;  2ZET C;  5LKU A;  5LKT A;  1JM7 A;  2LGL A;  2Y43 A;  3KNV A;  2VPG A;  4N4F A;  3HCT A;  2UZG A;  3PUR A;  4AVX A;  2JMI A;  2HDP A;  1F62 A;  3DPL R;  3KV6 A;  4GNG A;  2MNY A;  3PHD A;  4GNE A;  2AN6 A;  2L80 A;  2MNZ A;  3ZTG A;  4LK9 A;  5DIN A;  4ZQL A;  3SHB A;  2RSD A;  3I2D A;  4FK5 A;  5G0F A;  1JOC A;  4YAD A;  3ZPV E;  5AIU A;  4YBT A;  2CKL A;  2CKL B;  2MIQ A;  4GNF A;  4CA1 A;  5G04 B;  2LQ6 A;  2YSJ A;  5KH3 A;  4Q6F A;  3ZVZ B;  5H9M A;  4FJC A;  5LKZ A;  4B86 C;  2YQM A;  2DX8 A;  3EB6 A;  5B79 A;  4UI9 B;  1WIL A;  4TKP B;  3U5N A;  5B78 A;  2M6M A;  2KWO A;  3O34 A;  5KH7 A;  1IYM A;  4IC2 A;  4WZ2 A;  5AIT A;  4UP5 A;  2G6Q A;  3RPG B;  2JMJ A;  1WEN A;  2YUR A;  3GL6 A;  2VPD A;  2XB1 A;  4N3W A;  1VD4 A;  4L7X A;  2XEU A;  2ECN A;  4A49 A;  3LQJ A;  2D8S A;  1WEE A;  1WEQ A;  1CHC A;  5TRB A;  2ECV A;  2L43 A;  1VFY A;  4UP0 A;  4A0C D;  3L1Z B;  1Z2Q A;  3MHH A;  2Y1N A;  4W4U A;  1HYJ A;  4S3O B;  4LLB A;  4YAB A;  4GB0 A;  4AUQ B;  5FB1 A;  4MSX A;  4BBQ A;  4LJN A;  1JM7 B;  4YAX A;  4XI1 A;  2NAA A;  3M99 A;  3EB5 A;  2VP7 A;  3U5M A;  5H1U A;  5TDR A;  5TAB A;  4AP4 A;  1ZBD B;  2ECT A;  2EOD A;  4LKA A;  1V87 A;  3O7A A;  3PUQ A;  3VK6 A;  2VNF A;  5FB0 A;  2ECJ A;  1WGM A;  5C13 A;  2F6J A;  1FBV A;  2F42 A;  1WEP A;  5LCW B;  2QJ0 A;  3C6W A;  2CSZ A;  2KYU A;  5B8D A;  4R8P K;  3N9M A;  4L58 A;  2KIZ A;  4B7Y C;  1WIM A;  2HYE D;  5FER A;  4GND A;  1N87 A;  2VPB A;  3L1X A;  1X4U A;  2E6S A;  2FSA A;  2VJF A;  3N9O A;  1LDK C;  2VJF B;  2QIZ A;  5I3L A;  2LRI C;  2LDR A;  5D1M B;  4ZUX U;  2L5U A;  1WEO A;  2YHN A;  3RTR B;  2KR4 A;  3O70 A;  2KRE A;  2MA5 A;  2YQL A;  3N9P A;  2LXH C;  2MUM A;  5FEY A;  3T6R A;  2BAY A;  4A4B A;  2YW8 A;  4YBS A;  1E4U A;  4PPE A;  2KWJ A;  3T7L A;  2YU4 A;  4V3K C;  5B77 A;  3HTK C;  4BHW A;  2MA6 A;  3HCU A;  2EGP A;  2ECG A;  2K17 A;  3L11 A;  2YHO A;  3GV4 A;  3IHP A;  2H0D A;  2OXQ C;  2LXP C;  3HCS A;  2H0D B;  4I7D A;  4YC9 A;  2LV9 A;  2KFT A;  2I50 A;  5DKA A;  5C11 A;  2CT2 A;  5LKX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...