2MUMA

Solution structure of the phd domain of yeast yng2
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
50
structure length
50
Chain Sequence
TLYCFCQRVSFGEMVACDGPNCKYEWFHYDCVNLKEPPKGTWYCPECKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chromatin modification-related protein YNG2
publication title Solution structure of the PHD domain of Yeast YNG2
rcsb
source organism Saccharomyces cerevisiae s288c
molecule tags Transcription regulator
total genus 8
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 2014-09-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2mumA00
4FJCA 5LCWB 3O34A 4GNGA 5AITA 2JMIA 3HCUA 3ZVZB 4ZUXU 3GL6A 3PURA 3RPGC 4IC2A 4YATA 2ECIA 2M3HA 2FUIA 4AYCA 4CA1A 1LDJB 4QF2A 4YAXA 5KH3A 2YSMA 2CSZA 2YT5A 3IHPA 2CKLA 1FP0A 2KGGA 2VP7A 5G05B 2XB1A 3T6RA 2K17A 4YBSA 2YYRA 1K2FA 4IC3A 1WENA 2ECNA 2QIZA 5FB1A 4B7YC 3LRQA 4A0CD 5D1KB 2EODA 4R2YA 5G04B 2KFTA 3EB5A 2L43A 2LGKA 3V43A 3LQHA 4ZQLA 5D1MB 2KE1A 2D8SA 4A49A 4I7CA 2MA6A 4I7BA 1RMDA 2Y1NA 3I2DA 4R7EA 2Y43A 3U5NA 4AYCB 5TRBA 2XEUA 4V3LC 1X4JA 1Z2QA 2EA6A 3ZTGA 1X4UA 2K16A 2JRJA 1V87A 2VJEB 5B79A 3KQIA 1MM2A 2C2LA 5D1LB 2Y1MA 2VJFA 1Z6UA 2LGGA 4YC9A 5C13A 4LKAA 4QF3A 2KIZA 4UP0A 2KWOA 5KH7A 2H0DA 4GNDA 2G6QA 5FERA 1WEMA 1DVPA 4L58A 3LQIA 4ZDTA 2M1RA 2M6MA 1XWHA 1WEPA 2MNYA 2VPBA 3NG2A 1LDKC 2G43A 1F62A 2UZGA 2FSAA 1FBVA 5B77A 2YQLA 4FIPA 4C9ZA 2YURA 2YSJA 2ECJA 5TDRA 3HTKC 2KREA 2MD8C 2AN6A 2VJFB 1E4UA 3ZVYA 2KWKA 3SOXA 2IDAA 2YW8A 4BBQA 5J3XA 3KV5A 2LV9A 4FO9A 3O35A 2ECVA 3ZYQA 5AIUA 3HCSA 2JMDA 2KWNA 2RSDA 2YU4A 4GNFA 4B86C 2MT5A 2HYED 5H1VA 2MUMA 3VK6A 1ZBDB 2CSYA 3DPLR 5TABA 4YBMA 4GB0A 3C5KA 3T7LA 4LLBA 4MSXA 2QICA 3N9NA 2ECGA 4A4BA 3M99A 2LDRA 4YADA 2FUUA 4LADB 1WIMA 2MIQA 3ZNIA 2CT2A 2LGLA 1WE9A 2LN0A 4AP4A 1CHCA 2CKLB 1U6GB 5FB0A 5JG6A 1HYIA 1WEWA 4WZ2A 2RI7A 1HYJA 4GNEA 2F6JA 2LXHC 2YQMA 1VYXA 3RPGB 3L11A 3C6WA 2I50A 3SOWA 3O70A 3M63A 3PHDA 4O64A 4BHWA 4AVXA 3MHHA 3N9PA 3PUQA 4LK9A 4PTBA 5H1TA 2YHOA 1JOCA 2KU3A 4P5OB 5LKXA 3RTRB 3EB6A 1VD4A 2LXPC 3O7AA 2KGIA 1WEVA 1Z60A 2KR4A 4N3WA 5KH9A 2C2VS 5DINA 1X4IA 1VFYA 5FEYA 1WFKA 5B75A 3L1XA 3KV6A 3N9LA 2DX8A 5G0FA 3MHSA 2LGVA 3FL2A 2YREA 2QJ0A 5DKAA 4XI1A 5C11A 5B76A 2L80A 3U5MA 5LKTA 5LKUA 2ZETC 2E6RA 1WEOA 5LKZA 2H0DB 2VNFA 3O36A 1T1HA 2KYUA 2YUCA 4NN2A 2VPDA 1JM7A 1MM3A 2LQ6A 5H9MA 5TBNA 2L5UA 2ECTA 5B78A 3O37A 4UI9B 4FK5A 4S3OC 5EYAF 2VJEA 5TDWA 3ZPVE 3HCTA 5B8DA 4V3KC 3ZPV1 4Q6FA 3L1ZB 2KWJA 2VPEA 4I7DA 2YHNA 1IYMA 3SOUA 1WEUA 2OXQC 3N9MA 1WGMA 1G25A 2K1JA 2JMJA 4X3GA 4A4CA 2MD7B 4MVTA 3ASLA 1WESA 4YABA 2ECWA 4AUQB 4WZ3B 3N9QA 4R8PK 1WEEA 4W4UA 2PUYA 4LJNA 2NAAA 1BORA 2L0BA 2L75A 3M62A 5I3LA 1JM7B 3N9OA 1WEQA 2G45A 2K4DA 2BAYA 4PPEA 4CCGX 4YBTA 4L7XA 3GV4A 3KNVA 4WZ0A 2MNZA 3U5OA 2VPGA 3LQJA 2PNXA 1WILA 4S3OB 2M85A 4UP5A 1N87A 2MA5A 5H1UA 2EGPA 4F52B 4WA6A 3SHBA 2F42A 3U5PA 3O33A 2F6NA 3QZVA 2E6SA 2HDPA 4N4FA 2LRIC 4TKPB 3DQVR
chains in the Genus database with same CATH superfamily
4FJCA 5LCWB 3O34A 4GNGA 5AITA 2JMIA 3HCUA 3ZVZB 2CRRA 4ZUXU 3GL6A 3PURA 3RPGC 3LVQE 4IC2A 4YATA 2ECIA 2M3HA 2FUIA 4AYCA 4CA1A 1LDJB 4QF2A 4YAXA 2YVRA 5KH3A 2YSMA 2CSZA 2YT5A 3IHPA 2CKLA 2LAUA 1FP0A 2KGGA 3MDBC 2VP7A 5G05B 3LDYA 2XB1A 3T6RA 2K17A 4YBSA 2YYRA 3SUBA 1K2FA 4IC3A 1WENA 2ECNA 2QIZA 5FB1A 4B7YC 2JUNA 3LRQA 4A0CD 5D1KB 2EODA 4R2YA 5G04B 2KFTA 3LJUX 3EB5A 2L43A 2L7PA 2LGKA 3V43A 3LQHA 4ZQLA 5D1MB 2KE1A 2D8SA 4A49A 2CSVA 4I7CA 2MA6A 4I7BA 1RMDA 2Y1NA 3I2DA 4R7EA 2Y43A 3U5NA 4AYCB 5SVXA 5TRBA 2XEUA 3JUEA 4V3LC 1X4JA 1Z2QA 2EA6A 3T9KA 3ZTGA 1X4UA 2K16A 2JRJA 1V87A 2P57A 2VJEB 3DWDA 5B79A 3KQIA 1MM2A 2C2LA 5D1LB 2Y1MA 2VJFA 1Z6UA 2LGGA 4YC9A 5C13A 4LKAA 3Q1DA 4QF3A 2KIZA 4UP0A 2KWOA 5KH7A 2H0DA 4GNDA 2G6QA 5FERA 1WEMA 1DVPA 4L58A 2XP0A 3LQIA 4ZDTA 2B0OE 2M1RA 2M6MA 1XWHA 1WEPA 2MNYA 2VPBA 2FD4A 3NG2A 1LDKC 2RR4A 2G43A 1F62A 2UZGA 1DCQA 2FSAA 1FBVA 5B77A 2YQLA 4FIPA 4C9ZA 2YURA 2YSJA 2ECJA 5TDRA 3HTKC 2KREA 2MD8C 2AN6A 2VJFB 4OGCA 1E4UA 3ZVYA 2KWKA 3SOXA 2IDAA 2YW8A 4BBQA 2MKEA 5J3XA 3KV5A 2LV9A 4FO9A 3O35A 2ECVA 3ZYQA 5AIUA 3HCSA 2JMDA 3FJUB 2KWNA 2RSDA 2YU4A 4GNFA 4B86C 2MT5A 2HYED 5H1VA 2MUMA 3VK6A 1ZBDB 2CSYA 3DPLR 5TABA 4YBMA 4GB0A 3C5KA 3T7LA 4LLBA 4MSXA 2QICA 4QQ4A 3N9NA 5SVYA 2ECGA 4A4BA 2XOYA 3M99A 4H9DA 2LDRA 4YADA 2FUUA 4LADB 1WIMA 2MIQA 3LVRE 3ZNIA 2CT2A 2LGLA 1WE9A 1MBMA 2LN0A 4AP4A 1CHCA 2CKLB 1U6GB 5FB0A 5JG6A 1HYIA 1WEWA 2OWAA 4WZ2A 2RI7A 1HYJA 4GNEA 2F6JA 2LXHC 3H7HA 2YQMA 1VYXA 3RPGB 3E2DA 3L11A 3C6WA 2I50A 3SOWA 3O70A 3M63A 3PHDA 4O64A 4BHWA 5K3QA 4AVXA 3MHHA 3N9PA 3PUQA 4LK9A 4PTBA 5H1TA 2YHOA 3FAOA 1JOCA 2CONA 2KU3A 4P5OB 5LKXA 3RTRB 3EB6A 1VD4A 2LXPC 3O7AA 2KGIA 1WEVA 2IQJA 1Z60A 2KR4A 4N3WA 5KH9A 2DSMA 2C2VS 5DINA 1X4IA 1VFYA 5FEYA 1WFKA 5B75A 2KKYA 3L1XA 3KV6A 3N9LA 2DX8A 2EGMA 5G0FA 3MHSA 2LGVA 3FL2A 2YREA 2QJ0A 5DKAA 4XI1A 5C11A 5B76A 2L80A 3U5MA 3M7KA 5LKTA 5LKUA 2DJAA 3FM8C 2ZETC 2E6RA 4Z0OA 1WEOA 5LKZA 2H0DB 3FEHA 2VNFA 3O36A 1T1HA 2KYUA 2YUCA 4NN2A 2VPDA 1JM7A 1MM3A 2LQ6A 2D8UA 5SVIA 5H9MA 5TBNA 2L5UA 2ECTA 2XOZA 2XOCA 5B78A 3O37A 4UI9B 4Z0RA 4FK5A 4S3OC 5EYAF 2VJEA 5TDWA 3ZPVE 3FANA 3HCTA 5B8DA 4V3KC 3ZPV1 4Q6FA 3L1ZB 2KWJA 2VPEA 4I7DA 2YHNA 1IYMA 3SOUA 1WEUA 2OXQC 2FFWA 3N9MA 1WGMA 1G25A 2K1JA 2JMJA 4X3GA 4A4CA 2MD7B 4MVTA 3ASLA 1WESA 4YABA 4OGEA 2ECWA 4AUQB 4WZ3B 3N9QA 4R8PK 1WEEA 4W4UA 2PUYA 2M13A 4LJNA 2NAAA 1BORA 2L0BA 2L75A 3M62A 5I3LA 1JM7B 5SVIB 3N9OA 1WEQA 2EXUA 2G45A 3KDEC 2K4DA 2BAYA 4PPEA 2E61A 4CCGX 4YBTA 4L7XA 2JM3A 3GV4A 3KNVA 3O47A 2KKXA 4WZ0A 2MNZA 3U5OA 2VPGA 3PLWA 3LQJA 2PNXA 1WILA 2CRWA 4S3OB 4F1PA 2M85A 4UP5A 1N87A 2MA5A 5H1UA 2EGPA 4F52B 4WA6A 4O62A 3SHBA 2F42A 3U5PA 3DDTA 3O33A 2F6NA 3QZVA 2E6SA 2HDPA 4N4FA 2LRIC 4TKPB 3DQVR
chains in the Genus database with same CATH topology
4FJCA 5LCWB 3O34A 4GNGA 5AITA 2JMIA 3HCUA 3ZVZB 4ZUXU 3GL6A 3PURA 3RPGC 4IC2A 4YATA 2ECIA 2M3HA 2FUIA 4AYCA 4CA1A 1LDJB 4QF2A 4YAXA 5KH3A 2YSMA 2CSZA 2YT5A 3IHPA 2CKLA 1FP0A 2KGGA 2VP7A 5G05B 2XB1A 3T6RA 2K17A 4YBSA 2YYRA 1K2FA 4IC3A 1WENA 2ECNA 2QIZA 5FB1A 4B7YC 3LRQA 4A0CD 5D1KB 2EODA 4R2YA 5G04B 2KFTA 3EB5A 2L43A 2LGKA 3V43A 3LQHA 4ZQLA 5D1MB 2KE1A 2D8SA 4A49A 4I7CA 2MA6A 4I7BA 1RMDA 2Y1NA 3I2DA 4R7EA 2Y43A 3U5NA 4AYCB 5TRBA 2XEUA 4V3LC 1X4JA 1Z2QA 2EA6A 3ZTGA 1X4UA 2K16A 2JRJA 1V87A 2VJEB 5B79A 3KQIA 1MM2A 2C2LA 5D1LB 2Y1MA 2VJFA 1Z6UA 2LGGA 4YC9A 5C13A 4LKAA 4QF3A 2KIZA 4UP0A 2KWOA 5KH7A 2H0DA 4GNDA 2G6QA 5FERA 1WEMA 1DVPA 4L58A 3LQIA 4ZDTA 2M1RA 2M6MA 1XWHA 1WEPA 2MNYA 2VPBA 3NG2A 1LDKC 2G43A 1F62A 2UZGA 2FSAA 1FBVA 5B77A 2YQLA 4FIPA 4C9ZA 2YURA 2YSJA 2ECJA 5TDRA 3HTKC 2KREA 2MD8C 2AN6A 2VJFB 1E4UA 3ZVYA 2KWKA 3SOXA 2IDAA 2YW8A 4BBQA 5J3XA 3KV5A 2LV9A 4FO9A 3O35A 2ECVA 3ZYQA 5AIUA 3HCSA 2JMDA 2KWNA 2RSDA 2YU4A 4GNFA 4B86C 2MT5A 2HYED 5H1VA 2MUMA 3VK6A 1ZBDB 2CSYA 3DPLR 5TABA 4YBMA 4GB0A 3C5KA 3T7LA 4LLBA 4MSXA 2QICA 3N9NA 2ECGA 4A4BA 3M99A 2LDRA 4YADA 2FUUA 4LADB 1WIMA 2MIQA 3ZNIA 2CT2A 2LGLA 1WE9A 2LN0A 4AP4A 1CHCA 2CKLB 1U6GB 5FB0A 5JG6A 1HYIA 1WEWA 4WZ2A 2RI7A 1HYJA 4GNEA 2F6JA 2LXHC 2YQMA 1VYXA 3RPGB 3L11A 3C6WA 2I50A 3SOWA 3O70A 3M63A 3PHDA 4O64A 4BHWA 4AVXA 3MHHA 3N9PA 3PUQA 4LK9A 4PTBA 5H1TA 2YHOA 1JOCA 2KU3A 4P5OB 5LKXA 3RTRB 3EB6A 1VD4A 2LXPC 3O7AA 2KGIA 1WEVA 1Z60A 2KR4A 4N3WA 5KH9A 2C2VS 5DINA 1X4IA 1VFYA 5FEYA 1WFKA 5B75A 3L1XA 3KV6A 3N9LA 2DX8A 5G0FA 3MHSA 2LGVA 3FL2A 2YREA 2QJ0A 5DKAA 4XI1A 5C11A 5B76A 2L80A 3U5MA 5LKTA 5LKUA 2ZETC 2E6RA 1WEOA 5LKZA 2H0DB 2VNFA 3O36A 1T1HA 2KYUA 2YUCA 4NN2A 2VPDA 1JM7A 1MM3A 2LQ6A 5H9MA 5TBNA 2L5UA 2ECTA 5B78A 3O37A 4UI9B 4FK5A 4S3OC 5EYAF 2VJEA 5TDWA 3ZPVE 3HCTA 5B8DA 4V3KC 3ZPV1 4Q6FA 3L1ZB 2KWJA 2VPEA 4I7DA 2YHNA 1IYMA 3SOUA 1WEUA 2OXQC 3N9MA 1WGMA 1G25A 2K1JA 2JMJA 4X3GA 4A4CA 2MD7B 4MVTA 3ASLA 1WESA 4YABA 2ECWA 4AUQB 4WZ3B 3N9QA 4R8PK 1WEEA 4W4UA 2PUYA 4LJNA 2NAAA 1BORA 2L0BA 2L75A 3M62A 5I3LA 1JM7B 3N9OA 1WEQA 2G45A 2K4DA 2BAYA 4PPEA 4CCGX 4YBTA 4L7XA 3GV4A 3KNVA 4WZ0A 2MNZA 3U5OA 2VPGA 3LQJA 2PNXA 1WILA 4S3OB 2M85A 4UP5A 1N87A 2MA5A 5H1UA 2EGPA 4F52B 4WA6A 3SHBA 2F42A 3U5PA 3O33A 2F6NA 3QZVA 2E6SA 2HDPA 4N4FA 2LRIC 4TKPB 3DQVR
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FJC A;  5LCW B;  3O34 A;  4GNG A;  5AIT A;  2JMI A;  3HCU A;  3ZVZ B;  4ZUX U;  3GL6 A;  3PUR A;  3RPG C;  4IC2 A;  4YAT A;  2ECI A;  2M3H A;  2FUI A;  4AYC A;  4CA1 A;  1LDJ B;  4QF2 A;  4YAX A;  5KH3 A;  2YSM A;  2CSZ A;  2YT5 A;  3IHP A;  2CKL A;  1FP0 A;  2KGG A;  2VP7 A;  5G05 B;  2XB1 A;  3T6R A;  2K17 A;  4YBS A;  2YYR A;  1K2F A;  4IC3 A;  1WEN A;  2ECN A;  2QIZ A;  5FB1 A;  4B7Y C;  3LRQ A;  4A0C D;  5D1K B;  2EOD A;  4R2Y A;  5G04 B;  2KFT A;  3EB5 A;  2L43 A;  2LGK A;  3V43 A;  3LQH A;  4ZQL A;  5D1M B;  2KE1 A;  2D8S A;  4A49 A;  4I7C A;  2MA6 A;  4I7B A;  1RMD A;  2Y1N A;  3I2D A;  4R7E A;  2Y43 A;  3U5N A;  4AYC B;  5TRB A;  2XEU A;  4V3L C;  1X4J A;  1Z2Q A;  2EA6 A;  3ZTG A;  1X4U A;  2K16 A;  2JRJ A;  1V87 A;  2VJE B;  5B79 A;  3KQI A;  1MM2 A;  2C2L A;  5D1L B;  2Y1M A;  2VJF A;  1Z6U A;  2LGG A;  4YC9 A;  5C13 A;  4LKA A;  4QF3 A;  2KIZ A;  4UP0 A;  2KWO A;  5KH7 A;  2H0D A;  4GND A;  2G6Q A;  5FER A;  1WEM A;  1DVP A;  4L58 A;  3LQI A;  4ZDT A;  2M1R A;  2M6M A;  1XWH A;  1WEP A;  2MNY A;  2VPB A;  3NG2 A;  1LDK C;  2G43 A;  1F62 A;  2UZG A;  2FSA A;  1FBV A;  5B77 A;  2YQL A;  4FIP A;  4C9Z A;  2YUR A;  2YSJ A;  2ECJ A;  5TDR A;  3HTK C;  2KRE A;  2MD8 C;  2AN6 A;  2VJF B;  1E4U A;  3ZVY A;  2KWK A;  3SOX A;  2IDA A;  2YW8 A;  4BBQ A;  5J3X A;  3KV5 A;  2LV9 A;  4FO9 A;  3O35 A;  2ECV A;  3ZYQ A;  5AIU A;  3HCS A;  2JMD A;  2KWN A;  2RSD A;  2YU4 A;  4GNF A;  4B86 C;  2MT5 A;  2HYE D;  5H1V A;  2MUM A;  3VK6 A;  1ZBD B;  2CSY A;  3DPL R;  5TAB A;  4YBM A;  4GB0 A;  3C5K A;  3T7L A;  4LLB A;  4MSX A;  2QIC A;  3N9N A;  2ECG A;  4A4B A;  3M99 A;  2LDR A;  4YAD A;  2FUU A;  4LAD B;  1WIM A;  2MIQ A;  3ZNI A;  2CT2 A;  2LGL A;  1WE9 A;  2LN0 A;  4AP4 A;  1CHC A;  2CKL B;  1U6G B;  5FB0 A;  5JG6 A;  1HYI A;  1WEW A;  4WZ2 A;  2RI7 A;  1HYJ A;  4GNE A;  2F6J A;  2LXH C;  2YQM A;  1VYX A;  3RPG B;  3L11 A;  3C6W A;  2I50 A;  3SOW A;  3O70 A;  3M63 A;  3PHD A;  4O64 A;  4BHW A;  4AVX A;  3MHH A;  3N9P A;  3PUQ A;  4LK9 A;  4PTB A;  5H1T A;  2YHO A;  1JOC A;  2KU3 A;  4P5O B;  5LKX A;  3RTR B;  3EB6 A;  1VD4 A;  2LXP C;  3O7A A;  2KGI A;  1WEV A;  1Z60 A;  2KR4 A;  4N3W A;  5KH9 A;  2C2V S;  5DIN A;  1X4I A;  1VFY A;  5FEY A;  1WFK A;  5B75 A;  3L1X A;  3KV6 A;  3N9L A;  2DX8 A;  5G0F A;  3MHS A;  2LGV A;  3FL2 A;  2YRE A;  2QJ0 A;  5DKA A;  4XI1 A;  5C11 A;  5B76 A;  2L80 A;  3U5M A;  5LKT A;  5LKU A;  2ZET C;  2E6R A;  1WEO A;  5LKZ A;  2H0D B;  2VNF A;  3O36 A;  1T1H A;  2KYU A;  2YUC A;  4NN2 A;  2VPD A;  1JM7 A;  1MM3 A;  2LQ6 A;  5H9M A;  5TBN A;  2L5U A;  2ECT A;  5B78 A;  3O37 A;  4UI9 B;  4FK5 A;  4S3O C;  5EYA F;  2VJE A;  5TDW A;  3ZPV E;  3HCT A;  5B8D A;  4V3K C;  3ZPV 1;  4Q6F A;  3L1Z B;  2KWJ A;  2VPE A;  4I7D A;  2YHN A;  1IYM A;  3SOU A;  1WEU A;  2OXQ C;  3N9M A;  1WGM A;  1G25 A;  2K1J A;  2JMJ A;  4X3G A;  4A4C A;  2MD7 B;  4MVT A;  3ASL A;  1WES A;  4YAB A;  2ECW A;  4AUQ B;  4WZ3 B;  3N9Q A;  4R8P K;  1WEE A;  4W4U A;  2PUY A;  4LJN A;  2NAA A;  1BOR A;  2L0B A;  2L75 A;  3M62 A;  5I3L A;  1JM7 B;  3N9O A;  1WEQ A;  2G45 A;  2K4D A;  2BAY A;  4PPE A;  4CCG X;  4YBT A;  4L7X A;  3GV4 A;  3KNV A;  4WZ0 A;  2MNZ A;  3U5O A;  2VPG A;  3LQJ A;  2PNX A;  1WIL A;  4S3O B;  2M85 A;  4UP5 A;  1N87 A;  2MA5 A;  5H1U A;  2EGP A;  4F52 B;  4WA6 A;  3SHB A;  2F42 A;  3U5P A;  3O33 A;  2F6N A;  3QZV A;  2E6S A;  2HDP A;  4N4F A;  2LRI C;  4TKP B;  3DQV R; 
#chains in the Genus database with same CATH topology
 4FJC A;  5LCW B;  3O34 A;  4GNG A;  5AIT A;  2JMI A;  3HCU A;  3ZVZ B;  2CRR A;  4ZUX U;  3GL6 A;  3PUR A;  3RPG C;  3LVQ E;  4IC2 A;  4YAT A;  2ECI A;  2M3H A;  2FUI A;  4AYC A;  4CA1 A;  1LDJ B;  4QF2 A;  4YAX A;  2YVR A;  5KH3 A;  2YSM A;  2CSZ A;  2YT5 A;  3IHP A;  2CKL A;  2LAU A;  1FP0 A;  2KGG A;  3MDB C;  2VP7 A;  5G05 B;  3LDY A;  2XB1 A;  3T6R A;  2K17 A;  4YBS A;  2YYR A;  3SUB A;  1K2F A;  4IC3 A;  1WEN A;  2ECN A;  2QIZ A;  5FB1 A;  4B7Y C;  2JUN A;  3LRQ A;  4A0C D;  5D1K B;  2EOD A;  4R2Y A;  5G04 B;  2KFT A;  3LJU X;  3EB5 A;  2L43 A;  2L7P A;  2LGK A;  3V43 A;  3LQH A;  4ZQL A;  5D1M B;  2KE1 A;  2D8S A;  4A49 A;  2CSV A;  4I7C A;  2MA6 A;  4I7B A;  1RMD A;  2Y1N A;  3I2D A;  4R7E A;  2Y43 A;  3U5N A;  4AYC B;  5SVX A;  5TRB A;  2XEU A;  3JUE A;  4V3L C;  1X4J A;  1Z2Q A;  2EA6 A;  3T9K A;  3ZTG A;  1X4U A;  2K16 A;  2JRJ A;  1V87 A;  2P57 A;  2VJE B;  3DWD A;  5B79 A;  3KQI A;  1MM2 A;  2C2L A;  5D1L B;  2Y1M A;  2VJF A;  1Z6U A;  2LGG A;  4YC9 A;  5C13 A;  4LKA A;  3Q1D A;  4QF3 A;  2KIZ A;  4UP0 A;  2KWO A;  5KH7 A;  2H0D A;  4GND A;  2G6Q A;  5FER A;  1WEM A;  1DVP A;  4L58 A;  2XP0 A;  3LQI A;  4ZDT A;  2B0O E;  2M1R A;  2M6M A;  1XWH A;  1WEP A;  2MNY A;  2VPB A;  2FD4 A;  3NG2 A;  1LDK C;  2RR4 A;  2G43 A;  1F62 A;  2UZG A;  1DCQ A;  2FSA A;  1FBV A;  5B77 A;  2YQL A;  4FIP A;  4C9Z A;  2YUR A;  2YSJ A;  2ECJ A;  5TDR A;  3HTK C;  2KRE A;  2MD8 C;  2AN6 A;  2VJF B;  4OGC A;  1E4U A;  3ZVY A;  2KWK A;  3SOX A;  2IDA A;  2YW8 A;  4BBQ A;  2MKE A;  5J3X A;  3KV5 A;  2LV9 A;  4FO9 A;  3O35 A;  2ECV A;  3ZYQ A;  5AIU A;  3HCS A;  2JMD A;  3FJU B;  2KWN A;  2RSD A;  2YU4 A;  4GNF A;  4B86 C;  2MT5 A;  2HYE D;  5H1V A;  2MUM A;  3VK6 A;  1ZBD B;  2CSY A;  3DPL R;  5TAB A;  4YBM A;  4GB0 A;  3C5K A;  3T7L A;  4LLB A;  4MSX A;  2QIC A;  4QQ4 A;  3N9N A;  5SVY A;  2ECG A;  4A4B A;  2XOY A;  3M99 A;  4H9D A;  2LDR A;  4YAD A;  2FUU A;  4LAD B;  1WIM A;  2MIQ A;  3LVR E;  3ZNI A;  2CT2 A;  2LGL A;  1WE9 A;  1MBM A;  2LN0 A;  4AP4 A;  1CHC A;  2CKL B;  1U6G B;  5FB0 A;  5JG6 A;  1HYI A;  1WEW A;  2OWA A;  4WZ2 A;  2RI7 A;  1HYJ A;  4GNE A;  2F6J A;  2LXH C;  3H7H A;  2YQM A;  1VYX A;  3RPG B;  3E2D A;  3L11 A;  3C6W A;  2I50 A;  3SOW A;  3O70 A;  3M63 A;  3PHD A;  4O64 A;  4BHW A;  5K3Q A;  4AVX A;  3MHH A;  3N9P A;  3PUQ A;  4LK9 A;  4PTB A;  5H1T A;  2YHO A;  3FAO A;  1JOC A;  2CON A;  2KU3 A;  4P5O B;  5LKX A;  3RTR B;  3EB6 A;  1VD4 A;  2LXP C;  3O7A A;  2KGI A;  1WEV A;  2IQJ A;  1Z60 A;  2KR4 A;  4N3W A;  5KH9 A;  2DSM A;  2C2V S;  5DIN A;  1X4I A;  1VFY A;  5FEY A;  1WFK A;  5B75 A;  2KKY A;  3L1X A;  3KV6 A;  3N9L A;  2DX8 A;  2EGM A;  5G0F A;  3MHS A;  2LGV A;  3FL2 A;  2YRE A;  2QJ0 A;  5DKA A;  4XI1 A;  5C11 A;  5B76 A;  2L80 A;  3U5M A;  3M7K A;  5LKT A;  5LKU A;  2DJA A;  3FM8 C;  2ZET C;  2E6R A;  4Z0O A;  1WEO A;  5LKZ A;  2H0D B;  3FEH A;  2VNF A;  3O36 A;  1T1H A;  2KYU A;  2YUC A;  4NN2 A;  2VPD A;  1JM7 A;  1MM3 A;  2LQ6 A;  2D8U A;  5SVI A;  5H9M A;  5TBN A;  2L5U A;  2ECT A;  2XOZ A;  2XOC A;  5B78 A;  3O37 A;  4UI9 B;  4Z0R A;  4FK5 A;  4S3O C;  5EYA F;  2VJE A;  5TDW A;  3ZPV E;  3FAN A;  3HCT A;  5B8D A;  4V3K C;  3ZPV 1;  4Q6F A;  3L1Z B;  2KWJ A;  2VPE A;  4I7D A;  2YHN A;  1IYM A;  3SOU A;  1WEU A;  2OXQ C;  2FFW A;  3N9M A;  1WGM A;  1G25 A;  2K1J A;  2JMJ A;  4X3G A;  4A4C A;  2MD7 B;  4MVT A;  3ASL A;  1WES A;  4YAB A;  4OGE A;  2ECW A;  4AUQ B;  4WZ3 B;  3N9Q A;  4R8P K;  1WEE A;  4W4U A;  2PUY A;  2M13 A;  4LJN A;  2NAA A;  1BOR A;  2L0B A;  2L75 A;  3M62 A;  5I3L A;  1JM7 B;  5SVI B;  3N9O A;  1WEQ A;  2EXU A;  2G45 A;  3KDE C;  2K4D A;  2BAY A;  4PPE A;  2E61 A;  4CCG X;  4YBT A;  4L7X A;  2JM3 A;  3GV4 A;  3KNV A;  3O47 A;  2KKX A;  4WZ0 A;  2MNZ A;  3U5O A;  2VPG A;  3PLW A;  3LQJ A;  2PNX A;  1WIL A;  2CRW A;  4S3O B;  4F1P A;  2M85 A;  4UP5 A;  1N87 A;  2MA5 A;  5H1U A;  2EGP A;  4F52 B;  4WA6 A;  4O62 A;  3SHB A;  2F42 A;  3U5P A;  3DDT A;  3O33 A;  2F6N A;  3QZV A;  2E6S A;  2HDP A;  4N4F A;  2LRI C;  4TKP B;  3DQV R; 
#chains in the Genus database with same CATH homology
 4FJC A;  5LCW B;  3O34 A;  4GNG A;  5AIT A;  2JMI A;  3HCU A;  3ZVZ B;  4ZUX U;  3GL6 A;  3PUR A;  3RPG C;  4IC2 A;  4YAT A;  2ECI A;  2M3H A;  2FUI A;  4AYC A;  4CA1 A;  1LDJ B;  4QF2 A;  4YAX A;  5KH3 A;  2YSM A;  2CSZ A;  2YT5 A;  3IHP A;  2CKL A;  1FP0 A;  2KGG A;  2VP7 A;  5G05 B;  2XB1 A;  3T6R A;  2K17 A;  4YBS A;  2YYR A;  1K2F A;  4IC3 A;  1WEN A;  2ECN A;  2QIZ A;  5FB1 A;  4B7Y C;  3LRQ A;  4A0C D;  5D1K B;  2EOD A;  4R2Y A;  5G04 B;  2KFT A;  3EB5 A;  2L43 A;  2LGK A;  3V43 A;  3LQH A;  4ZQL A;  5D1M B;  2KE1 A;  2D8S A;  4A49 A;  4I7C A;  2MA6 A;  4I7B A;  1RMD A;  2Y1N A;  3I2D A;  4R7E A;  2Y43 A;  3U5N A;  4AYC B;  5TRB A;  2XEU A;  4V3L C;  1X4J A;  1Z2Q A;  2EA6 A;  3ZTG A;  1X4U A;  2K16 A;  2JRJ A;  1V87 A;  2VJE B;  5B79 A;  3KQI A;  1MM2 A;  2C2L A;  5D1L B;  2Y1M A;  2VJF A;  1Z6U A;  2LGG A;  4YC9 A;  5C13 A;  4LKA A;  4QF3 A;  2KIZ A;  4UP0 A;  2KWO A;  5KH7 A;  2H0D A;  4GND A;  2G6Q A;  5FER A;  1WEM A;  1DVP A;  4L58 A;  3LQI A;  4ZDT A;  2M1R A;  2M6M A;  1XWH A;  1WEP A;  2MNY A;  2VPB A;  3NG2 A;  1LDK C;  2G43 A;  1F62 A;  2UZG A;  2FSA A;  1FBV A;  5B77 A;  2YQL A;  4FIP A;  4C9Z A;  2YUR A;  2YSJ A;  2ECJ A;  5TDR A;  3HTK C;  2KRE A;  2MD8 C;  2AN6 A;  2VJF B;  1E4U A;  3ZVY A;  2KWK A;  3SOX A;  2IDA A;  2YW8 A;  4BBQ A;  5J3X A;  3KV5 A;  2LV9 A;  4FO9 A;  3O35 A;  2ECV A;  3ZYQ A;  5AIU A;  3HCS A;  2JMD A;  2KWN A;  2RSD A;  2YU4 A;  4GNF A;  4B86 C;  2MT5 A;  2HYE D;  5H1V A;  2MUM A;  3VK6 A;  1ZBD B;  2CSY A;  3DPL R;  5TAB A;  4YBM A;  4GB0 A;  3C5K A;  3T7L A;  4LLB A;  4MSX A;  2QIC A;  3N9N A;  2ECG A;  4A4B A;  3M99 A;  2LDR A;  4YAD A;  2FUU A;  4LAD B;  1WIM A;  2MIQ A;  3ZNI A;  2CT2 A;  2LGL A;  1WE9 A;  2LN0 A;  4AP4 A;  1CHC A;  2CKL B;  1U6G B;  5FB0 A;  5JG6 A;  1HYI A;  1WEW A;  4WZ2 A;  2RI7 A;  1HYJ A;  4GNE A;  2F6J A;  2LXH C;  2YQM A;  1VYX A;  3RPG B;  3L11 A;  3C6W A;  2I50 A;  3SOW A;  3O70 A;  3M63 A;  3PHD A;  4O64 A;  4BHW A;  4AVX A;  3MHH A;  3N9P A;  3PUQ A;  4LK9 A;  4PTB A;  5H1T A;  2YHO A;  1JOC A;  2KU3 A;  4P5O B;  5LKX A;  3RTR B;  3EB6 A;  1VD4 A;  2LXP C;  3O7A A;  2KGI A;  1WEV A;  1Z60 A;  2KR4 A;  4N3W A;  5KH9 A;  2C2V S;  5DIN A;  1X4I A;  1VFY A;  5FEY A;  1WFK A;  5B75 A;  3L1X A;  3KV6 A;  3N9L A;  2DX8 A;  5G0F A;  3MHS A;  2LGV A;  3FL2 A;  2YRE A;  2QJ0 A;  5DKA A;  4XI1 A;  5C11 A;  5B76 A;  2L80 A;  3U5M A;  5LKT A;  5LKU A;  2ZET C;  2E6R A;  1WEO A;  5LKZ A;  2H0D B;  2VNF A;  3O36 A;  1T1H A;  2KYU A;  2YUC A;  4NN2 A;  2VPD A;  1JM7 A;  1MM3 A;  2LQ6 A;  5H9M A;  5TBN A;  2L5U A;  2ECT A;  5B78 A;  3O37 A;  4UI9 B;  4FK5 A;  4S3O C;  5EYA F;  2VJE A;  5TDW A;  3ZPV E;  3HCT A;  5B8D A;  4V3K C;  3ZPV 1;  4Q6F A;  3L1Z B;  2KWJ A;  2VPE A;  4I7D A;  2YHN A;  1IYM A;  3SOU A;  1WEU A;  2OXQ C;  3N9M A;  1WGM A;  1G25 A;  2K1J A;  2JMJ A;  4X3G A;  4A4C A;  2MD7 B;  4MVT A;  3ASL A;  1WES A;  4YAB A;  2ECW A;  4AUQ B;  4WZ3 B;  3N9Q A;  4R8P K;  1WEE A;  4W4U A;  2PUY A;  4LJN A;  2NAA A;  1BOR A;  2L0B A;  2L75 A;  3M62 A;  5I3L A;  1JM7 B;  3N9O A;  1WEQ A;  2G45 A;  2K4D A;  2BAY A;  4PPE A;  4CCG X;  4YBT A;  4L7X A;  3GV4 A;  3KNV A;  4WZ0 A;  2MNZ A;  3U5O A;  2VPG A;  3LQJ A;  2PNX A;  1WIL A;  4S3O B;  2M85 A;  4UP5 A;  1N87 A;  2MA5 A;  5H1U A;  2EGP A;  4F52 B;  4WA6 A;  3SHB A;  2F42 A;  3U5P A;  3O33 A;  2F6N A;  3QZV A;  2E6S A;  2HDP A;  4N4F A;  2LRI C;  4TKP B;  3DQV R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...