1WEMA

Solution structure of phd domain in death inducer-obliterator 1(dio-1)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
76
structure length
76
Chain Sequence
GSSGSSGECEVYDPNALYCICRQPHNNRFMICCDRCEEWFHGDCVGISEARGRLLERNGEDYICPNCTILSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Death associated transcription factor 1
publication title Solution structure of PHD domain in death inducer-obliterator 1(DIO-1)
rcsb
source organism Mus musculus
molecule tags Dna binding protein
total genus 10
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2004-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1wemA00
3KV6A 2JMIA 3KQIA 2ECJA 2ECGA 4AYCB 2XEUA 5C13A 1JM7B 4YATA 2FUUA 2F6NA 4UP0A 2LXHC 4I7DA 5D1KB 5C11A 2CKLB 5FERA 4TKPB 1VFYA 3FL2A 1IYMA 2KWOA 4R2YA 2YQMA 4LKAA 1VYXA 3PHDA 5D1MB 2JMJA 1WILA 4IC2A 2KGGA 2DX8A 4L7XA 2KGIA 2G43A 3RPGC 1T1HA 3EB6A 2YQLA 3L11A 2KE1A 2MNZA 4CCGX 2KFTA 1DVPA 3O37A 5KH9A 2KWNA 5TABA 2M85A 3L1ZB 4LADB 3ASLA 1WEOA 2VPEA 3O33A 2Y1MA 1FP0A 2LDRA 4X3GA 4FJCA 2UZGA 5FB0A 2M1RA 1K2FA 3T7LA 4PTBA 5B75A 2CT2A 2YSMA 2YW8A 3O36A 2MT5A 3N9QA 3M99A 3DQVR 5DINA 4YABA 4C9ZA 2CSZA 1HYJA 2NAAA 2LXPC 1WEVA 5FEYA 2I50A 1WEQA 2L80A 3RTRB 3O70A 2MUMA 3O34A 4FK5A 4QF2A 3C6WA 4GNDA 4YAXA 1LDKC 3I2DA 2LGGA 1ZBDB 3O7AA 4B7YC 4P5OB 3U5MA 4N4FA 2YSJA 4A0CD 4UP5A 2RI7A 4QF3A 5B78A 3PURA 2KU3A 4WA6A 5JG6A 2LGVA 2HDPA 2MD7B 2K17A 5G04B 2E6RA 3SHBA 2C2VS 2AN6A 1XWHA 4LJNA 1CHCA 2MD8C 1WEPA 2MA5A 1Z2QA 2KWJA 2CSYA 3ZTGA 2YURA 2Y1NA 5KH3A 4PPEA 2C2LA 3NG2A 4NN2A 1WE9A 3RPGB 4L58A 3L1XA 3HCTA 4O64A 2E6SA 2LV9A 5D1LB 1E4UA 3IHPA 4YC9A 3QZVA 3ZVZB 1V87A 4Q6FA 4WZ0A 3U5OA 4WZ3B 1RMDA 5H1UA 2M6MA 5AIUA 4GB0A 3ZNIA 3ZYQA 2LGKA 2K4DA 3PUQA 4XI1A 4R8PK 4W4UA 4A49A 5EYAF 1WENA 4LLBA 5B79A 5H1TA 5B77A 4UI9B 3ZPV1 3DPLR 2MIQA 3LQJA 2YT5A 4BHWA 4ZUXU 4R7EA 4F52B 1G25A 3KNVA 4YBSA 3SOXA 5TRBA 1X4JA 2M3HA 2ECTA 4S3OB 5LKUA 3O35A 1F62A 5G05B 1MM3A 5G0FA 3ZPVE 3M62A 4AVXA 1FBVA 4A4BA 2L75A 2KR4A 4BBQA 4I7CA 2VPDA 2QICA 3N9PA 4YADA 5I3LA 3HTKC 2Y43A 1WEWA 5FB1A 2F6JA 2ECIA 2YREA 3N9NA 3GL6A 1X4IA 2KIZA 2OXQC 2RSDA 2LQ6A 2EGPA 2YHNA 3U5NA 1JOCA 3T6RA 5LKXA 5TDWA 4V3KC 3LRQA 2ECVA 2VPBA 4FO9A 1WEUA 2VNFA 1WEEA 2QIZA 5KH7A 3KV5A 4GNEA 5B76A 4IC3A 4WZ2A 1X4UA 4AP4A 1U6GB 1WEMA 3LQIA 4GNFA 4CA1A 5B8DA 3HCSA 3C5KA 3M63A 3MHSA 2PNXA 4GNGA 5DKAA 1WFKA 5LCWB 1WIMA 5J3XA 2K1JA 2ZETC 1VD4A 4YBMA 4N3WA 5H1VA 1N87A 4FIPA 2YYRA 3SOUA 4LK9A 4MVTA 2LGLA 2HYED 5H9MA 4V3LC 2FUIA 2VJEA 3GV4A 4I7BA 3VK6A 2YUCA 3V43A 2ECWA 2VJFA 3N9MA 5AITA 2PUYA 2KYUA 2FSAA 2H0DB 2JRJA 4AUQB 2L43A 2G45A 2JMDA 5TDRA 2G6QA 4AYCA 1HYIA 2K16A 2F42A 2MNYA 1JM7A 2L0BA 5LKTA 2CKLA 4ZQLA 3MHHA 2LRIC 4B86C 3HCUA 2ECNA 3N9LA 2VPGA 3EB5A 4A4CA 1Z60A 2LN0A 2YU4A 4YBTA 1BORA 4S3OC 2IDAA 1LDJB 2H0DA 4MSXA 3U5PA 2KWKA 2BAYA 2VP7A 3N9OA 4ZDTA 2VJEB 5LKZA 2EODA 3LQHA 2VJFB 3ZVYA 2QJ0A 2MA6A 1WGMA 2L5UA 1Z6UA 1MM2A 2YHOA 2EA6A 5TBNA 2D8SA 3SOWA 1WESA 2XB1A 2KREA
chains in the Genus database with same CATH superfamily
3KV6A 2JMIA 3KQIA 2ECJA 2ECGA 4AYCB 2XEUA 3DWDA 5C13A 1JM7B 4YATA 2FUUA 2F6NA 4UP0A 2LXHC 4I7DA 5D1KB 5C11A 2CKLB 5FERA 4TKPB 1VFYA 3FL2A 1IYMA 2KWOA 5SVYA 4R2YA 2YQMA 4LKAA 1VYXA 3PHDA 5D1MB 2JMJA 3FJUB 1WILA 4IC2A 2XP0A 2KGGA 2DX8A 4L7XA 2KGIA 2G43A 3RPGC 1T1HA 3EB6A 2YQLA 3L11A 2KE1A 2MNZA 4CCGX 2KFTA 1DVPA 2EGMA 3M7KA 3H7HA 3O37A 5KH9A 2KWNA 5TABA 2M85A 3L1ZB 4LADB 3ASLA 1WEOA 2VPEA 4H9DA 3O33A 2Y1MA 1FP0A 2LDRA 4X3GA 2P57A 4FJCA 2UZGA 5FB0A 2M1RA 1K2FA 3JUEA 4PTBA 3T7LA 5B75A 2CT2A 2YSMA 2YW8A 3O36A 2MT5A 3LDYA 3N9QA 3M99A 3DQVR 5DINA 4YABA 4C9ZA 2CSZA 3PLWA 1HYJA 2NAAA 2LXPC 1WEVA 2CONA 5FEYA 2I50A 3E2DA 1WEQA 2L80A 3RTRB 3O70A 2MUMA 3O34A 4FK5A 4QF2A 3C6WA 4GNDA 4YAXA 1LDKC 3I2DA 2LGGA 1ZBDB 3O7AA 2CRRA 4B7YC 4P5OB 3U5MA 4N4FA 2YSJA 4A0CD 4UP5A 2RI7A 4QF3A 5B78A 3PURA 2KU3A 4WA6A 5JG6A 2LGVA 2HDPA 2MD7B 2E61A 2K17A 5G04B 2E6RA 5K3QA 3SHBA 2C2VS 2AN6A 1XWHA 4LJNA 1CHCA 2MD8C 1WEPA 2MA5A 3DDTA 1Z2QA 2KWJA 2CSYA 3LVQE 3ZTGA 2YURA 2Y1NA 5KH3A 2YVRA 4PPEA 3FM8C 2C2LA 3NG2A 4NN2A 1WE9A 3RPGB 4L58A 3L1XA 3HCTA 4O64A 2E6SA 2LV9A 5D1LB 1E4UA 3IHPA 4YC9A 3QZVA 3ZVZB 1V87A 4Q6FA 4WZ0A 3U5OA 4WZ3B 1RMDA 5H1UA 2M6MA 5AIUA 4GB0A 4Z0RA 5SVXA 3ZNIA 3Q1DA 3ZYQA 2LGKA 2FFWA 2K4DA 3PUQA 4XI1A 4R8PK 4W4UA 4A49A 4QQ4A 5EYAF 3LJUX 1WENA 4LLBA 5SVIA 5B79A 5H1TA 5B77A 2EXUA 4UI9B 3DPLR 2MIQA 3LQJA 3ZPV1 2YT5A 4BHWA 3FAOA 2L7PA 4ZUXU 4R7EA 2RR4A 4F52B 2OWAA 1G25A 3KNVA 4YBSA 3SOXA 3FANA 5TRBA 1X4JA 2M3HA 2ECTA 4S3OB 5LKUA 3O35A 1F62A 5G05B 1MM3A 5G0FA 3ZPVE 2B0OE 2XOCA 3M62A 2KKYA 4AVXA 1FBVA 4A4BA 2L75A 2KR4A 4BBQA 4I7CA 2VPDA 2QICA 3N9PA 4YADA 5I3LA 2IQJA 3HTKC 2Y43A 2MKEA 1WEWA 5FB1A 2F6JA 2FD4A 2ECIA 2YREA 3N9NA 3GL6A 1X4IA 2KIZA 4Z0OA 2OXQC 2RSDA 2LQ6A 2EGPA 2M13A 2YHNA 1JOCA 3U5NA 3T6RA 4OGEA 5LKXA 5TDWA 5SVIB 4V3KC 3LRQA 2ECVA 2VPBA 4FO9A 1WEUA 1MBMA 2VNFA 1WEEA 2QIZA 5KH7A 3KV5A 4GNEA 5B76A 4IC3A 4WZ2A 1X4UA 4AP4A 1U6GB 1WEMA 3LQIA 4GNFA 4CA1A 1DCQA 5B8DA 3HCSA 3C5KA 3M63A 3MHSA 2DJAA 2PNXA 4GNGA 5DKAA 1WFKA 5LCWB 1WIMA 5J3XA 2K1JA 2ZETC 1VD4A 4YBMA 4N3WA 5H1VA 2XOYA 1N87A 3O47A 4FIPA 2YYRA 3SOUA 4LK9A 2DSMA 4MVTA 2LGLA 2HYED 5H9MA 3FEHA 4V3LC 2FUIA 2VJEA 3GV4A 4I7BA 3VK6A 3T9KA 2YUCA 3V43A 2ECWA 2VJFA 3N9MA 5AITA 2PUYA 2KYUA 2FSAA 2H0DB 2JRJA 4AUQB 2L43A 2G45A 2JMDA 5TDRA 3KDEC 2G6QA 2KKXA 4AYCA 1HYIA 2K16A 2F42A 2MNYA 1JM7A 2L0BA 2JUNA 5LKTA 2CKLA 4ZQLA 3MHHA 3MDBC 2LRIC 4B86C 2XOZA 4F1PA 2D8UA 3HCUA 2ECNA 3N9LA 2VPGA 3EB5A 4A4CA 1Z60A 2LN0A 4O62A 2YU4A 4OGCA 4YBTA 1BORA 2CSVA 4S3OC 2CRWA 2IDAA 1LDJB 2H0DA 2LAUA 4MSXA 3U5PA 3SUBA 2KWKA 2BAYA 2VP7A 3N9OA 4ZDTA 2VJEB 5LKZA 2EODA 3LQHA 2VJFB 3ZVYA 2QJ0A 2MA6A 1WGMA 2L5UA 1Z6UA 1MM2A 2YHOA 2EA6A 5TBNA 2D8SA 3SOWA 3LVRE 2JM3A 1WESA 2XB1A 2KREA
chains in the Genus database with same CATH topology
3KV6A 2JMIA 3KQIA 2ECJA 2ECGA 4AYCB 2XEUA 5C13A 1JM7B 4YATA 2FUUA 2F6NA 4UP0A 2LXHC 4I7DA 5D1KB 5C11A 2CKLB 5FERA 4TKPB 1VFYA 3FL2A 1IYMA 2KWOA 4R2YA 2YQMA 4LKAA 1VYXA 3PHDA 5D1MB 2JMJA 1WILA 4IC2A 2KGGA 2DX8A 4L7XA 2KGIA 2G43A 3RPGC 1T1HA 3EB6A 2YQLA 3L11A 2KE1A 2MNZA 4CCGX 2KFTA 1DVPA 3O37A 5KH9A 2KWNA 5TABA 2M85A 3L1ZB 4LADB 3ASLA 1WEOA 2VPEA 3O33A 2Y1MA 1FP0A 2LDRA 4X3GA 4FJCA 2UZGA 5FB0A 2M1RA 1K2FA 3T7LA 4PTBA 5B75A 2CT2A 2YSMA 2YW8A 3O36A 2MT5A 3N9QA 3M99A 3DQVR 5DINA 4YABA 4C9ZA 2CSZA 1HYJA 2NAAA 2LXPC 1WEVA 5FEYA 2I50A 1WEQA 2L80A 3RTRB 3O70A 2MUMA 3O34A 4FK5A 4QF2A 3C6WA 4GNDA 4YAXA 1LDKC 3I2DA 2LGGA 1ZBDB 3O7AA 4B7YC 4P5OB 3U5MA 4N4FA 2YSJA 4A0CD 4UP5A 2RI7A 4QF3A 5B78A 3PURA 2KU3A 4WA6A 5JG6A 2LGVA 2HDPA 2MD7B 2K17A 5G04B 2E6RA 3SHBA 2C2VS 2AN6A 1XWHA 4LJNA 1CHCA 2MD8C 1WEPA 2MA5A 1Z2QA 2KWJA 2CSYA 3ZTGA 2YURA 2Y1NA 5KH3A 4PPEA 2C2LA 3NG2A 4NN2A 1WE9A 3RPGB 4L58A 3L1XA 3HCTA 4O64A 2E6SA 2LV9A 5D1LB 1E4UA 3IHPA 4YC9A 3QZVA 3ZVZB 1V87A 4Q6FA 4WZ0A 3U5OA 4WZ3B 1RMDA 5H1UA 2M6MA 5AIUA 4GB0A 3ZNIA 3ZYQA 2LGKA 2K4DA 3PUQA 4XI1A 4R8PK 4W4UA 4A49A 5EYAF 1WENA 4LLBA 5B79A 5H1TA 5B77A 4UI9B 3ZPV1 3DPLR 2MIQA 3LQJA 2YT5A 4BHWA 4ZUXU 4R7EA 4F52B 1G25A 3KNVA 4YBSA 3SOXA 5TRBA 1X4JA 2M3HA 2ECTA 4S3OB 5LKUA 3O35A 1F62A 5G05B 1MM3A 5G0FA 3ZPVE 3M62A 4AVXA 1FBVA 4A4BA 2L75A 2KR4A 4BBQA 4I7CA 2VPDA 2QICA 3N9PA 4YADA 5I3LA 3HTKC 2Y43A 1WEWA 5FB1A 2F6JA 2ECIA 2YREA 3N9NA 3GL6A 1X4IA 2KIZA 2OXQC 2RSDA 2LQ6A 2EGPA 2YHNA 3U5NA 1JOCA 3T6RA 5LKXA 5TDWA 4V3KC 3LRQA 2ECVA 2VPBA 4FO9A 1WEUA 2VNFA 1WEEA 2QIZA 5KH7A 3KV5A 4GNEA 5B76A 4IC3A 4WZ2A 1X4UA 4AP4A 1U6GB 1WEMA 3LQIA 4GNFA 4CA1A 5B8DA 3HCSA 3C5KA 3M63A 3MHSA 2PNXA 4GNGA 5DKAA 1WFKA 5LCWB 1WIMA 5J3XA 2K1JA 2ZETC 1VD4A 4YBMA 4N3WA 5H1VA 1N87A 4FIPA 2YYRA 3SOUA 4LK9A 4MVTA 2LGLA 2HYED 5H9MA 4V3LC 2FUIA 2VJEA 3GV4A 4I7BA 3VK6A 2YUCA 3V43A 2ECWA 2VJFA 3N9MA 5AITA 2PUYA 2KYUA 2FSAA 2H0DB 2JRJA 4AUQB 2L43A 2G45A 2JMDA 5TDRA 2G6QA 4AYCA 1HYIA 2K16A 2F42A 2MNYA 1JM7A 2L0BA 5LKTA 2CKLA 4ZQLA 3MHHA 2LRIC 4B86C 3HCUA 2ECNA 3N9LA 2VPGA 3EB5A 4A4CA 1Z60A 2LN0A 2YU4A 4YBTA 1BORA 4S3OC 2IDAA 1LDJB 2H0DA 4MSXA 3U5PA 2KWKA 2BAYA 2VP7A 3N9OA 4ZDTA 2VJEB 5LKZA 2EODA 3LQHA 2VJFB 3ZVYA 2QJ0A 2MA6A 1WGMA 2L5UA 1Z6UA 1MM2A 2YHOA 2EA6A 5TBNA 2D8SA 3SOWA 1WESA 2XB1A 2KREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KV6 A;  2JMI A;  3KQI A;  2ECJ A;  2ECG A;  4AYC B;  2XEU A;  5C13 A;  1JM7 B;  4YAT A;  2FUU A;  2F6N A;  4UP0 A;  2LXH C;  4I7D A;  5D1K B;  5C11 A;  2CKL B;  5FER A;  4TKP B;  1VFY A;  3FL2 A;  1IYM A;  2KWO A;  4R2Y A;  2YQM A;  4LKA A;  1VYX A;  3PHD A;  5D1M B;  2JMJ A;  1WIL A;  4IC2 A;  2KGG A;  2DX8 A;  4L7X A;  2KGI A;  2G43 A;  3RPG C;  1T1H A;  3EB6 A;  2YQL A;  3L11 A;  2KE1 A;  2MNZ A;  4CCG X;  2KFT A;  1DVP A;  3O37 A;  5KH9 A;  2KWN A;  5TAB A;  2M85 A;  3L1Z B;  4LAD B;  3ASL A;  1WEO A;  2VPE A;  3O33 A;  2Y1M A;  1FP0 A;  2LDR A;  4X3G A;  4FJC A;  2UZG A;  5FB0 A;  2M1R A;  1K2F A;  3T7L A;  4PTB A;  5B75 A;  2CT2 A;  2YSM A;  2YW8 A;  3O36 A;  2MT5 A;  3N9Q A;  3M99 A;  3DQV R;  5DIN A;  4YAB A;  4C9Z A;  2CSZ A;  1HYJ A;  2NAA A;  2LXP C;  1WEV A;  5FEY A;  2I50 A;  1WEQ A;  2L80 A;  3RTR B;  3O70 A;  2MUM A;  3O34 A;  4FK5 A;  4QF2 A;  3C6W A;  4GND A;  4YAX A;  1LDK C;  3I2D A;  2LGG A;  1ZBD B;  3O7A A;  4B7Y C;  4P5O B;  3U5M A;  4N4F A;  2YSJ A;  4A0C D;  4UP5 A;  2RI7 A;  4QF3 A;  5B78 A;  3PUR A;  2KU3 A;  4WA6 A;  5JG6 A;  2LGV A;  2HDP A;  2MD7 B;  2K17 A;  5G04 B;  2E6R A;  3SHB A;  2C2V S;  2AN6 A;  1XWH A;  4LJN A;  1CHC A;  2MD8 C;  1WEP A;  2MA5 A;  1Z2Q A;  2KWJ A;  2CSY A;  3ZTG A;  2YUR A;  2Y1N A;  5KH3 A;  4PPE A;  2C2L A;  3NG2 A;  4NN2 A;  1WE9 A;  3RPG B;  4L58 A;  3L1X A;  3HCT A;  4O64 A;  2E6S A;  2LV9 A;  5D1L B;  1E4U A;  3IHP A;  4YC9 A;  3QZV A;  3ZVZ B;  1V87 A;  4Q6F A;  4WZ0 A;  3U5O A;  4WZ3 B;  1RMD A;  5H1U A;  2M6M A;  5AIU A;  4GB0 A;  3ZNI A;  3ZYQ A;  2LGK A;  2K4D A;  3PUQ A;  4XI1 A;  4R8P K;  4W4U A;  4A49 A;  5EYA F;  1WEN A;  4LLB A;  5B79 A;  5H1T A;  5B77 A;  4UI9 B;  3ZPV 1;  3DPL R;  2MIQ A;  3LQJ A;  2YT5 A;  4BHW A;  4ZUX U;  4R7E A;  4F52 B;  1G25 A;  3KNV A;  4YBS A;  3SOX A;  5TRB A;  1X4J A;  2M3H A;  2ECT A;  4S3O B;  5LKU A;  3O35 A;  1F62 A;  5G05 B;  1MM3 A;  5G0F A;  3ZPV E;  3M62 A;  4AVX A;  1FBV A;  4A4B A;  2L75 A;  2KR4 A;  4BBQ A;  4I7C A;  2VPD A;  2QIC A;  3N9P A;  4YAD A;  5I3L A;  3HTK C;  2Y43 A;  1WEW A;  5FB1 A;  2F6J A;  2ECI A;  2YRE A;  3N9N A;  3GL6 A;  1X4I A;  2KIZ A;  2OXQ C;  2RSD A;  2LQ6 A;  2EGP A;  2YHN A;  3U5N A;  1JOC A;  3T6R A;  5LKX A;  5TDW A;  4V3K C;  3LRQ A;  2ECV A;  2VPB A;  4FO9 A;  1WEU A;  2VNF A;  1WEE A;  2QIZ A;  5KH7 A;  3KV5 A;  4GNE A;  5B76 A;  4IC3 A;  4WZ2 A;  1X4U A;  4AP4 A;  1U6G B;  1WEM A;  3LQI A;  4GNF A;  4CA1 A;  5B8D A;  3HCS A;  3C5K A;  3M63 A;  3MHS A;  2PNX A;  4GNG A;  5DKA A;  1WFK A;  5LCW B;  1WIM A;  5J3X A;  2K1J A;  2ZET C;  1VD4 A;  4YBM A;  4N3W A;  5H1V A;  1N87 A;  4FIP A;  2YYR A;  3SOU A;  4LK9 A;  4MVT A;  2LGL A;  2HYE D;  5H9M A;  4V3L C;  2FUI A;  2VJE A;  3GV4 A;  4I7B A;  3VK6 A;  2YUC A;  3V43 A;  2ECW A;  2VJF A;  3N9M A;  5AIT A;  2PUY A;  2KYU A;  2FSA A;  2H0D B;  2JRJ A;  4AUQ B;  2L43 A;  2G45 A;  2JMD A;  5TDR A;  2G6Q A;  4AYC A;  1HYI A;  2K16 A;  2F42 A;  2MNY A;  1JM7 A;  2L0B A;  5LKT A;  2CKL A;  4ZQL A;  3MHH A;  2LRI C;  4B86 C;  3HCU A;  2ECN A;  3N9L A;  2VPG A;  3EB5 A;  4A4C A;  1Z60 A;  2LN0 A;  2YU4 A;  4YBT A;  1BOR A;  4S3O C;  2IDA A;  1LDJ B;  2H0D A;  4MSX A;  3U5P A;  2KWK A;  2BAY A;  2VP7 A;  3N9O A;  4ZDT A;  2VJE B;  5LKZ A;  2EOD A;  3LQH A;  2VJF B;  3ZVY A;  2QJ0 A;  2MA6 A;  1WGM A;  2L5U A;  1Z6U A;  1MM2 A;  2YHO A;  2EA6 A;  5TBN A;  2D8S A;  3SOW A;  1WES A;  2XB1 A;  2KRE A; 
#chains in the Genus database with same CATH topology
 3KV6 A;  2JMI A;  3KQI A;  2ECJ A;  2ECG A;  4AYC B;  2XEU A;  3DWD A;  5C13 A;  1JM7 B;  4YAT A;  2FUU A;  2F6N A;  4UP0 A;  2LXH C;  4I7D A;  5D1K B;  5C11 A;  2CKL B;  5FER A;  4TKP B;  1VFY A;  3FL2 A;  1IYM A;  2KWO A;  5SVY A;  4R2Y A;  2YQM A;  4LKA A;  1VYX A;  3PHD A;  5D1M B;  2JMJ A;  3FJU B;  1WIL A;  4IC2 A;  2XP0 A;  2KGG A;  2DX8 A;  4L7X A;  2KGI A;  2G43 A;  3RPG C;  1T1H A;  3EB6 A;  2YQL A;  3L11 A;  2KE1 A;  2MNZ A;  4CCG X;  2KFT A;  1DVP A;  2EGM A;  3M7K A;  3H7H A;  3O37 A;  5KH9 A;  2KWN A;  5TAB A;  2M85 A;  3L1Z B;  4LAD B;  3ASL A;  1WEO A;  2VPE A;  4H9D A;  3O33 A;  2Y1M A;  1FP0 A;  2LDR A;  4X3G A;  2P57 A;  4FJC A;  2UZG A;  5FB0 A;  2M1R A;  1K2F A;  3JUE A;  4PTB A;  3T7L A;  5B75 A;  2CT2 A;  2YSM A;  2YW8 A;  3O36 A;  2MT5 A;  3LDY A;  3N9Q A;  3M99 A;  3DQV R;  5DIN A;  4YAB A;  4C9Z A;  2CSZ A;  3PLW A;  1HYJ A;  2NAA A;  2LXP C;  1WEV A;  2CON A;  5FEY A;  2I50 A;  3E2D A;  1WEQ A;  2L80 A;  3RTR B;  3O70 A;  2MUM A;  3O34 A;  4FK5 A;  4QF2 A;  3C6W A;  4GND A;  4YAX A;  1LDK C;  3I2D A;  2LGG A;  1ZBD B;  3O7A A;  2CRR A;  4B7Y C;  4P5O B;  3U5M A;  4N4F A;  2YSJ A;  4A0C D;  4UP5 A;  2RI7 A;  4QF3 A;  5B78 A;  3PUR A;  2KU3 A;  4WA6 A;  5JG6 A;  2LGV A;  2HDP A;  2MD7 B;  2E61 A;  2K17 A;  5G04 B;  2E6R A;  5K3Q A;  3SHB A;  2C2V S;  2AN6 A;  1XWH A;  4LJN A;  1CHC A;  2MD8 C;  1WEP A;  2MA5 A;  3DDT A;  1Z2Q A;  2KWJ A;  2CSY A;  3LVQ E;  3ZTG A;  2YUR A;  2Y1N A;  5KH3 A;  2YVR A;  4PPE A;  3FM8 C;  2C2L A;  3NG2 A;  4NN2 A;  1WE9 A;  3RPG B;  4L58 A;  3L1X A;  3HCT A;  4O64 A;  2E6S A;  2LV9 A;  5D1L B;  1E4U A;  3IHP A;  4YC9 A;  3QZV A;  3ZVZ B;  1V87 A;  4Q6F A;  4WZ0 A;  3U5O A;  4WZ3 B;  1RMD A;  5H1U A;  2M6M A;  5AIU A;  4GB0 A;  4Z0R A;  5SVX A;  3ZNI A;  3Q1D A;  3ZYQ A;  2LGK A;  2FFW A;  2K4D A;  3PUQ A;  4XI1 A;  4R8P K;  4W4U A;  4A49 A;  4QQ4 A;  5EYA F;  3LJU X;  1WEN A;  4LLB A;  5SVI A;  5B79 A;  5H1T A;  5B77 A;  2EXU A;  4UI9 B;  3DPL R;  2MIQ A;  3LQJ A;  3ZPV 1;  2YT5 A;  4BHW A;  3FAO A;  2L7P A;  4ZUX U;  4R7E A;  2RR4 A;  4F52 B;  2OWA A;  1G25 A;  3KNV A;  4YBS A;  3SOX A;  3FAN A;  5TRB A;  1X4J A;  2M3H A;  2ECT A;  4S3O B;  5LKU A;  3O35 A;  1F62 A;  5G05 B;  1MM3 A;  5G0F A;  3ZPV E;  2B0O E;  2XOC A;  3M62 A;  2KKY A;  4AVX A;  1FBV A;  4A4B A;  2L75 A;  2KR4 A;  4BBQ A;  4I7C A;  2VPD A;  2QIC A;  3N9P A;  4YAD A;  5I3L A;  2IQJ A;  3HTK C;  2Y43 A;  2MKE A;  1WEW A;  5FB1 A;  2F6J A;  2FD4 A;  2ECI A;  2YRE A;  3N9N A;  3GL6 A;  1X4I A;  2KIZ A;  4Z0O A;  2OXQ C;  2RSD A;  2LQ6 A;  2EGP A;  2M13 A;  2YHN A;  1JOC A;  3U5N A;  3T6R A;  4OGE A;  5LKX A;  5TDW A;  5SVI B;  4V3K C;  3LRQ A;  2ECV A;  2VPB A;  4FO9 A;  1WEU A;  1MBM A;  2VNF A;  1WEE A;  2QIZ A;  5KH7 A;  3KV5 A;  4GNE A;  5B76 A;  4IC3 A;  4WZ2 A;  1X4U A;  4AP4 A;  1U6G B;  1WEM A;  3LQI A;  4GNF A;  4CA1 A;  1DCQ A;  5B8D A;  3HCS A;  3C5K A;  3M63 A;  3MHS A;  2DJA A;  2PNX A;  4GNG A;  5DKA A;  1WFK A;  5LCW B;  1WIM A;  5J3X A;  2K1J A;  2ZET C;  1VD4 A;  4YBM A;  4N3W A;  5H1V A;  2XOY A;  1N87 A;  3O47 A;  4FIP A;  2YYR A;  3SOU A;  4LK9 A;  2DSM A;  4MVT A;  2LGL A;  2HYE D;  5H9M A;  3FEH A;  4V3L C;  2FUI A;  2VJE A;  3GV4 A;  4I7B A;  3VK6 A;  3T9K A;  2YUC A;  3V43 A;  2ECW A;  2VJF A;  3N9M A;  5AIT A;  2PUY A;  2KYU A;  2FSA A;  2H0D B;  2JRJ A;  4AUQ B;  2L43 A;  2G45 A;  2JMD A;  5TDR A;  3KDE C;  2G6Q A;  2KKX A;  4AYC A;  1HYI A;  2K16 A;  2F42 A;  2MNY A;  1JM7 A;  2L0B A;  2JUN A;  5LKT A;  2CKL A;  4ZQL A;  3MHH A;  3MDB C;  2LRI C;  4B86 C;  2XOZ A;  4F1P A;  2D8U A;  3HCU A;  2ECN A;  3N9L A;  2VPG A;  3EB5 A;  4A4C A;  1Z60 A;  2LN0 A;  4O62 A;  2YU4 A;  4OGC A;  4YBT A;  1BOR A;  2CSV A;  4S3O C;  2CRW A;  2IDA A;  1LDJ B;  2H0D A;  2LAU A;  4MSX A;  3U5P A;  3SUB A;  2KWK A;  2BAY A;  2VP7 A;  3N9O A;  4ZDT A;  2VJE B;  5LKZ A;  2EOD A;  3LQH A;  2VJF B;  3ZVY A;  2QJ0 A;  2MA6 A;  1WGM A;  2L5U A;  1Z6U A;  1MM2 A;  2YHO A;  2EA6 A;  5TBN A;  2D8S A;  3SOW A;  3LVR E;  2JM3 A;  1WES A;  2XB1 A;  2KRE A; 
#chains in the Genus database with same CATH homology
 3KV6 A;  2JMI A;  3KQI A;  2ECJ A;  2ECG A;  4AYC B;  2XEU A;  5C13 A;  1JM7 B;  4YAT A;  2FUU A;  2F6N A;  4UP0 A;  2LXH C;  4I7D A;  5D1K B;  5C11 A;  2CKL B;  5FER A;  4TKP B;  1VFY A;  3FL2 A;  1IYM A;  2KWO A;  4R2Y A;  2YQM A;  4LKA A;  1VYX A;  3PHD A;  5D1M B;  2JMJ A;  1WIL A;  4IC2 A;  2KGG A;  2DX8 A;  4L7X A;  2KGI A;  2G43 A;  3RPG C;  1T1H A;  3EB6 A;  2YQL A;  3L11 A;  2KE1 A;  2MNZ A;  4CCG X;  2KFT A;  1DVP A;  3O37 A;  5KH9 A;  2KWN A;  5TAB A;  2M85 A;  3L1Z B;  4LAD B;  3ASL A;  1WEO A;  2VPE A;  3O33 A;  2Y1M A;  1FP0 A;  2LDR A;  4X3G A;  4FJC A;  2UZG A;  5FB0 A;  2M1R A;  1K2F A;  3T7L A;  4PTB A;  5B75 A;  2CT2 A;  2YSM A;  2YW8 A;  3O36 A;  2MT5 A;  3N9Q A;  3M99 A;  3DQV R;  5DIN A;  4YAB A;  4C9Z A;  2CSZ A;  1HYJ A;  2NAA A;  2LXP C;  1WEV A;  5FEY A;  2I50 A;  1WEQ A;  2L80 A;  3RTR B;  3O70 A;  2MUM A;  3O34 A;  4FK5 A;  4QF2 A;  3C6W A;  4GND A;  4YAX A;  1LDK C;  3I2D A;  2LGG A;  1ZBD B;  3O7A A;  4B7Y C;  4P5O B;  3U5M A;  4N4F A;  2YSJ A;  4A0C D;  4UP5 A;  2RI7 A;  4QF3 A;  5B78 A;  3PUR A;  2KU3 A;  4WA6 A;  5JG6 A;  2LGV A;  2HDP A;  2MD7 B;  2K17 A;  5G04 B;  2E6R A;  3SHB A;  2C2V S;  2AN6 A;  1XWH A;  4LJN A;  1CHC A;  2MD8 C;  1WEP A;  2MA5 A;  1Z2Q A;  2KWJ A;  2CSY A;  3ZTG A;  2YUR A;  2Y1N A;  5KH3 A;  4PPE A;  2C2L A;  3NG2 A;  4NN2 A;  1WE9 A;  3RPG B;  4L58 A;  3L1X A;  3HCT A;  4O64 A;  2E6S A;  2LV9 A;  5D1L B;  1E4U A;  3IHP A;  4YC9 A;  3QZV A;  3ZVZ B;  1V87 A;  4Q6F A;  4WZ0 A;  3U5O A;  4WZ3 B;  1RMD A;  5H1U A;  2M6M A;  5AIU A;  4GB0 A;  3ZNI A;  3ZYQ A;  2LGK A;  2K4D A;  3PUQ A;  4XI1 A;  4R8P K;  4W4U A;  4A49 A;  5EYA F;  1WEN A;  4LLB A;  5B79 A;  5H1T A;  5B77 A;  4UI9 B;  3ZPV 1;  3DPL R;  2MIQ A;  3LQJ A;  2YT5 A;  4BHW A;  4ZUX U;  4R7E A;  4F52 B;  1G25 A;  3KNV A;  4YBS A;  3SOX A;  5TRB A;  1X4J A;  2M3H A;  2ECT A;  4S3O B;  5LKU A;  3O35 A;  1F62 A;  5G05 B;  1MM3 A;  5G0F A;  3ZPV E;  3M62 A;  4AVX A;  1FBV A;  4A4B A;  2L75 A;  2KR4 A;  4BBQ A;  4I7C A;  2VPD A;  2QIC A;  3N9P A;  4YAD A;  5I3L A;  3HTK C;  2Y43 A;  1WEW A;  5FB1 A;  2F6J A;  2ECI A;  2YRE A;  3N9N A;  3GL6 A;  1X4I A;  2KIZ A;  2OXQ C;  2RSD A;  2LQ6 A;  2EGP A;  2YHN A;  3U5N A;  1JOC A;  3T6R A;  5LKX A;  5TDW A;  4V3K C;  3LRQ A;  2ECV A;  2VPB A;  4FO9 A;  1WEU A;  2VNF A;  1WEE A;  2QIZ A;  5KH7 A;  3KV5 A;  4GNE A;  5B76 A;  4IC3 A;  4WZ2 A;  1X4U A;  4AP4 A;  1U6G B;  1WEM A;  3LQI A;  4GNF A;  4CA1 A;  5B8D A;  3HCS A;  3C5K A;  3M63 A;  3MHS A;  2PNX A;  4GNG A;  5DKA A;  1WFK A;  5LCW B;  1WIM A;  5J3X A;  2K1J A;  2ZET C;  1VD4 A;  4YBM A;  4N3W A;  5H1V A;  1N87 A;  4FIP A;  2YYR A;  3SOU A;  4LK9 A;  4MVT A;  2LGL A;  2HYE D;  5H9M A;  4V3L C;  2FUI A;  2VJE A;  3GV4 A;  4I7B A;  3VK6 A;  2YUC A;  3V43 A;  2ECW A;  2VJF A;  3N9M A;  5AIT A;  2PUY A;  2KYU A;  2FSA A;  2H0D B;  2JRJ A;  4AUQ B;  2L43 A;  2G45 A;  2JMD A;  5TDR A;  2G6Q A;  4AYC A;  1HYI A;  2K16 A;  2F42 A;  2MNY A;  1JM7 A;  2L0B A;  5LKT A;  2CKL A;  4ZQL A;  3MHH A;  2LRI C;  4B86 C;  3HCU A;  2ECN A;  3N9L A;  2VPG A;  3EB5 A;  4A4C A;  1Z60 A;  2LN0 A;  2YU4 A;  4YBT A;  1BOR A;  4S3O C;  2IDA A;  1LDJ B;  2H0D A;  4MSX A;  3U5P A;  2KWK A;  2BAY A;  2VP7 A;  3N9O A;  4ZDT A;  2VJE B;  5LKZ A;  2EOD A;  3LQH A;  2VJF B;  3ZVY A;  2QJ0 A;  2MA6 A;  1WGM A;  2L5U A;  1Z6U A;  1MM2 A;  2YHO A;  2EA6 A;  5TBN A;  2D8S A;  3SOW A;  1WES A;  2XB1 A;  2KRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...