1WEMA

Solution structure of phd domain in death inducer-obliterator 1(dio-1)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
76
structure length
76
Chain Sequence
b'GSSGSSGECEVYDPNALYCICRQPHNNRFMICCDRCEEWFHGDCVGISEARGRLLERNGEDYICPNCTILSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Death associated transcription factor 1
publication title Solution structure of PHD domain in death inducer-obliterator 1(DIO-1)
rcsb
source organism Mus musculus
molecule tags Dna binding protein
total genus 10
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2004-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1wemA00
3I2DA 3KV5A 1MM3A 3O36A 2DX8A 2FUUA 1JOCA 2ECIA 2ECGA 5TDRA 3PURA 2G6QA 1LDKC 2VPBA 4UP0A 4LJNA 1VYXA 5KH3A 1WEOA 2VJEB 5B76A 2ECNA 4B7YC 4GB0A 3RPGB 4CA1A 1WEPA 5LKUA 5D1MB 4TKPB 2VP7A 1F62A 2OXQC 4O64A 4YATA 4LLBA 3NG2A 2LN0A 1FBVA 2G45A 2JMDA 4I7BA 4I7CA 3N9MA 5J3XA 2QIZA 3DPLR 1G25A 3PUQA 3N9PA 5DINA 1LDJB 4CCGX 5H1UA 4FO9A 2Y43A 3RTRB 3C6WA 2E6RA 5TDWA 3N9NA 4WZ0A 4A0CD 5TBNA 3M99A 2LGLA 3L1ZB 3QZVA 2KWJA 1CHCA 4YABA 2NAAA 3C5KA 4Q6FA 4FK5A 4X3GA 2C2VS 2YQLA 3ZNIA 5DKAA 1U6GB 2MA5A 5B79A 2ZETC 2LGKA 3M63A 4A4CA 2E6SA 5B75A 4C9ZA 2D8SA 2MT5A 3O35A 3V43A 2L43A 1JM7A 5KH9A 5LKZA 5D1LB 1XWHA 2RSDA 2VJFB 2JMIA 1FP0A 2YREA 2CKLB 1WEQA 2YSJA 2KWNA 1ZBDB 3KV6A 2MD8C 4IC3A 2H0DB 2QJ0A 5I3LA 2YW8A 3EB6A 1WEMA 2ECTA 5LKTA 3ZPVE 1WENA 2UZGA 5EYAF 2ECJA 3U5NA 2FSAA 3KQIA 2L75A 3MHHA 2XB1A 4QF2A 2CSYA 2KGIA 3O70A 3O34A 2F42A 4A4BA 4AP4A 4YBTA 2YHNA 1IYMA 4AYCB 4V3KC 4L58A 3RPGC 3ZTGA 3LQJA 2M6MA 5G04B 2MNYA 4NN2A 5H1VA 1WE9A 2H0DA 1V87A 4WA6A 2C2LA 2HYED 3LQHA 3O37A 5FB1A 1Z6UA 2YURA 3KNVA 2CT2A 5AITA 2KR4A 4F52B 4BHWA 3SOXA 4PPEA 1WESA 2KGGA 2KIZA 2JRJA 3FL2A 1X4UA 2LXPC 4AUQB 5FB0A 2KU3A 3HCSA 2JMJA 1MM2A 4UI9B 2FUIA 2VJEA 4R2YA 4WZ3B 2M85A 2EODA 3L11A 4W4UA 3T7LA 3IHPA 2F6JA 2KE1A 4WZ2A 2KFTA 1K2FA 4GNFA 1DVPA 5AIUA 1E4UA 5TABA 3ZVZB 3EB5A 3HCUA 2RI7A 2LGGA 4GNGA 1WGMA 3U5PA 3SHBA 2LDRA 3ZVYA 2G43A 5H9MA 2MA6A 2K17A 2VPEA 2M1RA 5C11A 2KWKA 2MNZA 4IC2A 1RMDA 3PHDA 2K16A 3ZPV1 4GNDA 4ZDTA 2Y1NA 3ASLA 4V3LC 1WEUA 3MHSA 4LKAA 1Z2QA 4S3OC 1HYJA 2KYUA 4GNEA 4YADA 4BBQA 4S3OB 5C13A 4MVTA 5FERA 1WEWA 2KWOA 2ECVA 3U5OA 5KH7A 1BORA 5TRBA 2MIQA 4A49A 2VJFA 2L80A 4ZQLA 4UP5A 2CKLA 5B8DA 4R8PK 3N9LA 4MSXA 3LRQA 4YBMA 3O33A 4XI1A 4FJCA 2F6NA 5LCWB 2ECWA 1VD4A 1WIMA 2EA6A 3HTKC 3DQVR 2MUMA 3L1XA 2AN6A 3SOUA 2KREA 5JG6A 2LV9A 4AYCA 5FEYA 4QF3A 2LRIC 1JM7B 3ZYQA 2LQ6A 2Y1MA 4FIPA 3T6RA 5LKXA 2PNXA 2VPGA 4YC9A 1WEVA 3O7AA 2HDPA 3SOWA 1WEEA 2EGPA 2YUCA 4LADB 3N9QA 2VPDA 1HYIA 5G0FA 2YSMA 4ZUXU 1X4JA 5B78A 2BAYA 1X4IA 3HCTA 4I7DA 2K4DA 1N87A 4N3WA 2L5UA 2YT5A 2IDAA 2LGVA 2QICA 1T1HA 4LK9A 1Z60A 2CSZA 3M62A 2YU4A 2LXHC 4N4FA 1VFYA 2VNFA 2YQMA 5D1KB 2L0BA 4P5OB 4B86C 3N9OA 5B77A 4L7XA 3VK6A 2XEUA 5G05B 2YYRA 4AVXA 2PUYA 1WFKA 2K1JA 4PTBA 2M3HA 4R7EA 2MD7B 3GL6A 4YAXA 3LQIA 2YHOA 4YBSA 2I50A 3U5MA 5H1TA 1WILA 3GV4A
chains in the Genus database with same CATH superfamily
3I2DA 3KV5A 1MM3A 3O36A 2DX8A 2FUUA 1JOCA 2ECIA 3E2DA 2ECGA 2XOYA 5TDRA 3PURA 2G6QA 1LDKC 2VPBA 2IQJA 4LJNA 4UP0A 1VYXA 5KH3A 1WEOA 2VJEB 5B76A 2ECNA 4B7YC 4GB0A 3RPGB 4CA1A 1WEPA 5LKUA 5D1MB 4TKPB 2VP7A 1F62A 2OXQC 4O64A 4YATA 4LLBA 3NG2A 2LN0A 1FBVA 2YVRA 2G45A 2JMDA 4I7BA 4I7CA 5SVXA 3N9MA 5J3XA 2QIZA 3DPLR 1G25A 3PUQA 3N9PA 5DINA 1LDJB 4CCGX 5SVIB 5H1UA 4FO9A 2KKXA 2Y43A 3RTRB 3C6WA 2E6RA 5TDWA 2EGMA 2JUNA 3N9NA 3O47A 4WZ0A 4A0CD 5TBNA 2EXUA 2B0OE 3M99A 2LGLA 3QZVA 3L1ZB 2KWJA 1CHCA 4YABA 2NAAA 3LVQE 3C5KA 4OGCA 4Q6FA 4FK5A 4X3GA 2C2VS 2YQLA 3ZNIA 5DKAA 1U6GB 2MA5A 5B79A 2L7PA 2ZETC 2LGKA 3M63A 4A4CA 2E6SA 5B75A 4O62A 4C9ZA 2DJAA 2D8SA 2MT5A 3O35A 3V43A 2L43A 1JM7A 3FJUB 2OWAA 4Z0OA 5SVIA 2CSVA 5KH9A 5LKZA 5D1LB 1XWHA 2RSDA 3FANA 2VJFB 2JMIA 1FP0A 2P57A 2YREA 2CKLB 1WEQA 2YSJA 2KWNA 1ZBDB 3KV6A 2MD8C 4IC3A 2H0DB 2QJ0A 3LJUX 2FD4A 2YW8A 3EB6A 5I3LA 1WEMA 2ECTA 5LKTA 3ZPVE 1WENA 2UZGA 5EYAF 2ECJA 3U5NA 2FSAA 3KQIA 2L75A 3MHHA 2XB1A 4QF2A 2CSYA 2KGIA 3O70A 3O34A 2F42A 4A4BA 4AP4A 2CRWA 4YBTA 2YHNA 1IYMA 4AYCB 3Q1DA 2XOCA 4V3KC 4QQ4A 4L58A 3DWDA 3RPGC 4Z0RA 3ZTGA 3LQJA 2M6MA 4F1PA 5G04B 2MNYA 4NN2A 5H1VA 1WE9A 2H0DA 1V87A 4WA6A 2C2LA 2HYED 3LQHA 3O37A 5FB1A 1Z6UA 2YURA 2E61A 3KNVA 3PLWA 2CT2A 1DCQA 2JM3A 5AITA 2KR4A 4F52B 4BHWA 3SOXA 3T9KA 4PPEA 3FM8C 1WESA 2KGGA 2KIZA 2JRJA 3FL2A 1X4UA 2LXPC 4AUQB 3KDEC 5FB0A 2KU3A 3HCSA 2JMJA 1MM2A 4UI9B 2FUIA 2VJEA 3MDBC 4R2YA 4WZ3B 2M85A 2EODA 3L11A 5SVYA 4W4UA 2CONA 3T7LA 3IHPA 2F6JA 2KE1A 4WZ2A 2KFTA 1K2FA 4GNFA 1DVPA 5AIUA 1E4UA 5TABA 2XP0A 3ZVZB 3EB5A 2D8UA 3HCUA 2RI7A 2LGGA 4GNGA 1WGMA 3U5PA 3SHBA 2LDRA 3ZVYA 2G43A 5H9MA 2MA6A 2K17A 2VPEA 2M1RA 5C11A 2KWKA 2DSMA 2MNZA 4IC2A 1RMDA 3PHDA 2K16A 3ZPV1 4GNDA 4ZDTA 2Y1NA 2XOZA 3ASLA 4V3LC 1WEUA 3MHSA 4LKAA 1Z2QA 4OGEA 4S3OC 1HYJA 2KYUA 4GNEA 3FEHA 4YADA 4BBQA 4S3OB 5C13A 4MVTA 5FERA 1WEWA 2KWOA 2ECVA 3U5OA 5KH7A 1BORA 5TRBA 2MIQA 4A49A 2VJFA 2L80A 2M13A 4ZQLA 4UP5A 2CKLA 5B8DA 4R8PK 3N9LA 4MSXA 3LRQA 4YBMA 3O33A 2MKEA 4XI1A 4FJCA 2F6NA 5LCWB 2ECWA 1VD4A 2KKYA 1WIMA 2EA6A 3HTKC 3DQVR 2MUMA 3JUEA 3L1XA 2AN6A 3M7KA 3SOUA 2KREA 5JG6A 2LV9A 4AYCA 5FEYA 4QF3A 2LRIC 1JM7B 2FFWA 2LQ6A 2LAUA 2Y1MA 3ZYQA 4FIPA 3SUBA 3T6RA 5LKXA 2PNXA 2VPGA 4YC9A 1WEVA 3O7AA 2HDPA 3SOWA 1WEEA 2EGPA 2YUCA 4LADB 3N9QA 2VPDA 1HYIA 5G0FA 2YSMA 4ZUXU 1X4JA 2RR4A 5B78A 2BAYA 1X4IA 3HCTA 4I7DA 3H7HA 2K4DA 1N87A 4N3WA 2L5UA 2YT5A 2IDAA 2LGVA 1MBMA 2QICA 3DDTA 1T1HA 4LK9A 1Z60A 2CSZA 3M62A 2YU4A 2LXHC 4N4FA 3LDYA 1VFYA 2VNFA 2YQMA 5D1KB 2L0BA 2CRRA 4P5OB 4B86C 4H9DA 3N9OA 5K3QA 5B77A 4L7XA 3VK6A 2XEUA 5G05B 2YYRA 4AVXA 2PUYA 1WFKA 2K1JA 4PTBA 2M3HA 4R7EA 2MD7B 3GL6A 3FAOA 3LVRE 4YAXA 3LQIA 2YHOA 4YBSA 2I50A 3U5MA 5H1TA 1WILA 3GV4A
chains in the Genus database with same CATH topology
3I2DA 3KV5A 1MM3A 3O36A 2DX8A 2FUUA 1JOCA 2ECIA 2ECGA 5TDRA 3PURA 2G6QA 1LDKC 2VPBA 4UP0A 4LJNA 1VYXA 5KH3A 1WEOA 2VJEB 5B76A 2ECNA 4B7YC 4GB0A 3RPGB 4CA1A 1WEPA 5LKUA 5D1MB 4TKPB 2VP7A 1F62A 2OXQC 4O64A 4YATA 4LLBA 3NG2A 2LN0A 1FBVA 2G45A 2JMDA 4I7BA 4I7CA 3N9MA 5J3XA 2QIZA 3DPLR 1G25A 3PUQA 3N9PA 5DINA 1LDJB 4CCGX 5H1UA 4FO9A 2Y43A 3RTRB 3C6WA 2E6RA 5TDWA 3N9NA 4WZ0A 4A0CD 5TBNA 3M99A 2LGLA 3L1ZB 3QZVA 2KWJA 1CHCA 4YABA 2NAAA 3C5KA 4Q6FA 4FK5A 4X3GA 2C2VS 2YQLA 3ZNIA 5DKAA 1U6GB 2MA5A 5B79A 2ZETC 2LGKA 3M63A 4A4CA 2E6SA 5B75A 4C9ZA 2D8SA 2MT5A 3O35A 3V43A 2L43A 1JM7A 5KH9A 5LKZA 5D1LB 1XWHA 2RSDA 2VJFB 2JMIA 1FP0A 2YREA 2CKLB 1WEQA 2YSJA 2KWNA 1ZBDB 3KV6A 2MD8C 4IC3A 2H0DB 2QJ0A 5I3LA 2YW8A 3EB6A 1WEMA 2ECTA 5LKTA 3ZPVE 1WENA 2UZGA 5EYAF 2ECJA 3U5NA 2FSAA 3KQIA 2L75A 3MHHA 2XB1A 4QF2A 2CSYA 2KGIA 3O70A 3O34A 2F42A 4A4BA 4AP4A 4YBTA 2YHNA 1IYMA 4AYCB 4V3KC 4L58A 3RPGC 3ZTGA 3LQJA 2M6MA 5G04B 2MNYA 4NN2A 5H1VA 1WE9A 2H0DA 1V87A 4WA6A 2C2LA 2HYED 3LQHA 3O37A 5FB1A 1Z6UA 2YURA 3KNVA 2CT2A 5AITA 2KR4A 4F52B 4BHWA 3SOXA 4PPEA 1WESA 2KGGA 2KIZA 2JRJA 3FL2A 1X4UA 2LXPC 4AUQB 5FB0A 2KU3A 3HCSA 2JMJA 1MM2A 4UI9B 2FUIA 2VJEA 4R2YA 4WZ3B 2M85A 2EODA 3L11A 4W4UA 3T7LA 3IHPA 2F6JA 2KE1A 4WZ2A 2KFTA 1K2FA 4GNFA 1DVPA 5AIUA 1E4UA 5TABA 3ZVZB 3EB5A 3HCUA 2RI7A 2LGGA 4GNGA 1WGMA 3U5PA 3SHBA 2LDRA 3ZVYA 2G43A 5H9MA 2MA6A 2K17A 2VPEA 2M1RA 5C11A 2KWKA 2MNZA 4IC2A 1RMDA 3PHDA 2K16A 3ZPV1 4GNDA 4ZDTA 2Y1NA 3ASLA 4V3LC 1WEUA 3MHSA 4LKAA 1Z2QA 4S3OC 1HYJA 2KYUA 4GNEA 4YADA 4BBQA 4S3OB 5C13A 4MVTA 5FERA 1WEWA 2KWOA 2ECVA 3U5OA 5KH7A 1BORA 5TRBA 2MIQA 4A49A 2VJFA 2L80A 4ZQLA 4UP5A 2CKLA 5B8DA 4R8PK 3N9LA 4MSXA 3LRQA 4YBMA 3O33A 4XI1A 4FJCA 2F6NA 5LCWB 2ECWA 1VD4A 1WIMA 2EA6A 3HTKC 3DQVR 2MUMA 3L1XA 2AN6A 3SOUA 2KREA 5JG6A 2LV9A 4AYCA 5FEYA 4QF3A 2LRIC 1JM7B 3ZYQA 2LQ6A 2Y1MA 4FIPA 3T6RA 5LKXA 2PNXA 2VPGA 4YC9A 1WEVA 3O7AA 2HDPA 3SOWA 1WEEA 2EGPA 2YUCA 4LADB 3N9QA 2VPDA 1HYIA 5G0FA 2YSMA 4ZUXU 1X4JA 5B78A 2BAYA 1X4IA 3HCTA 4I7DA 2K4DA 1N87A 4N3WA 2L5UA 2YT5A 2IDAA 2LGVA 2QICA 1T1HA 4LK9A 1Z60A 2CSZA 3M62A 2YU4A 2LXHC 4N4FA 1VFYA 2VNFA 2YQMA 5D1KB 2L0BA 4P5OB 4B86C 3N9OA 5B77A 4L7XA 3VK6A 2XEUA 5G05B 2YYRA 4AVXA 2PUYA 1WFKA 2K1JA 4PTBA 2M3HA 4R7EA 2MD7B 3GL6A 4YAXA 3LQIA 2YHOA 4YBSA 2I50A 3U5MA 5H1TA 1WILA 3GV4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I2D A;  3KV5 A;  1MM3 A;  3O36 A;  2DX8 A;  2FUU A;  1JOC A;  2ECI A;  2ECG A;  5TDR A;  3PUR A;  2G6Q A;  1LDK C;  2VPB A;  4UP0 A;  4LJN A;  1VYX A;  5KH3 A;  1WEO A;  2VJE B;  5B76 A;  2ECN A;  4B7Y C;  4GB0 A;  3RPG B;  4CA1 A;  1WEP A;  5LKU A;  5D1M B;  4TKP B;  2VP7 A;  1F62 A;  2OXQ C;  4O64 A;  4YAT A;  4LLB A;  3NG2 A;  2LN0 A;  1FBV A;  2G45 A;  2JMD A;  4I7B A;  4I7C A;  3N9M A;  5J3X A;  2QIZ A;  3DPL R;  1G25 A;  3PUQ A;  3N9P A;  5DIN A;  1LDJ B;  4CCG X;  5H1U A;  4FO9 A;  2Y43 A;  3RTR B;  3C6W A;  2E6R A;  5TDW A;  3N9N A;  4WZ0 A;  4A0C D;  5TBN A;  3M99 A;  2LGL A;  3L1Z B;  3QZV A;  2KWJ A;  1CHC A;  4YAB A;  2NAA A;  3C5K A;  4Q6F A;  4FK5 A;  4X3G A;  2C2V S;  2YQL A;  3ZNI A;  5DKA A;  1U6G B;  2MA5 A;  5B79 A;  2ZET C;  2LGK A;  3M63 A;  4A4C A;  2E6S A;  5B75 A;  4C9Z A;  2D8S A;  2MT5 A;  3O35 A;  3V43 A;  2L43 A;  1JM7 A;  5KH9 A;  5LKZ A;  5D1L B;  1XWH A;  2RSD A;  2VJF B;  2JMI A;  1FP0 A;  2YRE A;  2CKL B;  1WEQ A;  2YSJ A;  2KWN A;  1ZBD B;  3KV6 A;  2MD8 C;  4IC3 A;  2H0D B;  2QJ0 A;  5I3L A;  2YW8 A;  3EB6 A;  1WEM A;  2ECT A;  5LKT A;  3ZPV E;  1WEN A;  2UZG A;  5EYA F;  2ECJ A;  3U5N A;  2FSA A;  3KQI A;  2L75 A;  3MHH A;  2XB1 A;  4QF2 A;  2CSY A;  2KGI A;  3O70 A;  3O34 A;  2F42 A;  4A4B A;  4AP4 A;  4YBT A;  2YHN A;  1IYM A;  4AYC B;  4V3K C;  4L58 A;  3RPG C;  3ZTG A;  3LQJ A;  2M6M A;  5G04 B;  2MNY A;  4NN2 A;  5H1V A;  1WE9 A;  2H0D A;  1V87 A;  4WA6 A;  2C2L A;  2HYE D;  3LQH A;  3O37 A;  5FB1 A;  1Z6U A;  2YUR A;  3KNV A;  2CT2 A;  5AIT A;  2KR4 A;  4F52 B;  4BHW A;  3SOX A;  4PPE A;  1WES A;  2KGG A;  2KIZ A;  2JRJ A;  3FL2 A;  1X4U A;  2LXP C;  4AUQ B;  5FB0 A;  2KU3 A;  3HCS A;  2JMJ A;  1MM2 A;  4UI9 B;  2FUI A;  2VJE A;  4R2Y A;  4WZ3 B;  2M85 A;  2EOD A;  3L11 A;  4W4U A;  3T7L A;  3IHP A;  2F6J A;  2KE1 A;  4WZ2 A;  2KFT A;  1K2F A;  4GNF A;  1DVP A;  5AIU A;  1E4U A;  5TAB A;  3ZVZ B;  3EB5 A;  3HCU A;  2RI7 A;  2LGG A;  4GNG A;  1WGM A;  3U5P A;  3SHB A;  2LDR A;  3ZVY A;  2G43 A;  5H9M A;  2MA6 A;  2K17 A;  2VPE A;  2M1R A;  5C11 A;  2KWK A;  2MNZ A;  4IC2 A;  1RMD A;  3PHD A;  2K16 A;  3ZPV 1;  4GND A;  4ZDT A;  2Y1N A;  3ASL A;  4V3L C;  1WEU A;  3MHS A;  4LKA A;  1Z2Q A;  4S3O C;  1HYJ A;  2KYU A;  4GNE A;  4YAD A;  4BBQ A;  4S3O B;  5C13 A;  4MVT A;  5FER A;  1WEW A;  2KWO A;  2ECV A;  3U5O A;  5KH7 A;  1BOR A;  5TRB A;  2MIQ A;  4A49 A;  2VJF A;  2L80 A;  4ZQL A;  4UP5 A;  2CKL A;  5B8D A;  4R8P K;  3N9L A;  4MSX A;  3LRQ A;  4YBM A;  3O33 A;  4XI1 A;  4FJC A;  2F6N A;  5LCW B;  2ECW A;  1VD4 A;  1WIM A;  2EA6 A;  3HTK C;  3DQV R;  2MUM A;  3L1X A;  2AN6 A;  3SOU A;  2KRE A;  5JG6 A;  2LV9 A;  4AYC A;  5FEY A;  4QF3 A;  2LRI C;  1JM7 B;  3ZYQ A;  2LQ6 A;  2Y1M A;  4FIP A;  3T6R A;  5LKX A;  2PNX A;  2VPG A;  4YC9 A;  1WEV A;  3O7A A;  2HDP A;  3SOW A;  1WEE A;  2EGP A;  2YUC A;  4LAD B;  3N9Q A;  2VPD A;  1HYI A;  5G0F A;  2YSM A;  4ZUX U;  1X4J A;  5B78 A;  2BAY A;  1X4I A;  3HCT A;  4I7D A;  2K4D A;  1N87 A;  4N3W A;  2L5U A;  2YT5 A;  2IDA A;  2LGV A;  2QIC A;  1T1H A;  4LK9 A;  1Z60 A;  2CSZ A;  3M62 A;  2YU4 A;  2LXH C;  4N4F A;  1VFY A;  2VNF A;  2YQM A;  5D1K B;  2L0B A;  4P5O B;  4B86 C;  3N9O A;  5B77 A;  4L7X A;  3VK6 A;  2XEU A;  5G05 B;  2YYR A;  4AVX A;  2PUY A;  1WFK A;  2K1J A;  4PTB A;  2M3H A;  4R7E A;  2MD7 B;  3GL6 A;  4YAX A;  3LQI A;  2YHO A;  4YBS A;  2I50 A;  3U5M A;  5H1T A;  1WIL A;  3GV4 A; 
#chains in the Genus database with same CATH topology
 3I2D A;  3KV5 A;  1MM3 A;  3O36 A;  2DX8 A;  2FUU A;  1JOC A;  2ECI A;  3E2D A;  2ECG A;  2XOY A;  5TDR A;  3PUR A;  2G6Q A;  1LDK C;  2VPB A;  2IQJ A;  4LJN A;  4UP0 A;  1VYX A;  5KH3 A;  1WEO A;  2VJE B;  5B76 A;  2ECN A;  4B7Y C;  4GB0 A;  3RPG B;  4CA1 A;  1WEP A;  5LKU A;  5D1M B;  4TKP B;  2VP7 A;  1F62 A;  2OXQ C;  4O64 A;  4YAT A;  4LLB A;  3NG2 A;  2LN0 A;  1FBV A;  2YVR A;  2G45 A;  2JMD A;  4I7B A;  4I7C A;  5SVX A;  3N9M A;  5J3X A;  2QIZ A;  3DPL R;  1G25 A;  3PUQ A;  3N9P A;  5DIN A;  1LDJ B;  4CCG X;  5SVI B;  5H1U A;  4FO9 A;  2KKX A;  2Y43 A;  3RTR B;  3C6W A;  2E6R A;  5TDW A;  2EGM A;  2JUN A;  3N9N A;  3O47 A;  4WZ0 A;  4A0C D;  5TBN A;  2EXU A;  2B0O E;  3M99 A;  2LGL A;  3QZV A;  3L1Z B;  2KWJ A;  1CHC A;  4YAB A;  2NAA A;  3LVQ E;  3C5K A;  4OGC A;  4Q6F A;  4FK5 A;  4X3G A;  2C2V S;  2YQL A;  3ZNI A;  5DKA A;  1U6G B;  2MA5 A;  5B79 A;  2L7P A;  2ZET C;  2LGK A;  3M63 A;  4A4C A;  2E6S A;  5B75 A;  4O62 A;  4C9Z A;  2DJA A;  2D8S A;  2MT5 A;  3O35 A;  3V43 A;  2L43 A;  1JM7 A;  3FJU B;  2OWA A;  4Z0O A;  5SVI A;  2CSV A;  5KH9 A;  5LKZ A;  5D1L B;  1XWH A;  2RSD A;  3FAN A;  2VJF B;  2JMI A;  1FP0 A;  2P57 A;  2YRE A;  2CKL B;  1WEQ A;  2YSJ A;  2KWN A;  1ZBD B;  3KV6 A;  2MD8 C;  4IC3 A;  2H0D B;  2QJ0 A;  3LJU X;  2FD4 A;  2YW8 A;  3EB6 A;  5I3L A;  1WEM A;  2ECT A;  5LKT A;  3ZPV E;  1WEN A;  2UZG A;  5EYA F;  2ECJ A;  3U5N A;  2FSA A;  3KQI A;  2L75 A;  3MHH A;  2XB1 A;  4QF2 A;  2CSY A;  2KGI A;  3O70 A;  3O34 A;  2F42 A;  4A4B A;  4AP4 A;  2CRW A;  4YBT A;  2YHN A;  1IYM A;  4AYC B;  3Q1D A;  2XOC A;  4V3K C;  4QQ4 A;  4L58 A;  3DWD A;  3RPG C;  4Z0R A;  3ZTG A;  3LQJ A;  2M6M A;  4F1P A;  5G04 B;  2MNY A;  4NN2 A;  5H1V A;  1WE9 A;  2H0D A;  1V87 A;  4WA6 A;  2C2L A;  2HYE D;  3LQH A;  3O37 A;  5FB1 A;  1Z6U A;  2YUR A;  2E61 A;  3KNV A;  3PLW A;  2CT2 A;  1DCQ A;  2JM3 A;  5AIT A;  2KR4 A;  4F52 B;  4BHW A;  3SOX A;  3T9K A;  4PPE A;  3FM8 C;  1WES A;  2KGG A;  2KIZ A;  2JRJ A;  3FL2 A;  1X4U A;  2LXP C;  4AUQ B;  3KDE C;  5FB0 A;  2KU3 A;  3HCS A;  2JMJ A;  1MM2 A;  4UI9 B;  2FUI A;  2VJE A;  3MDB C;  4R2Y A;  4WZ3 B;  2M85 A;  2EOD A;  3L11 A;  5SVY A;  4W4U A;  2CON A;  3T7L A;  3IHP A;  2F6J A;  2KE1 A;  4WZ2 A;  2KFT A;  1K2F A;  4GNF A;  1DVP A;  5AIU A;  1E4U A;  5TAB A;  2XP0 A;  3ZVZ B;  3EB5 A;  2D8U A;  3HCU A;  2RI7 A;  2LGG A;  4GNG A;  1WGM A;  3U5P A;  3SHB A;  2LDR A;  3ZVY A;  2G43 A;  5H9M A;  2MA6 A;  2K17 A;  2VPE A;  2M1R A;  5C11 A;  2KWK A;  2DSM A;  2MNZ A;  4IC2 A;  1RMD A;  3PHD A;  2K16 A;  3ZPV 1;  4GND A;  4ZDT A;  2Y1N A;  2XOZ A;  3ASL A;  4V3L C;  1WEU A;  3MHS A;  4LKA A;  1Z2Q A;  4OGE A;  4S3O C;  1HYJ A;  2KYU A;  4GNE A;  3FEH A;  4YAD A;  4BBQ A;  4S3O B;  5C13 A;  4MVT A;  5FER A;  1WEW A;  2KWO A;  2ECV A;  3U5O A;  5KH7 A;  1BOR A;  5TRB A;  2MIQ A;  4A49 A;  2VJF A;  2L80 A;  2M13 A;  4ZQL A;  4UP5 A;  2CKL A;  5B8D A;  4R8P K;  3N9L A;  4MSX A;  3LRQ A;  4YBM A;  3O33 A;  2MKE A;  4XI1 A;  4FJC A;  2F6N A;  5LCW B;  2ECW A;  1VD4 A;  2KKY A;  1WIM A;  2EA6 A;  3HTK C;  3DQV R;  2MUM A;  3JUE A;  3L1X A;  2AN6 A;  3M7K A;  3SOU A;  2KRE A;  5JG6 A;  2LV9 A;  4AYC A;  5FEY A;  4QF3 A;  2LRI C;  1JM7 B;  2FFW A;  2LQ6 A;  2LAU A;  2Y1M A;  3ZYQ A;  4FIP A;  3SUB A;  3T6R A;  5LKX A;  2PNX A;  2VPG A;  4YC9 A;  1WEV A;  3O7A A;  2HDP A;  3SOW A;  1WEE A;  2EGP A;  2YUC A;  4LAD B;  3N9Q A;  2VPD A;  1HYI A;  5G0F A;  2YSM A;  4ZUX U;  1X4J A;  2RR4 A;  5B78 A;  2BAY A;  1X4I A;  3HCT A;  4I7D A;  3H7H A;  2K4D A;  1N87 A;  4N3W A;  2L5U A;  2YT5 A;  2IDA A;  2LGV A;  1MBM A;  2QIC A;  3DDT A;  1T1H A;  4LK9 A;  1Z60 A;  2CSZ A;  3M62 A;  2YU4 A;  2LXH C;  4N4F A;  3LDY A;  1VFY A;  2VNF A;  2YQM A;  5D1K B;  2L0B A;  2CRR A;  4P5O B;  4B86 C;  4H9D A;  3N9O A;  5K3Q A;  5B77 A;  4L7X A;  3VK6 A;  2XEU A;  5G05 B;  2YYR A;  4AVX A;  2PUY A;  1WFK A;  2K1J A;  4PTB A;  2M3H A;  4R7E A;  2MD7 B;  3GL6 A;  3FAO A;  3LVR E;  4YAX A;  3LQI A;  2YHO A;  4YBS A;  2I50 A;  3U5M A;  5H1T A;  1WIL A;  3GV4 A; 
#chains in the Genus database with same CATH homology
 3I2D A;  3KV5 A;  1MM3 A;  3O36 A;  2DX8 A;  2FUU A;  1JOC A;  2ECI A;  2ECG A;  5TDR A;  3PUR A;  2G6Q A;  1LDK C;  2VPB A;  4UP0 A;  4LJN A;  1VYX A;  5KH3 A;  1WEO A;  2VJE B;  5B76 A;  2ECN A;  4B7Y C;  4GB0 A;  3RPG B;  4CA1 A;  1WEP A;  5LKU A;  5D1M B;  4TKP B;  2VP7 A;  1F62 A;  2OXQ C;  4O64 A;  4YAT A;  4LLB A;  3NG2 A;  2LN0 A;  1FBV A;  2G45 A;  2JMD A;  4I7B A;  4I7C A;  3N9M A;  5J3X A;  2QIZ A;  3DPL R;  1G25 A;  3PUQ A;  3N9P A;  5DIN A;  1LDJ B;  4CCG X;  5H1U A;  4FO9 A;  2Y43 A;  3RTR B;  3C6W A;  2E6R A;  5TDW A;  3N9N A;  4WZ0 A;  4A0C D;  5TBN A;  3M99 A;  2LGL A;  3L1Z B;  3QZV A;  2KWJ A;  1CHC A;  4YAB A;  2NAA A;  3C5K A;  4Q6F A;  4FK5 A;  4X3G A;  2C2V S;  2YQL A;  3ZNI A;  5DKA A;  1U6G B;  2MA5 A;  5B79 A;  2ZET C;  2LGK A;  3M63 A;  4A4C A;  2E6S A;  5B75 A;  4C9Z A;  2D8S A;  2MT5 A;  3O35 A;  3V43 A;  2L43 A;  1JM7 A;  5KH9 A;  5LKZ A;  5D1L B;  1XWH A;  2RSD A;  2VJF B;  2JMI A;  1FP0 A;  2YRE A;  2CKL B;  1WEQ A;  2YSJ A;  2KWN A;  1ZBD B;  3KV6 A;  2MD8 C;  4IC3 A;  2H0D B;  2QJ0 A;  5I3L A;  2YW8 A;  3EB6 A;  1WEM A;  2ECT A;  5LKT A;  3ZPV E;  1WEN A;  2UZG A;  5EYA F;  2ECJ A;  3U5N A;  2FSA A;  3KQI A;  2L75 A;  3MHH A;  2XB1 A;  4QF2 A;  2CSY A;  2KGI A;  3O70 A;  3O34 A;  2F42 A;  4A4B A;  4AP4 A;  4YBT A;  2YHN A;  1IYM A;  4AYC B;  4V3K C;  4L58 A;  3RPG C;  3ZTG A;  3LQJ A;  2M6M A;  5G04 B;  2MNY A;  4NN2 A;  5H1V A;  1WE9 A;  2H0D A;  1V87 A;  4WA6 A;  2C2L A;  2HYE D;  3LQH A;  3O37 A;  5FB1 A;  1Z6U A;  2YUR A;  3KNV A;  2CT2 A;  5AIT A;  2KR4 A;  4F52 B;  4BHW A;  3SOX A;  4PPE A;  1WES A;  2KGG A;  2KIZ A;  2JRJ A;  3FL2 A;  1X4U A;  2LXP C;  4AUQ B;  5FB0 A;  2KU3 A;  3HCS A;  2JMJ A;  1MM2 A;  4UI9 B;  2FUI A;  2VJE A;  4R2Y A;  4WZ3 B;  2M85 A;  2EOD A;  3L11 A;  4W4U A;  3T7L A;  3IHP A;  2F6J A;  2KE1 A;  4WZ2 A;  2KFT A;  1K2F A;  4GNF A;  1DVP A;  5AIU A;  1E4U A;  5TAB A;  3ZVZ B;  3EB5 A;  3HCU A;  2RI7 A;  2LGG A;  4GNG A;  1WGM A;  3U5P A;  3SHB A;  2LDR A;  3ZVY A;  2G43 A;  5H9M A;  2MA6 A;  2K17 A;  2VPE A;  2M1R A;  5C11 A;  2KWK A;  2MNZ A;  4IC2 A;  1RMD A;  3PHD A;  2K16 A;  3ZPV 1;  4GND A;  4ZDT A;  2Y1N A;  3ASL A;  4V3L C;  1WEU A;  3MHS A;  4LKA A;  1Z2Q A;  4S3O C;  1HYJ A;  2KYU A;  4GNE A;  4YAD A;  4BBQ A;  4S3O B;  5C13 A;  4MVT A;  5FER A;  1WEW A;  2KWO A;  2ECV A;  3U5O A;  5KH7 A;  1BOR A;  5TRB A;  2MIQ A;  4A49 A;  2VJF A;  2L80 A;  4ZQL A;  4UP5 A;  2CKL A;  5B8D A;  4R8P K;  3N9L A;  4MSX A;  3LRQ A;  4YBM A;  3O33 A;  4XI1 A;  4FJC A;  2F6N A;  5LCW B;  2ECW A;  1VD4 A;  1WIM A;  2EA6 A;  3HTK C;  3DQV R;  2MUM A;  3L1X A;  2AN6 A;  3SOU A;  2KRE A;  5JG6 A;  2LV9 A;  4AYC A;  5FEY A;  4QF3 A;  2LRI C;  1JM7 B;  3ZYQ A;  2LQ6 A;  2Y1M A;  4FIP A;  3T6R A;  5LKX A;  2PNX A;  2VPG A;  4YC9 A;  1WEV A;  3O7A A;  2HDP A;  3SOW A;  1WEE A;  2EGP A;  2YUC A;  4LAD B;  3N9Q A;  2VPD A;  1HYI A;  5G0F A;  2YSM A;  4ZUX U;  1X4J A;  5B78 A;  2BAY A;  1X4I A;  3HCT A;  4I7D A;  2K4D A;  1N87 A;  4N3W A;  2L5U A;  2YT5 A;  2IDA A;  2LGV A;  2QIC A;  1T1H A;  4LK9 A;  1Z60 A;  2CSZ A;  3M62 A;  2YU4 A;  2LXH C;  4N4F A;  1VFY A;  2VNF A;  2YQM A;  5D1K B;  2L0B A;  4P5O B;  4B86 C;  3N9O A;  5B77 A;  4L7X A;  3VK6 A;  2XEU A;  5G05 B;  2YYR A;  4AVX A;  2PUY A;  1WFK A;  2K1J A;  4PTB A;  2M3H A;  4R7E A;  2MD7 B;  3GL6 A;  4YAX A;  3LQI A;  2YHO A;  4YBS A;  2I50 A;  3U5M A;  5H1T A;  1WIL A;  3GV4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...