2JMJA

Nmr solution structure of the phd domain from the yeast yng1 protein in complex with h3(1-9)k4me3 peptide
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
60
structure length
60
Chain Sequence
QEEVYCFCRNVSYGPMVACDNPACPFEWFHYGCVGLKQAPKGKWYCSKDCKEIANQRSKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Protein YNG1
publication title Yng1 PHD finger binding to H3 trimethylated at K4 promotes NuA3 HAT activity at K14 of H3 and transcription at a subset of targeted ORFs
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 3
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2006-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2jmjA00
1WEMA 3O70A 5AIUA 2VPBA 3T6RA 2ECJA 4V3KC 2OXQC 4A4CA 1WEUA 3M62A 4QF2A 2Y43A 4GNDA 3M99A 3RTRB 2MD7B 2NAAA 1V87A 2ECWA 3ZTGA 2L80A 3VK6A 4UI9B 4CA1A 4I7CA 5D1LB 2C2LA 4PTBA 2JMJA 1HYIA 2YYRA 4L58A 5LKTA 2K16A 1HYJA 1LDKC 1X4UA 4ZQLA 4GNEA 1Z6UA 2DX8A 2VJEB 4R7EA 4W4UA 3O36A 2CKLA 2YSJA 4O64A 3IHPA 4YAXA 2YREA 5DKAA 3FL2A 2MT5A 2EA6A 2FUUA 4YC9A 2F42A 4I7DA 1LDJB 3N9NA 5FEYA 5KH3A 2K4DA 2L5UA 2H0DB 5B79A 4WA6A 5TABA 1WIMA 2KYUA 4N4FA 2VPGA 3KQIA 3U5OA 3V43A 4FK5A 2YHNA 3NG2A 4Q6FA 2ZETC 4A0CD 4C9ZA 4PPEA 2KR4A 2ECIA 4L7XA 5FB1A 2KWKA 4IC2A 1E4UA 4LK9A 2VNFA 3N9LA 4P5OB 1WFKA 2VJFB 2KU3A 3KNVA 1WEPA 3LQJA 5H1TA 5G0FA 5H1UA 5KH9A 4AYCA 3ZNIA 3O37A 4YABA 3N9MA 3PHDA 3LQHA 5LKUA 1ZBDB 5LKZA 3T7LA 2KGGA 2K17A 5D1MB 2E6SA 4AP4A 3QZVA 2ECTA 3O35A 1JM7A 3N9QA 3ZVYA 2JRJA 4ZUXU 3RPGB 1WEWA 4LKAA 2MD8C 2G45A 4X3GA 4GNFA 3SOXA 2AN6A 2HDPA 3O34A 5C13A 5G04B 2VPDA 5C11A 2L75A 3ZPV1 3HCSA 2YT5A 2LGLA 2KFTA 5TDWA 2CSYA 2RI7A 4YATA 4WZ3B 3U5MA 2LN0A 2IDAA 4LADB 2LGVA 3KV5A 4S3OC 3HCTA 1WEQA 4I7BA 5I3LA 2G6QA 5LKXA 1IYMA 4GNGA 2ECVA 3MHHA 2L43A 1XWHA 3ZPVE 2LGGA 2EGPA 2KWJA 2KWNA 2M6MA 4R8PK 5AITA 2MUMA 2LV9A 3GL6A 5TRBA 2KGIA 2YQLA 2K1JA 2LDRA 3N9OA 4UP5A 2KWOA 2YW8A 4AVXA 1WEVA 5FERA 2D8SA 5FB0A 2QICA 4YBTA 4XI1A 2EODA 4FIPA 3EB5A 4A49A 1WEOA 1F62A 2LXHC 4GB0A 3LQIA 3C6WA 1WGMA 1Z2QA 2YUCA 2KREA 1JOCA 2VP7A 5J3XA 3M63A 2XB1A 2HYED 4V3LC 2Y1MA 5EYAF 1VYXA 2VJEA 3ZYQA 3DPLR 1FP0A 3L11A 2M85A 3DQVR 2L0BA 2Y1NA 3U5PA 2C2VS 3HTKC 5D1KB 3SOUA 2CT2A 2LXPC 3SHBA 1WE9A 1N87A 2YU4A 4YADA 1G25A 5B8DA 4B86C 4FO9A 5TBNA 2MIQA 4AUQB 2YSMA 4NN2A 3HCUA 4YBMA 2H0DA 2CKLB 5B76A 2PNXA 1X4JA 3PURA 3N9PA 3PUQA 2MNZA 4WZ2A 4BBQA 2KIZA 4UP0A 2KE1A 1Z60A 2YHOA 1RMDA 2LQ6A 2MNYA 2UZGA 2FSAA 4MSXA 1VD4A 2QJ0A 2VJFA 4LLBA 4QF3A 2XEUA 5LCWB 1CHCA 2LRIC 5G05B 2I50A 2MA6A 3L1XA 2E6RA 2VPEA 4IC3A 4ZDTA 4MVTA 1T1HA 3U5NA 1DVPA 2YQMA 1WILA 4CCGX 3ZVZB 3SOWA 5B78A 3L1ZB 3I2DA 4AYCB 4B7YC 1U6GB 2BAYA 3EB6A 4WZ0A 2PUYA 4YBSA 3ASLA 2YURA 5DINA 4N3WA 4BHWA 5JG6A 2JMDA 1BORA 2F6NA 5KH7A 3O7AA 1MM3A 3LRQA 2JMIA 1WEEA 1K2FA 2CSZA 4FJCA 2MA5A 4R2YA 5B77A 1MM2A 1JM7B 3RPGC 3KV6A 1WESA 3O33A 3C5KA 4TKPB 2M1RA 2F6JA 2LGKA 4S3OB 2QIZA 3GV4A 3MHSA 1VFYA 5H9MA 2G43A 4F52B 1FBVA 4A4BA 1WENA 4LJNA 5H1VA 2RSDA 5B75A 5TDRA 2M3HA 2ECGA 2ECNA 2FUIA 1X4IA
chains in the Genus database with same CATH superfamily
1WEMA 3O70A 5AIUA 2OWAA 2VPBA 3T6RA 2ECJA 4V3KC 2OXQC 4A4CA 1WEUA 3M62A 4QF2A 2Y43A 4GNDA 3M99A 3RTRB 2MD7B 2NAAA 1V87A 2ECWA 3ZTGA 2L80A 3VK6A 2D8UA 4UI9B 4CA1A 4I7CA 5D1LB 2C2LA 4PTBA 2JMJA 1HYIA 2YYRA 4L58A 3O47A 2YVRA 5LKTA 2K16A 1HYJA 1LDKC 1X4UA 4ZQLA 4GNEA 1Z6UA 2DX8A 2VJEB 4R7EA 4W4UA 3O36A 2CKLA 3LVQE 2YSJA 4O64A 3IHPA 4YAXA 2YREA 5DKAA 3FANA 4H9DA 3FL2A 3SUBA 2MT5A 2EA6A 4Z0RA 2FUUA 4YC9A 5SVYA 5SVIA 2F42A 4I7DA 5SVXA 1LDJB 3N9NA 5FEYA 5KH3A 2K4DA 2L5UA 2H0DB 5B79A 4WA6A 5TABA 1WIMA 2KYUA 4N4FA 2VPGA 3KQIA 3U5OA 3V43A 3M7KA 4FK5A 2YHNA 3NG2A 4Q6FA 2ZETC 4A0CD 4C9ZA 4PPEA 3KDEC 2KR4A 2ECIA 3FEHA 4L7XA 2XOZA 5FB1A 2KKYA 2KWKA 4IC2A 1E4UA 5K3QA 4LK9A 3MDBC 2VNFA 3N9LA 4P5OB 1WFKA 2VJFB 2KU3A 3KNVA 1WEPA 3LQJA 5H1TA 5G0FA 5H1UA 5KH9A 4AYCA 3ZNIA 3FAOA 3O37A 4YABA 3Q1DA 2EGMA 3N9MA 2EXUA 2IQJA 3PHDA 3LQHA 5LKUA 1ZBDB 5LKZA 3T7LA 2KGGA 2K17A 5D1MB 2E6SA 4AP4A 4O62A 3QZVA 2LAUA 2ECTA 3O35A 1JM7A 3N9QA 3T9KA 3ZVYA 2JRJA 4ZUXU 3RPGB 1WEWA 4LKAA 2MD8C 2G45A 4X3GA 4GNFA 3SOXA 2AN6A 2HDPA 3O34A 5C13A 5G04B 2VPDA 5C11A 2L75A 3ZPV1 3HCSA 2YT5A 2LGLA 4OGCA 2KFTA 2XOCA 5TDWA 3PLWA 2CSYA 2RI7A 4YATA 4WZ3B 3U5MA 2LN0A 3FM8C 2KKXA 2IDAA 4LADB 2LGVA 3KV5A 2CRRA 3HCTA 1WEQA 4I7BA 4S3OC 2G6QA 5I3LA 5LKXA 1IYMA 4GNGA 2ECVA 3MHHA 2L43A 1XWHA 3LDYA 3ZPVE 2LGGA 2EGPA 2KWJA 2KWNA 2M6MA 4R8PK 5AITA 2MUMA 2LV9A 3GL6A 5TRBA 2KGIA 2YQLA 2K1JA 2LDRA 3N9OA 2CRWA 4UP5A 2KWOA 2YW8A 4AVXA 1WEVA 5FERA 2D8SA 5FB0A 2QICA 4YBTA 4XI1A 2EODA 4FIPA 2CSVA 3EB5A 4A49A 1WEOA 1F62A 2LXHC 4GB0A 3LQIA 3C6WA 1WGMA 2CONA 1Z2QA 2YUCA 2KREA 1JOCA 2VP7A 1DCQA 5J3XA 3M63A 2XB1A 2HYED 4V3LC 2Y1MA 5EYAF 1VYXA 2VJEA 3ZYQA 3DPLR 1FP0A 3L11A 2M85A 3DQVR 2L0BA 2Y1NA 3U5PA 2C2VS 3HTKC 5D1KB 3SOUA 2CT2A 2LXPC 3JUEA 1WE9A 3SHBA 1N87A 2YU4A 4YADA 1G25A 5B8DA 4B86C 4FO9A 5TBNA 2MIQA 4AUQB 2YSMA 4NN2A 3HCUA 4YBMA 2H0DA 2CKLB 5B76A 2PNXA 1X4JA 3PURA 3N9PA 3PUQA 2MNZA 4WZ2A 4BBQA 2KIZA 3LVRE 4UP0A 2KE1A 1Z60A 2YHOA 1RMDA 2LQ6A 5SVIB 2B0OE 2MNYA 2UZGA 2FSAA 2M13A 2DSMA 4MSXA 1VD4A 2QJ0A 2VJFA 4LLBA 2XOYA 2XEUA 4QF3A 1MBMA 5LCWB 1CHCA 2LRIC 2JUNA 5G05B 2I50A 2MA6A 3L1XA 2E6RA 2L7PA 2VPEA 4IC3A 4ZDTA 4MVTA 1T1HA 3U5NA 1DVPA 2YQMA 1WILA 4CCGX 2FFWA 3ZVZB 2E61A 3SOWA 5B78A 3DWDA 3FJUB 3L1ZB 3I2DA 4AYCB 4B7YC 1U6GB 2BAYA 4Z0OA 2FD4A 3EB6A 4WZ0A 2PUYA 2P57A 4YBSA 2JM3A 3E2DA 3ASLA 2YURA 3DDTA 5DINA 4N3WA 4BHWA 5JG6A 2JMDA 1BORA 2F6NA 5KH7A 3O7AA 1MM3A 3LRQA 2JMIA 1WEEA 3LJUX 1K2FA 2CSZA 4FJCA 2MA5A 4OGEA 4R2YA 5B77A 1MM2A 1JM7B 3RPGC 2DJAA 3KV6A 1WESA 3H7HA 4F1PA 3O33A 3C5KA 4TKPB 2M1RA 2F6JA 2LGKA 4S3OB 4QQ4A 2QIZA 2MKEA 3GV4A 3MHSA 1VFYA 5H9MA 2G43A 4F52B 1FBVA 2RR4A 4A4BA 1WENA 4LJNA 5H1VA 2RSDA 5B75A 2XP0A 5TDRA 2M3HA 2ECGA 2ECNA 2FUIA 1X4IA
chains in the Genus database with same CATH topology
1WEMA 3O70A 5AIUA 2VPBA 3T6RA 2ECJA 4V3KC 2OXQC 4A4CA 1WEUA 3M62A 4QF2A 2Y43A 4GNDA 3M99A 3RTRB 2MD7B 2NAAA 1V87A 2ECWA 3ZTGA 2L80A 3VK6A 4UI9B 4CA1A 4I7CA 5D1LB 2C2LA 4PTBA 2JMJA 1HYIA 2YYRA 4L58A 5LKTA 2K16A 1HYJA 1LDKC 1X4UA 4ZQLA 4GNEA 1Z6UA 2DX8A 2VJEB 4R7EA 4W4UA 3O36A 2CKLA 2YSJA 4O64A 3IHPA 4YAXA 2YREA 5DKAA 3FL2A 2MT5A 2EA6A 2FUUA 4YC9A 2F42A 4I7DA 1LDJB 3N9NA 5FEYA 5KH3A 2K4DA 2L5UA 2H0DB 5B79A 4WA6A 5TABA 1WIMA 2KYUA 4N4FA 2VPGA 3KQIA 3U5OA 3V43A 4FK5A 2YHNA 3NG2A 4Q6FA 2ZETC 4A0CD 4C9ZA 4PPEA 2KR4A 2ECIA 4L7XA 5FB1A 2KWKA 4IC2A 1E4UA 4LK9A 2VNFA 3N9LA 4P5OB 1WFKA 2VJFB 2KU3A 3KNVA 1WEPA 3LQJA 5H1TA 5G0FA 5H1UA 5KH9A 4AYCA 3ZNIA 3O37A 4YABA 3N9MA 3PHDA 3LQHA 5LKUA 1ZBDB 5LKZA 3T7LA 2KGGA 2K17A 5D1MB 2E6SA 4AP4A 3QZVA 2ECTA 3O35A 1JM7A 3N9QA 3ZVYA 2JRJA 4ZUXU 3RPGB 1WEWA 4LKAA 2MD8C 2G45A 4X3GA 4GNFA 3SOXA 2AN6A 2HDPA 3O34A 5C13A 5G04B 2VPDA 5C11A 2L75A 3ZPV1 3HCSA 2YT5A 2LGLA 2KFTA 5TDWA 2CSYA 2RI7A 4YATA 4WZ3B 3U5MA 2LN0A 2IDAA 4LADB 2LGVA 3KV5A 4S3OC 3HCTA 1WEQA 4I7BA 5I3LA 2G6QA 5LKXA 1IYMA 4GNGA 2ECVA 3MHHA 2L43A 1XWHA 3ZPVE 2LGGA 2EGPA 2KWJA 2KWNA 2M6MA 4R8PK 5AITA 2MUMA 2LV9A 3GL6A 5TRBA 2KGIA 2YQLA 2K1JA 2LDRA 3N9OA 4UP5A 2KWOA 2YW8A 4AVXA 1WEVA 5FERA 2D8SA 5FB0A 2QICA 4YBTA 4XI1A 2EODA 4FIPA 3EB5A 4A49A 1WEOA 1F62A 2LXHC 4GB0A 3LQIA 3C6WA 1WGMA 1Z2QA 2YUCA 2KREA 1JOCA 2VP7A 5J3XA 3M63A 2XB1A 2HYED 4V3LC 2Y1MA 5EYAF 1VYXA 2VJEA 3ZYQA 3DPLR 1FP0A 3L11A 2M85A 3DQVR 2L0BA 2Y1NA 3U5PA 2C2VS 3HTKC 5D1KB 3SOUA 2CT2A 2LXPC 3SHBA 1WE9A 1N87A 2YU4A 4YADA 1G25A 5B8DA 4B86C 4FO9A 5TBNA 2MIQA 4AUQB 2YSMA 4NN2A 3HCUA 4YBMA 2H0DA 2CKLB 5B76A 2PNXA 1X4JA 3PURA 3N9PA 3PUQA 2MNZA 4WZ2A 4BBQA 2KIZA 4UP0A 2KE1A 1Z60A 2YHOA 1RMDA 2LQ6A 2MNYA 2UZGA 2FSAA 4MSXA 1VD4A 2QJ0A 2VJFA 4LLBA 4QF3A 2XEUA 5LCWB 1CHCA 2LRIC 5G05B 2I50A 2MA6A 3L1XA 2E6RA 2VPEA 4IC3A 4ZDTA 4MVTA 1T1HA 3U5NA 1DVPA 2YQMA 1WILA 4CCGX 3ZVZB 3SOWA 5B78A 3L1ZB 3I2DA 4AYCB 4B7YC 1U6GB 2BAYA 3EB6A 4WZ0A 2PUYA 4YBSA 3ASLA 2YURA 5DINA 4N3WA 4BHWA 5JG6A 2JMDA 1BORA 2F6NA 5KH7A 3O7AA 1MM3A 3LRQA 2JMIA 1WEEA 1K2FA 2CSZA 4FJCA 2MA5A 4R2YA 5B77A 1MM2A 1JM7B 3RPGC 3KV6A 1WESA 3O33A 3C5KA 4TKPB 2M1RA 2F6JA 2LGKA 4S3OB 2QIZA 3GV4A 3MHSA 1VFYA 5H9MA 2G43A 4F52B 1FBVA 4A4BA 1WENA 4LJNA 5H1VA 2RSDA 5B75A 5TDRA 2M3HA 2ECGA 2ECNA 2FUIA 1X4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WEM A;  3O70 A;  5AIU A;  2VPB A;  3T6R A;  2ECJ A;  4V3K C;  2OXQ C;  4A4C A;  1WEU A;  3M62 A;  4QF2 A;  2Y43 A;  4GND A;  3M99 A;  3RTR B;  2MD7 B;  2NAA A;  1V87 A;  2ECW A;  3ZTG A;  2L80 A;  3VK6 A;  4UI9 B;  4CA1 A;  4I7C A;  5D1L B;  2C2L A;  4PTB A;  2JMJ A;  1HYI A;  2YYR A;  4L58 A;  5LKT A;  2K16 A;  1HYJ A;  1LDK C;  1X4U A;  4ZQL A;  4GNE A;  1Z6U A;  2DX8 A;  2VJE B;  4R7E A;  4W4U A;  3O36 A;  2CKL A;  2YSJ A;  4O64 A;  3IHP A;  4YAX A;  2YRE A;  5DKA A;  3FL2 A;  2MT5 A;  2EA6 A;  2FUU A;  4YC9 A;  2F42 A;  4I7D A;  1LDJ B;  3N9N A;  5FEY A;  5KH3 A;  2K4D A;  2L5U A;  2H0D B;  5B79 A;  4WA6 A;  5TAB A;  1WIM A;  2KYU A;  4N4F A;  2VPG A;  3KQI A;  3U5O A;  3V43 A;  4FK5 A;  2YHN A;  3NG2 A;  4Q6F A;  2ZET C;  4A0C D;  4C9Z A;  4PPE A;  2KR4 A;  2ECI A;  4L7X A;  5FB1 A;  2KWK A;  4IC2 A;  1E4U A;  4LK9 A;  2VNF A;  3N9L A;  4P5O B;  1WFK A;  2VJF B;  2KU3 A;  3KNV A;  1WEP A;  3LQJ A;  5H1T A;  5G0F A;  5H1U A;  5KH9 A;  4AYC A;  3ZNI A;  3O37 A;  4YAB A;  3N9M A;  3PHD A;  3LQH A;  5LKU A;  1ZBD B;  5LKZ A;  3T7L A;  2KGG A;  2K17 A;  5D1M B;  2E6S A;  4AP4 A;  3QZV A;  2ECT A;  3O35 A;  1JM7 A;  3N9Q A;  3ZVY A;  2JRJ A;  4ZUX U;  3RPG B;  1WEW A;  4LKA A;  2MD8 C;  2G45 A;  4X3G A;  4GNF A;  3SOX A;  2AN6 A;  2HDP A;  3O34 A;  5C13 A;  5G04 B;  2VPD A;  5C11 A;  2L75 A;  3ZPV 1;  3HCS A;  2YT5 A;  2LGL A;  2KFT A;  5TDW A;  2CSY A;  2RI7 A;  4YAT A;  4WZ3 B;  3U5M A;  2LN0 A;  2IDA A;  4LAD B;  2LGV A;  3KV5 A;  4S3O C;  3HCT A;  1WEQ A;  4I7B A;  5I3L A;  2G6Q A;  5LKX A;  1IYM A;  4GNG A;  2ECV A;  3MHH A;  2L43 A;  1XWH A;  3ZPV E;  2LGG A;  2EGP A;  2KWJ A;  2KWN A;  2M6M A;  4R8P K;  5AIT A;  2MUM A;  2LV9 A;  3GL6 A;  5TRB A;  2KGI A;  2YQL A;  2K1J A;  2LDR A;  3N9O A;  4UP5 A;  2KWO A;  2YW8 A;  4AVX A;  1WEV A;  5FER A;  2D8S A;  5FB0 A;  2QIC A;  4YBT A;  4XI1 A;  2EOD A;  4FIP A;  3EB5 A;  4A49 A;  1WEO A;  1F62 A;  2LXH C;  4GB0 A;  3LQI A;  3C6W A;  1WGM A;  1Z2Q A;  2YUC A;  2KRE A;  1JOC A;  2VP7 A;  5J3X A;  3M63 A;  2XB1 A;  2HYE D;  4V3L C;  2Y1M A;  5EYA F;  1VYX A;  2VJE A;  3ZYQ A;  3DPL R;  1FP0 A;  3L11 A;  2M85 A;  3DQV R;  2L0B A;  2Y1N A;  3U5P A;  2C2V S;  3HTK C;  5D1K B;  3SOU A;  2CT2 A;  2LXP C;  3SHB A;  1WE9 A;  1N87 A;  2YU4 A;  4YAD A;  1G25 A;  5B8D A;  4B86 C;  4FO9 A;  5TBN A;  2MIQ A;  4AUQ B;  2YSM A;  4NN2 A;  3HCU A;  4YBM A;  2H0D A;  2CKL B;  5B76 A;  2PNX A;  1X4J A;  3PUR A;  3N9P A;  3PUQ A;  2MNZ A;  4WZ2 A;  4BBQ A;  2KIZ A;  4UP0 A;  2KE1 A;  1Z60 A;  2YHO A;  1RMD A;  2LQ6 A;  2MNY A;  2UZG A;  2FSA A;  4MSX A;  1VD4 A;  2QJ0 A;  2VJF A;  4LLB A;  4QF3 A;  2XEU A;  5LCW B;  1CHC A;  2LRI C;  5G05 B;  2I50 A;  2MA6 A;  3L1X A;  2E6R A;  2VPE A;  4IC3 A;  4ZDT A;  4MVT A;  1T1H A;  3U5N A;  1DVP A;  2YQM A;  1WIL A;  4CCG X;  3ZVZ B;  3SOW A;  5B78 A;  3L1Z B;  3I2D A;  4AYC B;  4B7Y C;  1U6G B;  2BAY A;  3EB6 A;  4WZ0 A;  2PUY A;  4YBS A;  3ASL A;  2YUR A;  5DIN A;  4N3W A;  4BHW A;  5JG6 A;  2JMD A;  1BOR A;  2F6N A;  5KH7 A;  3O7A A;  1MM3 A;  3LRQ A;  2JMI A;  1WEE A;  1K2F A;  2CSZ A;  4FJC A;  2MA5 A;  4R2Y A;  5B77 A;  1MM2 A;  1JM7 B;  3RPG C;  3KV6 A;  1WES A;  3O33 A;  3C5K A;  4TKP B;  2M1R A;  2F6J A;  2LGK A;  4S3O B;  2QIZ A;  3GV4 A;  3MHS A;  1VFY A;  5H9M A;  2G43 A;  4F52 B;  1FBV A;  4A4B A;  1WEN A;  4LJN A;  5H1V A;  2RSD A;  5B75 A;  5TDR A;  2M3H A;  2ECG A;  2ECN A;  2FUI A;  1X4I A; 
#chains in the Genus database with same CATH topology
 1WEM A;  3O70 A;  5AIU A;  2OWA A;  2VPB A;  3T6R A;  2ECJ A;  4V3K C;  2OXQ C;  4A4C A;  1WEU A;  3M62 A;  4QF2 A;  2Y43 A;  4GND A;  3M99 A;  3RTR B;  2MD7 B;  2NAA A;  1V87 A;  2ECW A;  3ZTG A;  2L80 A;  3VK6 A;  2D8U A;  4UI9 B;  4CA1 A;  4I7C A;  5D1L B;  2C2L A;  4PTB A;  2JMJ A;  1HYI A;  2YYR A;  4L58 A;  3O47 A;  2YVR A;  5LKT A;  2K16 A;  1HYJ A;  1LDK C;  1X4U A;  4ZQL A;  4GNE A;  1Z6U A;  2DX8 A;  2VJE B;  4R7E A;  4W4U A;  3O36 A;  2CKL A;  3LVQ E;  2YSJ A;  4O64 A;  3IHP A;  4YAX A;  2YRE A;  5DKA A;  3FAN A;  4H9D A;  3FL2 A;  3SUB A;  2MT5 A;  2EA6 A;  4Z0R A;  2FUU A;  4YC9 A;  5SVY A;  5SVI A;  2F42 A;  4I7D A;  5SVX A;  1LDJ B;  3N9N A;  5FEY A;  5KH3 A;  2K4D A;  2L5U A;  2H0D B;  5B79 A;  4WA6 A;  5TAB A;  1WIM A;  2KYU A;  4N4F A;  2VPG A;  3KQI A;  3U5O A;  3V43 A;  3M7K A;  4FK5 A;  2YHN A;  3NG2 A;  4Q6F A;  2ZET C;  4A0C D;  4C9Z A;  4PPE A;  3KDE C;  2KR4 A;  2ECI A;  3FEH A;  4L7X A;  2XOZ A;  5FB1 A;  2KKY A;  2KWK A;  4IC2 A;  1E4U A;  5K3Q A;  4LK9 A;  3MDB C;  2VNF A;  3N9L A;  4P5O B;  1WFK A;  2VJF B;  2KU3 A;  3KNV A;  1WEP A;  3LQJ A;  5H1T A;  5G0F A;  5H1U A;  5KH9 A;  4AYC A;  3ZNI A;  3FAO A;  3O37 A;  4YAB A;  3Q1D A;  2EGM A;  3N9M A;  2EXU A;  2IQJ A;  3PHD A;  3LQH A;  5LKU A;  1ZBD B;  5LKZ A;  3T7L A;  2KGG A;  2K17 A;  5D1M B;  2E6S A;  4AP4 A;  4O62 A;  3QZV A;  2LAU A;  2ECT A;  3O35 A;  1JM7 A;  3N9Q A;  3T9K A;  3ZVY A;  2JRJ A;  4ZUX U;  3RPG B;  1WEW A;  4LKA A;  2MD8 C;  2G45 A;  4X3G A;  4GNF A;  3SOX A;  2AN6 A;  2HDP A;  3O34 A;  5C13 A;  5G04 B;  2VPD A;  5C11 A;  2L75 A;  3ZPV 1;  3HCS A;  2YT5 A;  2LGL A;  4OGC A;  2KFT A;  2XOC A;  5TDW A;  3PLW A;  2CSY A;  2RI7 A;  4YAT A;  4WZ3 B;  3U5M A;  2LN0 A;  3FM8 C;  2KKX A;  2IDA A;  4LAD B;  2LGV A;  3KV5 A;  2CRR A;  3HCT A;  1WEQ A;  4I7B A;  4S3O C;  2G6Q A;  5I3L A;  5LKX A;  1IYM A;  4GNG A;  2ECV A;  3MHH A;  2L43 A;  1XWH A;  3LDY A;  3ZPV E;  2LGG A;  2EGP A;  2KWJ A;  2KWN A;  2M6M A;  4R8P K;  5AIT A;  2MUM A;  2LV9 A;  3GL6 A;  5TRB A;  2KGI A;  2YQL A;  2K1J A;  2LDR A;  3N9O A;  2CRW A;  4UP5 A;  2KWO A;  2YW8 A;  4AVX A;  1WEV A;  5FER A;  2D8S A;  5FB0 A;  2QIC A;  4YBT A;  4XI1 A;  2EOD A;  4FIP A;  2CSV A;  3EB5 A;  4A49 A;  1WEO A;  1F62 A;  2LXH C;  4GB0 A;  3LQI A;  3C6W A;  1WGM A;  2CON A;  1Z2Q A;  2YUC A;  2KRE A;  1JOC A;  2VP7 A;  1DCQ A;  5J3X A;  3M63 A;  2XB1 A;  2HYE D;  4V3L C;  2Y1M A;  5EYA F;  1VYX A;  2VJE A;  3ZYQ A;  3DPL R;  1FP0 A;  3L11 A;  2M85 A;  3DQV R;  2L0B A;  2Y1N A;  3U5P A;  2C2V S;  3HTK C;  5D1K B;  3SOU A;  2CT2 A;  2LXP C;  3JUE A;  1WE9 A;  3SHB A;  1N87 A;  2YU4 A;  4YAD A;  1G25 A;  5B8D A;  4B86 C;  4FO9 A;  5TBN A;  2MIQ A;  4AUQ B;  2YSM A;  4NN2 A;  3HCU A;  4YBM A;  2H0D A;  2CKL B;  5B76 A;  2PNX A;  1X4J A;  3PUR A;  3N9P A;  3PUQ A;  2MNZ A;  4WZ2 A;  4BBQ A;  2KIZ A;  3LVR E;  4UP0 A;  2KE1 A;  1Z60 A;  2YHO A;  1RMD A;  2LQ6 A;  5SVI B;  2B0O E;  2MNY A;  2UZG A;  2FSA A;  2M13 A;  2DSM A;  4MSX A;  1VD4 A;  2QJ0 A;  2VJF A;  4LLB A;  2XOY A;  2XEU A;  4QF3 A;  1MBM A;  5LCW B;  1CHC A;  2LRI C;  2JUN A;  5G05 B;  2I50 A;  2MA6 A;  3L1X A;  2E6R A;  2L7P A;  2VPE A;  4IC3 A;  4ZDT A;  4MVT A;  1T1H A;  3U5N A;  1DVP A;  2YQM A;  1WIL A;  4CCG X;  2FFW A;  3ZVZ B;  2E61 A;  3SOW A;  5B78 A;  3DWD A;  3FJU B;  3L1Z B;  3I2D A;  4AYC B;  4B7Y C;  1U6G B;  2BAY A;  4Z0O A;  2FD4 A;  3EB6 A;  4WZ0 A;  2PUY A;  2P57 A;  4YBS A;  2JM3 A;  3E2D A;  3ASL A;  2YUR A;  3DDT A;  5DIN A;  4N3W A;  4BHW A;  5JG6 A;  2JMD A;  1BOR A;  2F6N A;  5KH7 A;  3O7A A;  1MM3 A;  3LRQ A;  2JMI A;  1WEE A;  3LJU X;  1K2F A;  2CSZ A;  4FJC A;  2MA5 A;  4OGE A;  4R2Y A;  5B77 A;  1MM2 A;  1JM7 B;  3RPG C;  2DJA A;  3KV6 A;  1WES A;  3H7H A;  4F1P A;  3O33 A;  3C5K A;  4TKP B;  2M1R A;  2F6J A;  2LGK A;  4S3O B;  4QQ4 A;  2QIZ A;  2MKE A;  3GV4 A;  3MHS A;  1VFY A;  5H9M A;  2G43 A;  4F52 B;  1FBV A;  2RR4 A;  4A4B A;  1WEN A;  4LJN A;  5H1V A;  2RSD A;  5B75 A;  2XP0 A;  5TDR A;  2M3H A;  2ECG A;  2ECN A;  2FUI A;  1X4I A; 
#chains in the Genus database with same CATH homology
 1WEM A;  3O70 A;  5AIU A;  2VPB A;  3T6R A;  2ECJ A;  4V3K C;  2OXQ C;  4A4C A;  1WEU A;  3M62 A;  4QF2 A;  2Y43 A;  4GND A;  3M99 A;  3RTR B;  2MD7 B;  2NAA A;  1V87 A;  2ECW A;  3ZTG A;  2L80 A;  3VK6 A;  4UI9 B;  4CA1 A;  4I7C A;  5D1L B;  2C2L A;  4PTB A;  2JMJ A;  1HYI A;  2YYR A;  4L58 A;  5LKT A;  2K16 A;  1HYJ A;  1LDK C;  1X4U A;  4ZQL A;  4GNE A;  1Z6U A;  2DX8 A;  2VJE B;  4R7E A;  4W4U A;  3O36 A;  2CKL A;  2YSJ A;  4O64 A;  3IHP A;  4YAX A;  2YRE A;  5DKA A;  3FL2 A;  2MT5 A;  2EA6 A;  2FUU A;  4YC9 A;  2F42 A;  4I7D A;  1LDJ B;  3N9N A;  5FEY A;  5KH3 A;  2K4D A;  2L5U A;  2H0D B;  5B79 A;  4WA6 A;  5TAB A;  1WIM A;  2KYU A;  4N4F A;  2VPG A;  3KQI A;  3U5O A;  3V43 A;  4FK5 A;  2YHN A;  3NG2 A;  4Q6F A;  2ZET C;  4A0C D;  4C9Z A;  4PPE A;  2KR4 A;  2ECI A;  4L7X A;  5FB1 A;  2KWK A;  4IC2 A;  1E4U A;  4LK9 A;  2VNF A;  3N9L A;  4P5O B;  1WFK A;  2VJF B;  2KU3 A;  3KNV A;  1WEP A;  3LQJ A;  5H1T A;  5G0F A;  5H1U A;  5KH9 A;  4AYC A;  3ZNI A;  3O37 A;  4YAB A;  3N9M A;  3PHD A;  3LQH A;  5LKU A;  1ZBD B;  5LKZ A;  3T7L A;  2KGG A;  2K17 A;  5D1M B;  2E6S A;  4AP4 A;  3QZV A;  2ECT A;  3O35 A;  1JM7 A;  3N9Q A;  3ZVY A;  2JRJ A;  4ZUX U;  3RPG B;  1WEW A;  4LKA A;  2MD8 C;  2G45 A;  4X3G A;  4GNF A;  3SOX A;  2AN6 A;  2HDP A;  3O34 A;  5C13 A;  5G04 B;  2VPD A;  5C11 A;  2L75 A;  3ZPV 1;  3HCS A;  2YT5 A;  2LGL A;  2KFT A;  5TDW A;  2CSY A;  2RI7 A;  4YAT A;  4WZ3 B;  3U5M A;  2LN0 A;  2IDA A;  4LAD B;  2LGV A;  3KV5 A;  4S3O C;  3HCT A;  1WEQ A;  4I7B A;  5I3L A;  2G6Q A;  5LKX A;  1IYM A;  4GNG A;  2ECV A;  3MHH A;  2L43 A;  1XWH A;  3ZPV E;  2LGG A;  2EGP A;  2KWJ A;  2KWN A;  2M6M A;  4R8P K;  5AIT A;  2MUM A;  2LV9 A;  3GL6 A;  5TRB A;  2KGI A;  2YQL A;  2K1J A;  2LDR A;  3N9O A;  4UP5 A;  2KWO A;  2YW8 A;  4AVX A;  1WEV A;  5FER A;  2D8S A;  5FB0 A;  2QIC A;  4YBT A;  4XI1 A;  2EOD A;  4FIP A;  3EB5 A;  4A49 A;  1WEO A;  1F62 A;  2LXH C;  4GB0 A;  3LQI A;  3C6W A;  1WGM A;  1Z2Q A;  2YUC A;  2KRE A;  1JOC A;  2VP7 A;  5J3X A;  3M63 A;  2XB1 A;  2HYE D;  4V3L C;  2Y1M A;  5EYA F;  1VYX A;  2VJE A;  3ZYQ A;  3DPL R;  1FP0 A;  3L11 A;  2M85 A;  3DQV R;  2L0B A;  2Y1N A;  3U5P A;  2C2V S;  3HTK C;  5D1K B;  3SOU A;  2CT2 A;  2LXP C;  3SHB A;  1WE9 A;  1N87 A;  2YU4 A;  4YAD A;  1G25 A;  5B8D A;  4B86 C;  4FO9 A;  5TBN A;  2MIQ A;  4AUQ B;  2YSM A;  4NN2 A;  3HCU A;  4YBM A;  2H0D A;  2CKL B;  5B76 A;  2PNX A;  1X4J A;  3PUR A;  3N9P A;  3PUQ A;  2MNZ A;  4WZ2 A;  4BBQ A;  2KIZ A;  4UP0 A;  2KE1 A;  1Z60 A;  2YHO A;  1RMD A;  2LQ6 A;  2MNY A;  2UZG A;  2FSA A;  4MSX A;  1VD4 A;  2QJ0 A;  2VJF A;  4LLB A;  4QF3 A;  2XEU A;  5LCW B;  1CHC A;  2LRI C;  5G05 B;  2I50 A;  2MA6 A;  3L1X A;  2E6R A;  2VPE A;  4IC3 A;  4ZDT A;  4MVT A;  1T1H A;  3U5N A;  1DVP A;  2YQM A;  1WIL A;  4CCG X;  3ZVZ B;  3SOW A;  5B78 A;  3L1Z B;  3I2D A;  4AYC B;  4B7Y C;  1U6G B;  2BAY A;  3EB6 A;  4WZ0 A;  2PUY A;  4YBS A;  3ASL A;  2YUR A;  5DIN A;  4N3W A;  4BHW A;  5JG6 A;  2JMD A;  1BOR A;  2F6N A;  5KH7 A;  3O7A A;  1MM3 A;  3LRQ A;  2JMI A;  1WEE A;  1K2F A;  2CSZ A;  4FJC A;  2MA5 A;  4R2Y A;  5B77 A;  1MM2 A;  1JM7 B;  3RPG C;  3KV6 A;  1WES A;  3O33 A;  3C5K A;  4TKP B;  2M1R A;  2F6J A;  2LGK A;  4S3O B;  2QIZ A;  3GV4 A;  3MHS A;  1VFY A;  5H9M A;  2G43 A;  4F52 B;  1FBV A;  4A4B A;  1WEN A;  4LJN A;  5H1V A;  2RSD A;  5B75 A;  5TDR A;  2M3H A;  2ECG A;  2ECN A;  2FUI A;  1X4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...