1WEMA

Solution structure of phd domain in death inducer-obliterator 1(dio-1)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
76
structure length
76
Chain Sequence
GSSGSSGECEVYDPNALYCICRQPHNNRFMICCDRCEEWFHGDCVGISEARGRLLERNGEDYICPNCTILSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Death associated transcription factor 1
publication title Solution structure of PHD domain in death inducer-obliterator 1(DIO-1)
rcsb
source organism Mus musculus
total genus 10
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2004-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1wemA00
5B75A 4MVTA 2BAYA 2RI7A 3KNVA 4S3OB 3N9OA 4PTBA 2F6JA 2KR4A 3EB5A 5LKXA 2LN0A 2FUUA 4LLBA 2EODA 2C2VS 2Y1MA 2DX8A 2LXHC 4WA6A 2I50A 5FB1A 2FUIA 4I7DA 3LQIA 3N9MA 2VJEB 3O7AA 4UP0A 2MIQA 3HCSA 2CT2A 3O34A 3T6RA 5J3XA 2LQ6A 2MNYA 3V43A 2L43A 2XB1A 3RTRB 2K16A 4GB0A 3NG2A 2KFTA 5TDWA 4ZUXU 1IYMA 2H0DB 4C9ZA 3LQHA 5H1VA 1JOCA 4MSXA 2H0DA 4FJCA 2CKLA 4I7BA 4R7EA 1X4JA 3KQIA 3L1XA 4A49A 3LRQA 1G25A 2YUCA 5LKTA 2QICA 4L58A 5LKZA 2JRJA 4YADA 1MM2A 4YBTA 2QJ0A 5D1KB 1T1HA 4GNGA 5AITA 5D1LB 1WEPA 2LGLA 3ZPV1 3N9PA 3O70A 1VD4A 4CA1A 4ZQLA 4B7YC 1E4UA 4YAXA 4A4CA 2JMDA 5H1UA 4LADB 1WEOA 1WEEA 5TABA 2YYRA 3SOUA 4R2YA 3L1ZB 2M1RA 3GL6A 2VP7A 3O36A 2MA5A 2M3HA 1DVPA 3C5KA 4XI1A 5DINA 3U5OA 3ZTGA 2KU3A 4CCGX 1FBVA 2KWNA 5KH7A 5B79A 2EA6A 1WENA 4X3GA 5H1TA 4UI9B 3HTKC 2MT5A 3M62A 2RSDA 3L11A 3RPGB 2ECJA 2LV9A 1K2FA 2G43A 2K4DA 2YU4A 5B78A 5LCWB 4F52B 5D1MB 4AP4A 2ECVA 3GV4A 2ECNA 1Z6UA 2KWOA 1VYXA 3PHDA 4NN2A 4YBMA 3HCUA 1Z2QA 4R8PK 1WEWA 3RPGC 1WEVA 2VJEA 2L5UA 1WIMA 2LXPC 5TRBA 2LRIC 2VPDA 4QF2A 3ZPVE 4GNDA 1LDKC 5I3LA 4QF3A 2QIZA 1F62A 3PUQA 1CHCA 2YQMA 3T7LA 4V3KC 3QZVA 2HYED 4WZ0A 2KE1A 1BORA 2EGPA 1HYJA 4GNFA 2LGKA 3DQVR 2F42A 3KV5A 5C13A 4ZDTA 1WILA 4A0CD 3SHBA 2CSYA 1JM7B 1RMDA 2UZGA 3N9NA 4A4BA 3U5MA 3KV6A 3I2DA 2YHNA 4UP5A 1JM7A 2MD7B 2JMIA 4LJNA 4BBQA 5FEYA 4YC9A 2IDAA 2L0BA 3O35A 5AIUA 5DKAA 2L75A 2YHOA 2YREA 1WEMA 3M99A 4P5OB 4AVXA 3ZYQA 5FERA 1X4UA 3M63A 2E6RA 2G45A 2PNXA 3O33A 3U5PA 2C2LA 2XEUA 3PURA 1WGMA 2OXQC 4PPEA 3MHHA 3ZVZB 4AYCB 2ECWA 1U6GB 5EYAF 2HDPA 2ECGA 1N87A 2YURA 2YT5A 3SOXA 2KGIA 2MA6A 4L7XA 5G04B 4B86C 1Z60A 1WESA 2PUYA 2KGGA 2VPGA 2LGVA 4W4UA 5H9MA 4LK9A 2KYUA 3C6WA 4YBSA 2Y1NA 2L80A 3ZNIA 2ZETC 2Y43A 3IHPA 1ZBDB 2MUMA 5LKUA 4BHWA 2D8SA 3FL2A 5B76A 2F6NA 3HCTA 5KH3A 4I7CA 1WEUA 1V87A 5G05B 2NAAA 5B8DA 2VNFA 2LDRA 4O64A 5C11A 3LQJA 3MHSA 4FIPA 2JMJA 4S3OC 3U5NA 1WEQA 4GNEA 3ZVYA 4LKAA 1X4IA 1MM3A 4TKPB 2CKLB 5B77A 4WZ3B 2ECIA 2VPEA 4IC2A 4FO9A 5JG6A 1WFKA 3N9QA 1LDJB 2YQLA 1FP0A 3N9LA 3EB6A 4N4FA 4YATA 2M6MA 2AN6A 5FB0A 2KREA 2VPBA 4V3LC 4YABA 2ECTA 4IC3A 2VJFB 1VFYA 4Q6FA 3ASLA 2K1JA 3O37A 5TBNA 2VJFA 4N3WA 2KWJA 1XWHA 2M85A 5TDRA 2YSJA 1HYIA 2E6SA 4WZ2A 2MD8C 2YSMA 3VK6A 2MNZA 4AYCA 2CSZA 2G6QA 2LGGA 5G0FA 1WE9A 2K17A 5KH9A 2KWKA 4FK5A 2FSAA 4AUQB 3DPLR 2KIZA 3SOWA 2YW8A
chains in the Genus database with same CATH superfamily
5B75A 4MVTA 2BAYA 2RI7A 3KNVA 4S3OB 3N9OA 4PTBA 2F6JA 2KR4A 3EB5A 5LKXA 2LN0A 2FUUA 4LLBA 2L7PA 2EODA 2C2VS 2Y1MA 2YVRA 3Q1DA 2DX8A 2LXHC 4WA6A 2CRRA 4F1PA 2I50A 5FB1A 2FUIA 4I7DA 3LQIA 3N9MA 2VJEB 3O7AA 4UP0A 2MIQA 3HCSA 2CT2A 3O34A 3T6RA 2D8UA 5J3XA 2LQ6A 2MNYA 3V43A 2L43A 2XB1A 3RTRB 2K16A 4GB0A 3NG2A 2KFTA 5TDWA 4ZUXU 1IYMA 2H0DB 4C9ZA 3LQHA 5H1VA 1JOCA 4MSXA 2H0DA 4FJCA 2CKLA 4I7BA 4R7EA 1X4JA 3KQIA 3L1XA 4A49A 3LRQA 1G25A 2YUCA 4O62A 5LKTA 2QICA 4L58A 5LKZA 2JRJA 4YADA 1MM2A 4YBTA 2QJ0A 5D1KB 3T9KA 2MKEA 1T1HA 4GNGA 5AITA 5D1LB 1WEPA 2LGLA 2EXUA 3ZPV1 3N9PA 3O70A 1VD4A 4CA1A 4ZQLA 4B7YC 1E4UA 4YAXA 4A4CA 2JMDA 5H1UA 4LADB 3SUBA 1WEOA 1WEEA 5TABA 2YYRA 3SOUA 2RR4A 4R2YA 3L1ZB 2M1RA 3GL6A 2VP7A 3O36A 2MA5A 2M3HA 1DVPA 3C5KA 4XI1A 5DINA 3U5OA 3M7KA 3ZTGA 2KU3A 4CCGX 2CRWA 1FBVA 2KWNA 5KH7A 5B79A 2EA6A 1WENA 4X3GA 5K3QA 5H1TA 4UI9B 3HTKC 2MT5A 3M62A 2IQJA 2RSDA 2KKXA 3L11A 3RPGB 2ECJA 2XP0A 2LV9A 1K2FA 2G43A 2K4DA 2YU4A 5B78A 5LCWB 4F52B 5D1MB 4AP4A 3PLWA 2ECVA 3GV4A 5SVIB 3JUEA 2ECNA 1Z6UA 2KWOA 1VYXA 3PHDA 4NN2A 4YBMA 4OGCA 3HCUA 1Z2QA 4R8PK 1WEWA 3RPGC 1WEVA 3FANA 2VJEA 2L5UA 1WIMA 2LXPC 3FEHA 5TRBA 2LRIC 2VPDA 2XOYA 4QF2A 3ZPVE 5SVXA 4GNDA 1LDKC 5I3LA 3LVQE 4QF3A 2QIZA 1F62A 3PUQA 2JUNA 1CHCA 2YQMA 3FJUB 3T7LA 4V3KC 3QZVA 2HYED 4WZ0A 3LJUX 2KE1A 1BORA 2EGPA 1HYJA 4GNFA 2LGKA 3DQVR 2F42A 3KV5A 5C13A 4ZDTA 1WILA 3MDBC 4A0CD 3SHBA 2E61A 1MBMA 2CSYA 1RMDA 1JM7B 2UZGA 3N9NA 4A4BA 3U5MA 3KV6A 2EGMA 3I2DA 2YHNA 4UP5A 1JM7A 2MD7B 2JMIA 4LJNA 4BBQA 5FEYA 4YC9A 2IDAA 2L0BA 3O35A 3H7HA 5AIUA 5DKAA 2L75A 2YHOA 2YREA 1WEMA 4Z0RA 3M99A 4P5OB 4AVXA 3ZYQA 5FERA 1X4UA 3M63A 2E6RA 2JM3A 2G45A 2PNXA 3O33A 3U5PA 2C2LA 2XEUA 2FFWA 3PURA 1WGMA 2OXQC 4PPEA 3MHHA 3SOWA 5SVYA 3ZVZB 4AYCB 2ECWA 1U6GB 5EYAF 2XOCA 4QQ4A 2HDPA 2ECGA 1N87A 2YURA 2YT5A 3SOXA 2KGIA 2MA6A 4L7XA 5G04B 4B86C 1Z60A 1WESA 3LDYA 2PUYA 2KGGA 2VPGA 2LGVA 4W4UA 5H9MA 4LK9A 2KYUA 3C6WA 3LVRE 4YBSA 2M13A 2Y1NA 2L80A 3ZNIA 2ZETC 2Y43A 3IHPA 1ZBDB 5SVIA 2MUMA 2OWAA 5LKUA 2FD4A 4BHWA 2D8SA 3FL2A 5B76A 2F6NA 2CONA 3HCTA 5KH3A 4I7CA 1WEUA 1V87A 5G05B 2CSVA 2NAAA 5B8DA 1DCQA 2VNFA 2LDRA 2KKYA 4O64A 4Z0OA 5C11A 3LQJA 3MHSA 4FIPA 2JMJA 4S3OC 3U5NA 4GNEA 3ZVYA 4LKAA 1X4IA 1MM3A 3KDEC 4TKPB 2CKLB 5B77A 3FM8C 4WZ3B 3O47A 2ECIA 2VPEA 4IC2A 4FO9A 5JG6A 1WFKA 3N9QA 1LDJB 2XOZA 3FAOA 2YQLA 1FP0A 2LAUA 3N9LA 3EB6A 4N4FA 4YATA 2M6MA 2AN6A 2KREA 2VPBA 4V3LC 5FB0A 4YABA 2ECTA 4OGEA 4IC3A 2B0OE 2VJFB 1VFYA 4Q6FA 3ASLA 2K1JA 3O37A 5TBNA 2VJFA 4N3WA 2KWJA 4H9DA 1XWHA 2M85A 5TDRA 2YSJA 1HYIA 2DSMA 2E6SA 4WZ2A 3DWDA 2MD8C 3E2DA 2YSMA 3VK6A 2MNZA 4AYCA 2DJAA 2CSZA 2G6QA 2P57A 3DDTA 2LGGA 5G0FA 1WE9A 2K17A 5KH9A 2KWKA 4FK5A 2FSAA 4AUQB 3DPLR 2KIZA 1WEQA 2YW8A
chains in the Genus database with same CATH topology
5B75A 4MVTA 2BAYA 2RI7A 3KNVA 4S3OB 3N9OA 4PTBA 2F6JA 2KR4A 3EB5A 5LKXA 2LN0A 2FUUA 4LLBA 2EODA 2C2VS 2Y1MA 2DX8A 2LXHC 4WA6A 2I50A 5FB1A 2FUIA 4I7DA 3LQIA 3N9MA 2VJEB 3O7AA 4UP0A 2MIQA 3HCSA 2CT2A 3O34A 3T6RA 5J3XA 2LQ6A 2MNYA 3V43A 2L43A 2XB1A 3RTRB 2K16A 4GB0A 3NG2A 2KFTA 5TDWA 4ZUXU 1IYMA 2H0DB 4C9ZA 3LQHA 5H1VA 1JOCA 4MSXA 2H0DA 4FJCA 2CKLA 4I7BA 4R7EA 1X4JA 3KQIA 3L1XA 4A49A 3LRQA 1G25A 2YUCA 5LKTA 2QICA 4L58A 5LKZA 2JRJA 4YADA 1MM2A 4YBTA 2QJ0A 5D1KB 1T1HA 4GNGA 5AITA 5D1LB 1WEPA 2LGLA 3ZPV1 3N9PA 3O70A 1VD4A 4CA1A 4ZQLA 4B7YC 1E4UA 4YAXA 4A4CA 2JMDA 5H1UA 4LADB 1WEOA 1WEEA 5TABA 2YYRA 3SOUA 4R2YA 3L1ZB 2M1RA 3GL6A 2VP7A 3O36A 2MA5A 2M3HA 1DVPA 3C5KA 4XI1A 5DINA 3U5OA 3ZTGA 2KU3A 4CCGX 1FBVA 2KWNA 5KH7A 5B79A 2EA6A 1WENA 4X3GA 5H1TA 4UI9B 3HTKC 2MT5A 3M62A 2RSDA 3L11A 3RPGB 2ECJA 2LV9A 1K2FA 2G43A 2K4DA 2YU4A 5B78A 5LCWB 4F52B 5D1MB 4AP4A 2ECVA 3GV4A 2ECNA 1Z6UA 2KWOA 1VYXA 3PHDA 4NN2A 4YBMA 3HCUA 1Z2QA 4R8PK 1WEWA 3RPGC 1WEVA 2VJEA 2L5UA 1WIMA 2LXPC 5TRBA 2LRIC 2VPDA 4QF2A 3ZPVE 4GNDA 1LDKC 5I3LA 4QF3A 2QIZA 1F62A 3PUQA 1CHCA 2YQMA 3T7LA 4V3KC 3QZVA 2HYED 4WZ0A 2KE1A 1BORA 2EGPA 1HYJA 4GNFA 2LGKA 3DQVR 2F42A 3KV5A 5C13A 4ZDTA 1WILA 4A0CD 3SHBA 2CSYA 1JM7B 1RMDA 2UZGA 3N9NA 4A4BA 3U5MA 3KV6A 3I2DA 2YHNA 4UP5A 1JM7A 2MD7B 2JMIA 4LJNA 4BBQA 5FEYA 4YC9A 2IDAA 2L0BA 3O35A 5AIUA 5DKAA 2L75A 2YHOA 2YREA 1WEMA 3M99A 4P5OB 4AVXA 3ZYQA 5FERA 1X4UA 3M63A 2E6RA 2G45A 2PNXA 3O33A 3U5PA 2C2LA 2XEUA 3PURA 1WGMA 2OXQC 4PPEA 3MHHA 3ZVZB 4AYCB 2ECWA 1U6GB 5EYAF 2HDPA 2ECGA 1N87A 2YURA 2YT5A 3SOXA 2KGIA 2MA6A 4L7XA 5G04B 4B86C 1Z60A 1WESA 2PUYA 2KGGA 2VPGA 2LGVA 4W4UA 5H9MA 4LK9A 2KYUA 3C6WA 4YBSA 2Y1NA 2L80A 3ZNIA 2ZETC 2Y43A 3IHPA 1ZBDB 2MUMA 5LKUA 4BHWA 2D8SA 3FL2A 5B76A 2F6NA 3HCTA 5KH3A 4I7CA 1WEUA 1V87A 5G05B 2NAAA 5B8DA 2VNFA 2LDRA 4O64A 5C11A 3LQJA 3MHSA 4FIPA 2JMJA 4S3OC 3U5NA 1WEQA 4GNEA 3ZVYA 4LKAA 1X4IA 1MM3A 4TKPB 2CKLB 5B77A 4WZ3B 2ECIA 2VPEA 4IC2A 4FO9A 5JG6A 1WFKA 3N9QA 1LDJB 2YQLA 1FP0A 3N9LA 3EB6A 4N4FA 4YATA 2M6MA 2AN6A 5FB0A 2KREA 2VPBA 4V3LC 4YABA 2ECTA 4IC3A 2VJFB 1VFYA 4Q6FA 3ASLA 2K1JA 3O37A 5TBNA 2VJFA 4N3WA 2KWJA 1XWHA 2M85A 5TDRA 2YSJA 1HYIA 2E6SA 4WZ2A 2MD8C 2YSMA 3VK6A 2MNZA 4AYCA 2CSZA 2G6QA 2LGGA 5G0FA 1WE9A 2K17A 5KH9A 2KWKA 4FK5A 2FSAA 4AUQB 3DPLR 2KIZA 3SOWA 2YW8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B75 A;  4MVT A;  2BAY A;  2RI7 A;  3KNV A;  4S3O B;  3N9O A;  4PTB A;  2F6J A;  2KR4 A;  3EB5 A;  5LKX A;  2LN0 A;  2FUU A;  4LLB A;  2EOD A;  2C2V S;  2Y1M A;  2DX8 A;  2LXH C;  4WA6 A;  2I50 A;  5FB1 A;  2FUI A;  4I7D A;  3LQI A;  3N9M A;  2VJE B;  3O7A A;  4UP0 A;  2MIQ A;  3HCS A;  2CT2 A;  3O34 A;  3T6R A;  5J3X A;  2LQ6 A;  2MNY A;  3V43 A;  2L43 A;  2XB1 A;  3RTR B;  2K16 A;  4GB0 A;  3NG2 A;  2KFT A;  5TDW A;  4ZUX U;  1IYM A;  2H0D B;  4C9Z A;  3LQH A;  5H1V A;  1JOC A;  4MSX A;  2H0D A;  4FJC A;  2CKL A;  4I7B A;  4R7E A;  1X4J A;  3KQI A;  3L1X A;  4A49 A;  3LRQ A;  1G25 A;  2YUC A;  5LKT A;  2QIC A;  4L58 A;  5LKZ A;  2JRJ A;  4YAD A;  1MM2 A;  4YBT A;  2QJ0 A;  5D1K B;  1T1H A;  4GNG A;  5AIT A;  5D1L B;  1WEP A;  2LGL A;  3ZPV 1;  3N9P A;  3O70 A;  1VD4 A;  4CA1 A;  4ZQL A;  4B7Y C;  1E4U A;  4YAX A;  4A4C A;  2JMD A;  5H1U A;  4LAD B;  1WEO A;  1WEE A;  5TAB A;  2YYR A;  3SOU A;  4R2Y A;  3L1Z B;  2M1R A;  3GL6 A;  2VP7 A;  3O36 A;  2MA5 A;  2M3H A;  1DVP A;  3C5K A;  4XI1 A;  5DIN A;  3U5O A;  3ZTG A;  2KU3 A;  4CCG X;  1FBV A;  2KWN A;  5KH7 A;  5B79 A;  2EA6 A;  1WEN A;  4X3G A;  5H1T A;  4UI9 B;  3HTK C;  2MT5 A;  3M62 A;  2RSD A;  3L11 A;  3RPG B;  2ECJ A;  2LV9 A;  1K2F A;  2G43 A;  2K4D A;  2YU4 A;  5B78 A;  5LCW B;  4F52 B;  5D1M B;  4AP4 A;  2ECV A;  3GV4 A;  2ECN A;  1Z6U A;  2KWO A;  1VYX A;  3PHD A;  4NN2 A;  4YBM A;  3HCU A;  1Z2Q A;  4R8P K;  1WEW A;  3RPG C;  1WEV A;  2VJE A;  2L5U A;  1WIM A;  2LXP C;  5TRB A;  2LRI C;  2VPD A;  4QF2 A;  3ZPV E;  4GND A;  1LDK C;  5I3L A;  4QF3 A;  2QIZ A;  1F62 A;  3PUQ A;  1CHC A;  2YQM A;  3T7L A;  4V3K C;  3QZV A;  2HYE D;  4WZ0 A;  2KE1 A;  1BOR A;  2EGP A;  1HYJ A;  4GNF A;  2LGK A;  3DQV R;  2F42 A;  3KV5 A;  5C13 A;  4ZDT A;  1WIL A;  4A0C D;  3SHB A;  2CSY A;  1JM7 B;  1RMD A;  2UZG A;  3N9N A;  4A4B A;  3U5M A;  3KV6 A;  3I2D A;  2YHN A;  4UP5 A;  1JM7 A;  2MD7 B;  2JMI A;  4LJN A;  4BBQ A;  5FEY A;  4YC9 A;  2IDA A;  2L0B A;  3O35 A;  5AIU A;  5DKA A;  2L75 A;  2YHO A;  2YRE A;  1WEM A;  3M99 A;  4P5O B;  4AVX A;  3ZYQ A;  5FER A;  1X4U A;  3M63 A;  2E6R A;  2G45 A;  2PNX A;  3O33 A;  3U5P A;  2C2L A;  2XEU A;  3PUR A;  1WGM A;  2OXQ C;  4PPE A;  3MHH A;  3ZVZ B;  4AYC B;  2ECW A;  1U6G B;  5EYA F;  2HDP A;  2ECG A;  1N87 A;  2YUR A;  2YT5 A;  3SOX A;  2KGI A;  2MA6 A;  4L7X A;  5G04 B;  4B86 C;  1Z60 A;  1WES A;  2PUY A;  2KGG A;  2VPG A;  2LGV A;  4W4U A;  5H9M A;  4LK9 A;  2KYU A;  3C6W A;  4YBS A;  2Y1N A;  2L80 A;  3ZNI A;  2ZET C;  2Y43 A;  3IHP A;  1ZBD B;  2MUM A;  5LKU A;  4BHW A;  2D8S A;  3FL2 A;  5B76 A;  2F6N A;  3HCT A;  5KH3 A;  4I7C A;  1WEU A;  1V87 A;  5G05 B;  2NAA A;  5B8D A;  2VNF A;  2LDR A;  4O64 A;  5C11 A;  3LQJ A;  3MHS A;  4FIP A;  2JMJ A;  4S3O C;  3U5N A;  1WEQ A;  4GNE A;  3ZVY A;  4LKA A;  1X4I A;  1MM3 A;  4TKP B;  2CKL B;  5B77 A;  4WZ3 B;  2ECI A;  2VPE A;  4IC2 A;  4FO9 A;  5JG6 A;  1WFK A;  3N9Q A;  1LDJ B;  2YQL A;  1FP0 A;  3N9L A;  3EB6 A;  4N4F A;  4YAT A;  2M6M A;  2AN6 A;  5FB0 A;  2KRE A;  2VPB A;  4V3L C;  4YAB A;  2ECT A;  4IC3 A;  2VJF B;  1VFY A;  4Q6F A;  3ASL A;  2K1J A;  3O37 A;  5TBN A;  2VJF A;  4N3W A;  2KWJ A;  1XWH A;  2M85 A;  5TDR A;  2YSJ A;  1HYI A;  2E6S A;  4WZ2 A;  2MD8 C;  2YSM A;  3VK6 A;  2MNZ A;  4AYC A;  2CSZ A;  2G6Q A;  2LGG A;  5G0F A;  1WE9 A;  2K17 A;  5KH9 A;  2KWK A;  4FK5 A;  2FSA A;  4AUQ B;  3DPL R;  2KIZ A;  3SOW A;  2YW8 A; 
#chains in the Genus database with same CATH topology
 5B75 A;  4MVT A;  2BAY A;  2RI7 A;  3KNV A;  4S3O B;  3N9O A;  4PTB A;  2F6J A;  2KR4 A;  3EB5 A;  5LKX A;  2LN0 A;  2FUU A;  4LLB A;  2L7P A;  2EOD A;  2C2V S;  2Y1M A;  2YVR A;  3Q1D A;  2DX8 A;  2LXH C;  4WA6 A;  2CRR A;  4F1P A;  2I50 A;  5FB1 A;  2FUI A;  4I7D A;  3LQI A;  3N9M A;  2VJE B;  3O7A A;  4UP0 A;  2MIQ A;  3HCS A;  2CT2 A;  3O34 A;  3T6R A;  2D8U A;  5J3X A;  2LQ6 A;  2MNY A;  3V43 A;  2L43 A;  2XB1 A;  3RTR B;  2K16 A;  4GB0 A;  3NG2 A;  2KFT A;  5TDW A;  4ZUX U;  1IYM A;  2H0D B;  4C9Z A;  3LQH A;  5H1V A;  1JOC A;  4MSX A;  2H0D A;  4FJC A;  2CKL A;  4I7B A;  4R7E A;  1X4J A;  3KQI A;  3L1X A;  4A49 A;  3LRQ A;  1G25 A;  2YUC A;  4O62 A;  5LKT A;  2QIC A;  4L58 A;  5LKZ A;  2JRJ A;  4YAD A;  1MM2 A;  4YBT A;  2QJ0 A;  5D1K B;  3T9K A;  2MKE A;  1T1H A;  4GNG A;  5AIT A;  5D1L B;  1WEP A;  2LGL A;  2EXU A;  3ZPV 1;  3N9P A;  3O70 A;  1VD4 A;  4CA1 A;  4ZQL A;  4B7Y C;  1E4U A;  4YAX A;  4A4C A;  2JMD A;  5H1U A;  4LAD B;  3SUB A;  1WEO A;  1WEE A;  5TAB A;  2YYR A;  3SOU A;  2RR4 A;  4R2Y A;  3L1Z B;  2M1R A;  3GL6 A;  2VP7 A;  3O36 A;  2MA5 A;  2M3H A;  1DVP A;  3C5K A;  4XI1 A;  5DIN A;  3U5O A;  3M7K A;  3ZTG A;  2KU3 A;  4CCG X;  2CRW A;  1FBV A;  2KWN A;  5KH7 A;  5B79 A;  2EA6 A;  1WEN A;  4X3G A;  5K3Q A;  5H1T A;  4UI9 B;  3HTK C;  2MT5 A;  3M62 A;  2IQJ A;  2RSD A;  2KKX A;  3L11 A;  3RPG B;  2ECJ A;  2XP0 A;  2LV9 A;  1K2F A;  2G43 A;  2K4D A;  2YU4 A;  5B78 A;  5LCW B;  4F52 B;  5D1M B;  4AP4 A;  3PLW A;  2ECV A;  3GV4 A;  5SVI B;  3JUE A;  2ECN A;  1Z6U A;  2KWO A;  1VYX A;  3PHD A;  4NN2 A;  4YBM A;  4OGC A;  3HCU A;  1Z2Q A;  4R8P K;  1WEW A;  3RPG C;  1WEV A;  3FAN A;  2VJE A;  2L5U A;  1WIM A;  2LXP C;  3FEH A;  5TRB A;  2LRI C;  2VPD A;  2XOY A;  4QF2 A;  3ZPV E;  5SVX A;  4GND A;  1LDK C;  5I3L A;  3LVQ E;  4QF3 A;  2QIZ A;  1F62 A;  3PUQ A;  2JUN A;  1CHC A;  2YQM A;  3FJU B;  3T7L A;  4V3K C;  3QZV A;  2HYE D;  4WZ0 A;  3LJU X;  2KE1 A;  1BOR A;  2EGP A;  1HYJ A;  4GNF A;  2LGK A;  3DQV R;  2F42 A;  3KV5 A;  5C13 A;  4ZDT A;  1WIL A;  3MDB C;  4A0C D;  3SHB A;  2E61 A;  1MBM A;  2CSY A;  1RMD A;  1JM7 B;  2UZG A;  3N9N A;  4A4B A;  3U5M A;  3KV6 A;  2EGM A;  3I2D A;  2YHN A;  4UP5 A;  1JM7 A;  2MD7 B;  2JMI A;  4LJN A;  4BBQ A;  5FEY A;  4YC9 A;  2IDA A;  2L0B A;  3O35 A;  3H7H A;  5AIU A;  5DKA A;  2L75 A;  2YHO A;  2YRE A;  1WEM A;  4Z0R A;  3M99 A;  4P5O B;  4AVX A;  3ZYQ A;  5FER A;  1X4U A;  3M63 A;  2E6R A;  2JM3 A;  2G45 A;  2PNX A;  3O33 A;  3U5P A;  2C2L A;  2XEU A;  2FFW A;  3PUR A;  1WGM A;  2OXQ C;  4PPE A;  3MHH A;  3SOW A;  5SVY A;  3ZVZ B;  4AYC B;  2ECW A;  1U6G B;  5EYA F;  2XOC A;  4QQ4 A;  2HDP A;  2ECG A;  1N87 A;  2YUR A;  2YT5 A;  3SOX A;  2KGI A;  2MA6 A;  4L7X A;  5G04 B;  4B86 C;  1Z60 A;  1WES A;  3LDY A;  2PUY A;  2KGG A;  2VPG A;  2LGV A;  4W4U A;  5H9M A;  4LK9 A;  2KYU A;  3C6W A;  3LVR E;  4YBS A;  2M13 A;  2Y1N A;  2L80 A;  3ZNI A;  2ZET C;  2Y43 A;  3IHP A;  1ZBD B;  5SVI A;  2MUM A;  2OWA A;  5LKU A;  2FD4 A;  4BHW A;  2D8S A;  3FL2 A;  5B76 A;  2F6N A;  2CON A;  3HCT A;  5KH3 A;  4I7C A;  1WEU A;  1V87 A;  5G05 B;  2CSV A;  2NAA A;  5B8D A;  1DCQ A;  2VNF A;  2LDR A;  2KKY A;  4O64 A;  4Z0O A;  5C11 A;  3LQJ A;  3MHS A;  4FIP A;  2JMJ A;  4S3O C;  3U5N A;  4GNE A;  3ZVY A;  4LKA A;  1X4I A;  1MM3 A;  3KDE C;  4TKP B;  2CKL B;  5B77 A;  3FM8 C;  4WZ3 B;  3O47 A;  2ECI A;  2VPE A;  4IC2 A;  4FO9 A;  5JG6 A;  1WFK A;  3N9Q A;  1LDJ B;  2XOZ A;  3FAO A;  2YQL A;  1FP0 A;  2LAU A;  3N9L A;  3EB6 A;  4N4F A;  4YAT A;  2M6M A;  2AN6 A;  2KRE A;  2VPB A;  4V3L C;  5FB0 A;  4YAB A;  2ECT A;  4OGE A;  4IC3 A;  2B0O E;  2VJF B;  1VFY A;  4Q6F A;  3ASL A;  2K1J A;  3O37 A;  5TBN A;  2VJF A;  4N3W A;  2KWJ A;  4H9D A;  1XWH A;  2M85 A;  5TDR A;  2YSJ A;  1HYI A;  2DSM A;  2E6S A;  4WZ2 A;  3DWD A;  2MD8 C;  3E2D A;  2YSM A;  3VK6 A;  2MNZ A;  4AYC A;  2DJA A;  2CSZ A;  2G6Q A;  2P57 A;  3DDT A;  2LGG A;  5G0F A;  1WE9 A;  2K17 A;  5KH9 A;  2KWK A;  4FK5 A;  2FSA A;  4AUQ B;  3DPL R;  2KIZ A;  1WEQ A;  2YW8 A; 
#chains in the Genus database with same CATH homology
 5B75 A;  4MVT A;  2BAY A;  2RI7 A;  3KNV A;  4S3O B;  3N9O A;  4PTB A;  2F6J A;  2KR4 A;  3EB5 A;  5LKX A;  2LN0 A;  2FUU A;  4LLB A;  2EOD A;  2C2V S;  2Y1M A;  2DX8 A;  2LXH C;  4WA6 A;  2I50 A;  5FB1 A;  2FUI A;  4I7D A;  3LQI A;  3N9M A;  2VJE B;  3O7A A;  4UP0 A;  2MIQ A;  3HCS A;  2CT2 A;  3O34 A;  3T6R A;  5J3X A;  2LQ6 A;  2MNY A;  3V43 A;  2L43 A;  2XB1 A;  3RTR B;  2K16 A;  4GB0 A;  3NG2 A;  2KFT A;  5TDW A;  4ZUX U;  1IYM A;  2H0D B;  4C9Z A;  3LQH A;  5H1V A;  1JOC A;  4MSX A;  2H0D A;  4FJC A;  2CKL A;  4I7B A;  4R7E A;  1X4J A;  3KQI A;  3L1X A;  4A49 A;  3LRQ A;  1G25 A;  2YUC A;  5LKT A;  2QIC A;  4L58 A;  5LKZ A;  2JRJ A;  4YAD A;  1MM2 A;  4YBT A;  2QJ0 A;  5D1K B;  1T1H A;  4GNG A;  5AIT A;  5D1L B;  1WEP A;  2LGL A;  3ZPV 1;  3N9P A;  3O70 A;  1VD4 A;  4CA1 A;  4ZQL A;  4B7Y C;  1E4U A;  4YAX A;  4A4C A;  2JMD A;  5H1U A;  4LAD B;  1WEO A;  1WEE A;  5TAB A;  2YYR A;  3SOU A;  4R2Y A;  3L1Z B;  2M1R A;  3GL6 A;  2VP7 A;  3O36 A;  2MA5 A;  2M3H A;  1DVP A;  3C5K A;  4XI1 A;  5DIN A;  3U5O A;  3ZTG A;  2KU3 A;  4CCG X;  1FBV A;  2KWN A;  5KH7 A;  5B79 A;  2EA6 A;  1WEN A;  4X3G A;  5H1T A;  4UI9 B;  3HTK C;  2MT5 A;  3M62 A;  2RSD A;  3L11 A;  3RPG B;  2ECJ A;  2LV9 A;  1K2F A;  2G43 A;  2K4D A;  2YU4 A;  5B78 A;  5LCW B;  4F52 B;  5D1M B;  4AP4 A;  2ECV A;  3GV4 A;  2ECN A;  1Z6U A;  2KWO A;  1VYX A;  3PHD A;  4NN2 A;  4YBM A;  3HCU A;  1Z2Q A;  4R8P K;  1WEW A;  3RPG C;  1WEV A;  2VJE A;  2L5U A;  1WIM A;  2LXP C;  5TRB A;  2LRI C;  2VPD A;  4QF2 A;  3ZPV E;  4GND A;  1LDK C;  5I3L A;  4QF3 A;  2QIZ A;  1F62 A;  3PUQ A;  1CHC A;  2YQM A;  3T7L A;  4V3K C;  3QZV A;  2HYE D;  4WZ0 A;  2KE1 A;  1BOR A;  2EGP A;  1HYJ A;  4GNF A;  2LGK A;  3DQV R;  2F42 A;  3KV5 A;  5C13 A;  4ZDT A;  1WIL A;  4A0C D;  3SHB A;  2CSY A;  1JM7 B;  1RMD A;  2UZG A;  3N9N A;  4A4B A;  3U5M A;  3KV6 A;  3I2D A;  2YHN A;  4UP5 A;  1JM7 A;  2MD7 B;  2JMI A;  4LJN A;  4BBQ A;  5FEY A;  4YC9 A;  2IDA A;  2L0B A;  3O35 A;  5AIU A;  5DKA A;  2L75 A;  2YHO A;  2YRE A;  1WEM A;  3M99 A;  4P5O B;  4AVX A;  3ZYQ A;  5FER A;  1X4U A;  3M63 A;  2E6R A;  2G45 A;  2PNX A;  3O33 A;  3U5P A;  2C2L A;  2XEU A;  3PUR A;  1WGM A;  2OXQ C;  4PPE A;  3MHH A;  3ZVZ B;  4AYC B;  2ECW A;  1U6G B;  5EYA F;  2HDP A;  2ECG A;  1N87 A;  2YUR A;  2YT5 A;  3SOX A;  2KGI A;  2MA6 A;  4L7X A;  5G04 B;  4B86 C;  1Z60 A;  1WES A;  2PUY A;  2KGG A;  2VPG A;  2LGV A;  4W4U A;  5H9M A;  4LK9 A;  2KYU A;  3C6W A;  4YBS A;  2Y1N A;  2L80 A;  3ZNI A;  2ZET C;  2Y43 A;  3IHP A;  1ZBD B;  2MUM A;  5LKU A;  4BHW A;  2D8S A;  3FL2 A;  5B76 A;  2F6N A;  3HCT A;  5KH3 A;  4I7C A;  1WEU A;  1V87 A;  5G05 B;  2NAA A;  5B8D A;  2VNF A;  2LDR A;  4O64 A;  5C11 A;  3LQJ A;  3MHS A;  4FIP A;  2JMJ A;  4S3O C;  3U5N A;  1WEQ A;  4GNE A;  3ZVY A;  4LKA A;  1X4I A;  1MM3 A;  4TKP B;  2CKL B;  5B77 A;  4WZ3 B;  2ECI A;  2VPE A;  4IC2 A;  4FO9 A;  5JG6 A;  1WFK A;  3N9Q A;  1LDJ B;  2YQL A;  1FP0 A;  3N9L A;  3EB6 A;  4N4F A;  4YAT A;  2M6M A;  2AN6 A;  5FB0 A;  2KRE A;  2VPB A;  4V3L C;  4YAB A;  2ECT A;  4IC3 A;  2VJF B;  1VFY A;  4Q6F A;  3ASL A;  2K1J A;  3O37 A;  5TBN A;  2VJF A;  4N3W A;  2KWJ A;  1XWH A;  2M85 A;  5TDR A;  2YSJ A;  1HYI A;  2E6S A;  4WZ2 A;  2MD8 C;  2YSM A;  3VK6 A;  2MNZ A;  4AYC A;  2CSZ A;  2G6Q A;  2LGG A;  5G0F A;  1WE9 A;  2K17 A;  5KH9 A;  2KWK A;  4FK5 A;  2FSA A;  4AUQ B;  3DPL R;  2KIZ A;  3SOW A;  2YW8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...