1X4IA

Solution structure of phd domain in inhibitor of growth protein 3 (ing3)
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
70
structure length
70
Chain Sequence
GSSGSSGYCICNQVSYGEMVGCDNQDCPIEWFHYGCVGLTEAPKGKWYCPQCTAAMKRRGSRHKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of PHD domain in inhibitor of growth protein 3 (ING3)
rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Inhibitor of growth protein 3
total genus 5
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2005-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1x4iA00
2FUIA 2LXPC 3U5OA 5DKAA 5I3LA 3IHPA 5B75A 2YT5A 3O7AA 2YW8A 4GNGA 5H1UA 2KREA 1X4UA 1MM2A 2VPEA 2I50A 3HCUA 4AVXA 4B7YC 2CSYA 3N9QA 3PHDA 2KWJA 2MA6A 2KGIA 3O37A 5JG6A 4AUQB 3PURA 5LCWB 3ZTGA 3O34A 3HTKC 2LV9A 3ASLA 3VK6A 2K1JA 4WZ2A 2EODA 2L5UA 4QF2A 4X3GA 2M85A 2ECJA 5B79A 4FJCA 3SOXA 2YHOA 1X4IA 4R7EA 2VNFA 2G45A 3M99A 2KWOA 2EGPA 1HYIA 5G04B 3HCSA 3O35A 4GNDA 4XI1A 1FP0A 2DX8A 3N9NA 2M1RA 3KV5A 1WEUA 5LKZA 2MD8C 4YBSA 4L58A 2K4DA 4MSXA 4LKAA 4WZ0A 2YSJA 5LKXA 2PNXA 5B76A 4CCGX 3T6RA 4P5OB 5FERA 5TBNA 3RPGC 3KNVA 4R2YA 1WGMA 5J3XA 2YQLA 2JMDA 2VPGA 4FK5A 2LGGA 5TABA 3N9LA 4F52B 3SOWA 4YADA 3KV6A 4PTBA 2KYUA 4A4BA 2LDRA 4A0CD 5KH7A 1VYXA 2M3HA 1WEMA 2L43A 4TKPB 1WFKA 2BAYA 2QICA 5FB1A 4MVTA 3SHBA 4W4UA 1K2FA 3LQHA 4S3OB 3L1XA 3C6WA 1WEWA 3EB6A 4GNFA 5AITA 2MA5A 4YABA 1WEPA 2VPDA 5G05B 5TDRA 5H9MA 2VJFB 5LKTA 5H1VA 3ZVYA 4O64A 5D1MB 3RPGB 1BORA 2XEUA 4YC9A 3M62A 3SOUA 3HCTA 3NG2A 2JRJA 3GV4A 5TDWA 2LXHC 4NN2A 1IYMA 2OXQC 1JOCA 1JM7B 5AIUA 1VFYA 4AYCB 3MHSA 3U5MA 4YBMA 2JMIA 4QF3A 3O36A 2LGVA 1X4JA 4S3OC 2LGKA 2KWKA 4N3WA 2ECGA 3O70A 4A4CA 2YHNA 4B86C 5KH3A 5B77A 4V3LC 1N87A 2KFTA 3M63A 2YU4A 2H0DB 5KH9A 4PPEA 4ZUXU 2EA6A 2CT2A 5C11A 2YUCA 4I7CA 4A49A 3L1ZB 2YURA 2ZETC 3EB5A 3FL2A 2KU3A 5FB0A 3RTRB 4IC2A 2Y1MA 2RSDA 2YYRA 1Z60A 5DINA 2VJEA 1E4UA 1FBVA 5FEYA 4UP5A 1WEVA 2VP7A 2LN0A 2D8SA 1HYJA 3QZVA 2YREA 1WILA 2MUMA 3T7LA 3LRQA 4LADB 3ZPVE 4LK9A 4YBTA 4L7XA 2C2LA 2G6QA 3GL6A 4YATA 1F62A 5TRBA 2HDPA 4CA1A 4I7BA 1ZBDB 4LLBA 2E6SA 2VJFA 2F6JA 2ECIA 2K16A 4C9ZA 4GB0A 1WEOA 5B8DA 4R8PK 2L75A 5D1KB 2FUUA 3U5NA 1G25A 2Y1NA 5H1TA 2KGGA 3N9MA 5G0FA 2JMJA 2ECWA 1JM7A 1V87A 2NAAA 4AYCA 2FSAA 2KR4A 2RI7A 3V43A 2QJ0A 1WIMA 1U6GB 3MHHA 2QIZA 1LDJB 2F42A 4AP4A 2MIQA 4ZDTA 4BBQA 2CKLA 2MNYA 2KIZA 1DVPA 2CSZA 1T1HA 2XB1A 1Z6UA 2H0DA 3DPLR 4WZ3B 2LRIC 2MNZA 2L0BA 3KQIA 4ZQLA 4IC3A 3ZNIA 4Q6FA 3N9OA 3U5PA 4FO9A 4BHWA 5LKUA 2LGLA 2PUYA 3ZPV1 1Z2QA 2G43A 2C2VS 4LJNA 4N4FA 2MD7B 2ECNA 2YSMA 4UP0A 3ZVZB 2CKLB 2VPBA 1WEEA 5B78A 1WE9A 2VJEB 2K17A 4FIPA 1WEQA 2IDAA 2UZGA 2YQMA 1WESA 3DQVR 2ECVA 5C13A 3ZYQA 2MT5A 1CHCA 3LQJA 5EYAF 2ECTA 4YAXA 2HYED 1RMDA 2KWNA 2AN6A 3C5KA 3PUQA 3O33A 3L11A 2LQ6A 2KE1A 4GNEA 2L80A 1LDKC 2M6MA 1MM3A 3LQIA 3N9PA 4UI9B 2Y43A 2F6NA 1WENA 5D1LB 4I7DA 1XWHA 4WA6A 3I2DA 2E6RA 1VD4A 4V3KC
chains in the Genus database with same CATH superfamily
2FUIA 2LXPC 3T9KA 3U5OA 5DKAA 5I3LA 3IHPA 1DCQA 5B75A 2YT5A 3O7AA 2YW8A 2OWAA 4GNGA 5H1UA 2KREA 1X4UA 2KKYA 1MM2A 2VPEA 2I50A 2JM3A 3JUEA 2XOCA 3HCUA 4AVXA 4O62A 4B7YC 2CSYA 3N9QA 3PHDA 2KWJA 2MA6A 2KGIA 3O37A 3DWDA 4AUQB 5JG6A 3PURA 2IQJA 5LCWB 3ZTGA 3Q1DA 3O34A 3HTKC 3LDYA 2XOYA 2LV9A 3ASLA 3VK6A 4WZ2A 2K1JA 2EODA 2L5UA 4QF2A 2L7PA 3MDBC 4X3GA 2M85A 2ECJA 5B79A 4FJCA 3SOXA 2YHOA 1X4IA 4R7EA 2XOZA 2VNFA 2G45A 3M99A 2KKXA 2KWOA 2EGPA 1HYIA 5G04B 3HCSA 3O35A 4GNDA 4XI1A 1FP0A 2DX8A 3N9NA 2M1RA 3KV5A 1WEUA 5LKZA 2MD8C 4YBSA 4L58A 2K4DA 4MSXA 4LKAA 4WZ0A 2YSJA 5LKXA 2PNXA 5B76A 4CCGX 3T6RA 4P5OB 5FERA 5TBNA 3RPGC 3KNVA 4R2YA 1WGMA 5J3XA 2YQLA 2JMDA 2VPGA 4FK5A 2LGGA 5TABA 2P57A 3N9LA 4F52B 3SOWA 4YADA 3KV6A 4PTBA 2KYUA 4A4BA 2LDRA 4A0CD 5KH7A 1VYXA 2M3HA 2XP0A 1WEMA 3FM8C 2L43A 4TKPB 1WFKA 2BAYA 2QICA 5FB1A 4MVTA 3KDEC 3SHBA 4W4UA 1K2FA 3LQHA 4S3OB 3L1XA 2DJAA 3C6WA 1WEWA 3EB6A 4GNFA 5AITA 2MA5A 4YABA 1WEPA 2VPDA 5G05B 3FEHA 5TDRA 5H9MA 2VJFB 5LKTA 5H1VA 5SVYA 3ZVYA 4O64A 5D1MB 3H7HA 3RPGB 1BORA 2XEUA 4YC9A 3M62A 3SOUA 3HCTA 3NG2A 2JRJA 3GV4A 5TDWA 3PLWA 2LXHC 4NN2A 5SVXA 1IYMA 2OXQC 1JOCA 1JM7B 5AIUA 1VFYA 4AYCB 3MHSA 3U5MA 4YBMA 3LVRE 2JMIA 4QF3A 3O36A 2LGVA 1X4JA 4S3OC 2LGKA 2KWKA 4N3WA 2ECGA 3O70A 4A4CA 2YHNA 4B86C 5KH3A 5B77A 3LJUX 4V3LC 1N87A 2KFTA 3M63A 2YU4A 2H0DB 5SVIA 5KH9A 3FAOA 4PPEA 4ZUXU 2EA6A 4H9DA 2CT2A 5C11A 2YUCA 4I7CA 4A49A 3L1ZB 2YURA 2ZETC 3EB5A 3FANA 4QQ4A 3FL2A 2KU3A 5FB0A 3RTRB 4IC2A 3LVQE 2Y1MA 2RSDA 2YYRA 3DDTA 1Z60A 2LAUA 5DINA 2VJEA 1E4UA 1FBVA 5FEYA 4UP5A 1WEVA 2VP7A 2RR4A 2LN0A 2D8SA 5K3QA 1HYJA 3QZVA 2YREA 1WILA 2MUMA 3T7LA 3LRQA 4LADB 3ZPVE 4LK9A 2DSMA 3FJUB 4YBTA 4L7XA 2C2LA 2G6QA 3GL6A 4YATA 1F62A 5TRBA 2HDPA 4CA1A 4I7BA 1ZBDB 4LLBA 2E6SA 2VJFA 2F6JA 2ECIA 2K16A 4C9ZA 4GB0A 4Z0OA 1WEOA 5B8DA 2E61A 4OGEA 4R8PK 2L75A 4Z0RA 2EXUA 5D1KB 2FD4A 2FUUA 2YVRA 2CRWA 3U5NA 1G25A 2Y1NA 5H1TA 2KGGA 3N9MA 5G0FA 2JMJA 2ECWA 1JM7A 1V87A 2JUNA 2NAAA 4AYCA 2FSAA 2KR4A 2CONA 2M13A 2RI7A 3V43A 2QJ0A 4F1PA 1WIMA 1U6GB 3MHHA 2QIZA 1LDJB 2F42A 4AP4A 2MIQA 2CSVA 4ZDTA 2CKLA 4BBQA 1MBMA 2MNYA 2KIZA 1DVPA 2B0OE 2CSZA 1T1HA 2XB1A 1Z6UA 2H0DA 5SVIB 2MKEA 3DPLR 4WZ3B 2LRIC 2MNZA 3SUBA 2L0BA 3KQIA 4ZQLA 4IC3A 3ZNIA 4Q6FA 3N9OA 3U5PA 4FO9A 4BHWA 5LKUA 2LGLA 2PUYA 3ZPV1 1Z2QA 2G43A 2C2VS 4LJNA 4N4FA 2MD7B 2ECNA 2YSMA 4UP0A 3ZVZB 3M7KA 2CKLB 2VPBA 1WEEA 2EGMA 5B78A 1WE9A 2VJEB 2K17A 4FIPA 1WEQA 2IDAA 2UZGA 2YQMA 1WESA 3DQVR 2ECVA 5C13A 3ZYQA 2MT5A 1CHCA 3LQJA 5EYAF 2ECTA 2D8UA 4YAXA 2HYED 1RMDA 2KWNA 2AN6A 3C5KA 3PUQA 3O33A 3L11A 2LQ6A 4OGCA 2KE1A 4GNEA 2L80A 1LDKC 2M6MA 3E2DA 1MM3A 3LQIA 2CRRA 3N9PA 2FFWA 3O47A 4UI9B 2Y43A 2F6NA 1WENA 5D1LB 4I7DA 1XWHA 4WA6A 3I2DA 2E6RA 1VD4A 4V3KC
chains in the Genus database with same CATH topology
2FUIA 2LXPC 3U5OA 5DKAA 5I3LA 3IHPA 5B75A 2YT5A 3O7AA 2YW8A 4GNGA 5H1UA 2KREA 1X4UA 1MM2A 2VPEA 2I50A 3HCUA 4AVXA 4B7YC 2CSYA 3N9QA 3PHDA 2KWJA 2MA6A 2KGIA 3O37A 5JG6A 4AUQB 3PURA 5LCWB 3ZTGA 3O34A 3HTKC 2LV9A 3ASLA 3VK6A 2K1JA 4WZ2A 2EODA 2L5UA 4QF2A 4X3GA 2M85A 2ECJA 5B79A 4FJCA 3SOXA 2YHOA 1X4IA 4R7EA 2VNFA 2G45A 3M99A 2KWOA 2EGPA 1HYIA 5G04B 3HCSA 3O35A 4GNDA 4XI1A 1FP0A 2DX8A 3N9NA 2M1RA 3KV5A 1WEUA 5LKZA 2MD8C 4YBSA 4L58A 2K4DA 4MSXA 4LKAA 4WZ0A 2YSJA 5LKXA 2PNXA 5B76A 4CCGX 3T6RA 4P5OB 5FERA 5TBNA 3RPGC 3KNVA 4R2YA 1WGMA 5J3XA 2YQLA 2JMDA 2VPGA 4FK5A 2LGGA 5TABA 3N9LA 4F52B 3SOWA 4YADA 3KV6A 4PTBA 2KYUA 4A4BA 2LDRA 4A0CD 5KH7A 1VYXA 2M3HA 1WEMA 2L43A 4TKPB 1WFKA 2BAYA 2QICA 5FB1A 4MVTA 3SHBA 4W4UA 1K2FA 3LQHA 4S3OB 3L1XA 3C6WA 1WEWA 3EB6A 4GNFA 5AITA 2MA5A 4YABA 1WEPA 2VPDA 5G05B 5TDRA 5H9MA 2VJFB 5LKTA 5H1VA 3ZVYA 4O64A 5D1MB 3RPGB 1BORA 2XEUA 4YC9A 3M62A 3SOUA 3HCTA 3NG2A 2JRJA 3GV4A 5TDWA 2LXHC 4NN2A 1IYMA 2OXQC 1JOCA 1JM7B 5AIUA 1VFYA 4AYCB 3MHSA 3U5MA 4YBMA 2JMIA 4QF3A 3O36A 2LGVA 1X4JA 4S3OC 2LGKA 2KWKA 4N3WA 2ECGA 3O70A 4A4CA 2YHNA 4B86C 5KH3A 5B77A 4V3LC 1N87A 2KFTA 3M63A 2YU4A 2H0DB 5KH9A 4PPEA 4ZUXU 2EA6A 2CT2A 5C11A 2YUCA 4I7CA 4A49A 3L1ZB 2YURA 2ZETC 3EB5A 3FL2A 2KU3A 5FB0A 3RTRB 4IC2A 2Y1MA 2RSDA 2YYRA 1Z60A 5DINA 2VJEA 1E4UA 1FBVA 5FEYA 4UP5A 1WEVA 2VP7A 2LN0A 2D8SA 1HYJA 3QZVA 2YREA 1WILA 2MUMA 3T7LA 3LRQA 4LADB 3ZPVE 4LK9A 4YBTA 4L7XA 2C2LA 2G6QA 3GL6A 4YATA 1F62A 5TRBA 2HDPA 4CA1A 4I7BA 1ZBDB 4LLBA 2E6SA 2VJFA 2F6JA 2ECIA 2K16A 4C9ZA 4GB0A 1WEOA 5B8DA 4R8PK 2L75A 5D1KB 2FUUA 3U5NA 1G25A 2Y1NA 5H1TA 2KGGA 3N9MA 5G0FA 2JMJA 2ECWA 1JM7A 1V87A 2NAAA 4AYCA 2FSAA 2KR4A 2RI7A 3V43A 2QJ0A 1WIMA 1U6GB 3MHHA 2QIZA 1LDJB 2F42A 4AP4A 2MIQA 4ZDTA 4BBQA 2CKLA 2MNYA 2KIZA 1DVPA 2CSZA 1T1HA 2XB1A 1Z6UA 2H0DA 3DPLR 4WZ3B 2LRIC 2MNZA 2L0BA 3KQIA 4ZQLA 4IC3A 3ZNIA 4Q6FA 3N9OA 3U5PA 4FO9A 4BHWA 5LKUA 2LGLA 2PUYA 3ZPV1 1Z2QA 2G43A 2C2VS 4LJNA 4N4FA 2MD7B 2ECNA 2YSMA 4UP0A 3ZVZB 2CKLB 2VPBA 1WEEA 5B78A 1WE9A 2VJEB 2K17A 4FIPA 1WEQA 2IDAA 2UZGA 2YQMA 1WESA 3DQVR 2ECVA 5C13A 3ZYQA 2MT5A 1CHCA 3LQJA 5EYAF 2ECTA 4YAXA 2HYED 1RMDA 2KWNA 2AN6A 3C5KA 3PUQA 3O33A 3L11A 2LQ6A 2KE1A 4GNEA 2L80A 1LDKC 2M6MA 1MM3A 3LQIA 3N9PA 4UI9B 2Y43A 2F6NA 1WENA 5D1LB 4I7DA 1XWHA 4WA6A 3I2DA 2E6RA 1VD4A 4V3KC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FUI A;  2LXP C;  3U5O A;  5DKA A;  5I3L A;  3IHP A;  5B75 A;  2YT5 A;  3O7A A;  2YW8 A;  4GNG A;  5H1U A;  2KRE A;  1X4U A;  1MM2 A;  2VPE A;  2I50 A;  3HCU A;  4AVX A;  4B7Y C;  2CSY A;  3N9Q A;  3PHD A;  2KWJ A;  2MA6 A;  2KGI A;  3O37 A;  5JG6 A;  4AUQ B;  3PUR A;  5LCW B;  3ZTG A;  3O34 A;  3HTK C;  2LV9 A;  3ASL A;  3VK6 A;  2K1J A;  4WZ2 A;  2EOD A;  2L5U A;  4QF2 A;  4X3G A;  2M85 A;  2ECJ A;  5B79 A;  4FJC A;  3SOX A;  2YHO A;  1X4I A;  4R7E A;  2VNF A;  2G45 A;  3M99 A;  2KWO A;  2EGP A;  1HYI A;  5G04 B;  3HCS A;  3O35 A;  4GND A;  4XI1 A;  1FP0 A;  2DX8 A;  3N9N A;  2M1R A;  3KV5 A;  1WEU A;  5LKZ A;  2MD8 C;  4YBS A;  4L58 A;  2K4D A;  4MSX A;  4LKA A;  4WZ0 A;  2YSJ A;  5LKX A;  2PNX A;  5B76 A;  4CCG X;  3T6R A;  4P5O B;  5FER A;  5TBN A;  3RPG C;  3KNV A;  4R2Y A;  1WGM A;  5J3X A;  2YQL A;  2JMD A;  2VPG A;  4FK5 A;  2LGG A;  5TAB A;  3N9L A;  4F52 B;  3SOW A;  4YAD A;  3KV6 A;  4PTB A;  2KYU A;  4A4B A;  2LDR A;  4A0C D;  5KH7 A;  1VYX A;  2M3H A;  1WEM A;  2L43 A;  4TKP B;  1WFK A;  2BAY A;  2QIC A;  5FB1 A;  4MVT A;  3SHB A;  4W4U A;  1K2F A;  3LQH A;  4S3O B;  3L1X A;  3C6W A;  1WEW A;  3EB6 A;  4GNF A;  5AIT A;  2MA5 A;  4YAB A;  1WEP A;  2VPD A;  5G05 B;  5TDR A;  5H9M A;  2VJF B;  5LKT A;  5H1V A;  3ZVY A;  4O64 A;  5D1M B;  3RPG B;  1BOR A;  2XEU A;  4YC9 A;  3M62 A;  3SOU A;  3HCT A;  3NG2 A;  2JRJ A;  3GV4 A;  5TDW A;  2LXH C;  4NN2 A;  1IYM A;  2OXQ C;  1JOC A;  1JM7 B;  5AIU A;  1VFY A;  4AYC B;  3MHS A;  3U5M A;  4YBM A;  2JMI A;  4QF3 A;  3O36 A;  2LGV A;  1X4J A;  4S3O C;  2LGK A;  2KWK A;  4N3W A;  2ECG A;  3O70 A;  4A4C A;  2YHN A;  4B86 C;  5KH3 A;  5B77 A;  4V3L C;  1N87 A;  2KFT A;  3M63 A;  2YU4 A;  2H0D B;  5KH9 A;  4PPE A;  4ZUX U;  2EA6 A;  2CT2 A;  5C11 A;  2YUC A;  4I7C A;  4A49 A;  3L1Z B;  2YUR A;  2ZET C;  3EB5 A;  3FL2 A;  2KU3 A;  5FB0 A;  3RTR B;  4IC2 A;  2Y1M A;  2RSD A;  2YYR A;  1Z60 A;  5DIN A;  2VJE A;  1E4U A;  1FBV A;  5FEY A;  4UP5 A;  1WEV A;  2VP7 A;  2LN0 A;  2D8S A;  1HYJ A;  3QZV A;  2YRE A;  1WIL A;  2MUM A;  3T7L A;  3LRQ A;  4LAD B;  3ZPV E;  4LK9 A;  4YBT A;  4L7X A;  2C2L A;  2G6Q A;  3GL6 A;  4YAT A;  1F62 A;  5TRB A;  2HDP A;  4CA1 A;  4I7B A;  1ZBD B;  4LLB A;  2E6S A;  2VJF A;  2F6J A;  2ECI A;  2K16 A;  4C9Z A;  4GB0 A;  1WEO A;  5B8D A;  4R8P K;  2L75 A;  5D1K B;  2FUU A;  3U5N A;  1G25 A;  2Y1N A;  5H1T A;  2KGG A;  3N9M A;  5G0F A;  2JMJ A;  2ECW A;  1JM7 A;  1V87 A;  2NAA A;  4AYC A;  2FSA A;  2KR4 A;  2RI7 A;  3V43 A;  2QJ0 A;  1WIM A;  1U6G B;  3MHH A;  2QIZ A;  1LDJ B;  2F42 A;  4AP4 A;  2MIQ A;  4ZDT A;  4BBQ A;  2CKL A;  2MNY A;  2KIZ A;  1DVP A;  2CSZ A;  1T1H A;  2XB1 A;  1Z6U A;  2H0D A;  3DPL R;  4WZ3 B;  2LRI C;  2MNZ A;  2L0B A;  3KQI A;  4ZQL A;  4IC3 A;  3ZNI A;  4Q6F A;  3N9O A;  3U5P A;  4FO9 A;  4BHW A;  5LKU A;  2LGL A;  2PUY A;  3ZPV 1;  1Z2Q A;  2G43 A;  2C2V S;  4LJN A;  4N4F A;  2MD7 B;  2ECN A;  2YSM A;  4UP0 A;  3ZVZ B;  2CKL B;  2VPB A;  1WEE A;  5B78 A;  1WE9 A;  2VJE B;  2K17 A;  4FIP A;  1WEQ A;  2IDA A;  2UZG A;  2YQM A;  1WES A;  3DQV R;  2ECV A;  5C13 A;  3ZYQ A;  2MT5 A;  1CHC A;  3LQJ A;  5EYA F;  2ECT A;  4YAX A;  2HYE D;  1RMD A;  2KWN A;  2AN6 A;  3C5K A;  3PUQ A;  3O33 A;  3L11 A;  2LQ6 A;  2KE1 A;  4GNE A;  2L80 A;  1LDK C;  2M6M A;  1MM3 A;  3LQI A;  3N9P A;  4UI9 B;  2Y43 A;  2F6N A;  1WEN A;  5D1L B;  4I7D A;  1XWH A;  4WA6 A;  3I2D A;  2E6R A;  1VD4 A;  4V3K C; 
#chains in the Genus database with same CATH topology
 2FUI A;  2LXP C;  3T9K A;  3U5O A;  5DKA A;  5I3L A;  3IHP A;  1DCQ A;  5B75 A;  2YT5 A;  3O7A A;  2YW8 A;  2OWA A;  4GNG A;  5H1U A;  2KRE A;  1X4U A;  2KKY A;  1MM2 A;  2VPE A;  2I50 A;  2JM3 A;  3JUE A;  2XOC A;  3HCU A;  4AVX A;  4O62 A;  4B7Y C;  2CSY A;  3N9Q A;  3PHD A;  2KWJ A;  2MA6 A;  2KGI A;  3O37 A;  3DWD A;  4AUQ B;  5JG6 A;  3PUR A;  2IQJ A;  5LCW B;  3ZTG A;  3Q1D A;  3O34 A;  3HTK C;  3LDY A;  2XOY A;  2LV9 A;  3ASL A;  3VK6 A;  4WZ2 A;  2K1J A;  2EOD A;  2L5U A;  4QF2 A;  2L7P A;  3MDB C;  4X3G A;  2M85 A;  2ECJ A;  5B79 A;  4FJC A;  3SOX A;  2YHO A;  1X4I A;  4R7E A;  2XOZ A;  2VNF A;  2G45 A;  3M99 A;  2KKX A;  2KWO A;  2EGP A;  1HYI A;  5G04 B;  3HCS A;  3O35 A;  4GND A;  4XI1 A;  1FP0 A;  2DX8 A;  3N9N A;  2M1R A;  3KV5 A;  1WEU A;  5LKZ A;  2MD8 C;  4YBS A;  4L58 A;  2K4D A;  4MSX A;  4LKA A;  4WZ0 A;  2YSJ A;  5LKX A;  2PNX A;  5B76 A;  4CCG X;  3T6R A;  4P5O B;  5FER A;  5TBN A;  3RPG C;  3KNV A;  4R2Y A;  1WGM A;  5J3X A;  2YQL A;  2JMD A;  2VPG A;  4FK5 A;  2LGG A;  5TAB A;  2P57 A;  3N9L A;  4F52 B;  3SOW A;  4YAD A;  3KV6 A;  4PTB A;  2KYU A;  4A4B A;  2LDR A;  4A0C D;  5KH7 A;  1VYX A;  2M3H A;  2XP0 A;  1WEM A;  3FM8 C;  2L43 A;  4TKP B;  1WFK A;  2BAY A;  2QIC A;  5FB1 A;  4MVT A;  3KDE C;  3SHB A;  4W4U A;  1K2F A;  3LQH A;  4S3O B;  3L1X A;  2DJA A;  3C6W A;  1WEW A;  3EB6 A;  4GNF A;  5AIT A;  2MA5 A;  4YAB A;  1WEP A;  2VPD A;  5G05 B;  3FEH A;  5TDR A;  5H9M A;  2VJF B;  5LKT A;  5H1V A;  5SVY A;  3ZVY A;  4O64 A;  5D1M B;  3H7H A;  3RPG B;  1BOR A;  2XEU A;  4YC9 A;  3M62 A;  3SOU A;  3HCT A;  3NG2 A;  2JRJ A;  3GV4 A;  5TDW A;  3PLW A;  2LXH C;  4NN2 A;  5SVX A;  1IYM A;  2OXQ C;  1JOC A;  1JM7 B;  5AIU A;  1VFY A;  4AYC B;  3MHS A;  3U5M A;  4YBM A;  3LVR E;  2JMI A;  4QF3 A;  3O36 A;  2LGV A;  1X4J A;  4S3O C;  2LGK A;  2KWK A;  4N3W A;  2ECG A;  3O70 A;  4A4C A;  2YHN A;  4B86 C;  5KH3 A;  5B77 A;  3LJU X;  4V3L C;  1N87 A;  2KFT A;  3M63 A;  2YU4 A;  2H0D B;  5SVI A;  5KH9 A;  3FAO A;  4PPE A;  4ZUX U;  2EA6 A;  4H9D A;  2CT2 A;  5C11 A;  2YUC A;  4I7C A;  4A49 A;  3L1Z B;  2YUR A;  2ZET C;  3EB5 A;  3FAN A;  4QQ4 A;  3FL2 A;  2KU3 A;  5FB0 A;  3RTR B;  4IC2 A;  3LVQ E;  2Y1M A;  2RSD A;  2YYR A;  3DDT A;  1Z60 A;  2LAU A;  5DIN A;  2VJE A;  1E4U A;  1FBV A;  5FEY A;  4UP5 A;  1WEV A;  2VP7 A;  2RR4 A;  2LN0 A;  2D8S A;  5K3Q A;  1HYJ A;  3QZV A;  2YRE A;  1WIL A;  2MUM A;  3T7L A;  3LRQ A;  4LAD B;  3ZPV E;  4LK9 A;  2DSM A;  3FJU B;  4YBT A;  4L7X A;  2C2L A;  2G6Q A;  3GL6 A;  4YAT A;  1F62 A;  5TRB A;  2HDP A;  4CA1 A;  4I7B A;  1ZBD B;  4LLB A;  2E6S A;  2VJF A;  2F6J A;  2ECI A;  2K16 A;  4C9Z A;  4GB0 A;  4Z0O A;  1WEO A;  5B8D A;  2E61 A;  4OGE A;  4R8P K;  2L75 A;  4Z0R A;  2EXU A;  5D1K B;  2FD4 A;  2FUU A;  2YVR A;  2CRW A;  3U5N A;  1G25 A;  2Y1N A;  5H1T A;  2KGG A;  3N9M A;  5G0F A;  2JMJ A;  2ECW A;  1JM7 A;  1V87 A;  2JUN A;  2NAA A;  4AYC A;  2FSA A;  2KR4 A;  2CON A;  2M13 A;  2RI7 A;  3V43 A;  2QJ0 A;  4F1P A;  1WIM A;  1U6G B;  3MHH A;  2QIZ A;  1LDJ B;  2F42 A;  4AP4 A;  2MIQ A;  2CSV A;  4ZDT A;  2CKL A;  4BBQ A;  1MBM A;  2MNY A;  2KIZ A;  1DVP A;  2B0O E;  2CSZ A;  1T1H A;  2XB1 A;  1Z6U A;  2H0D A;  5SVI B;  2MKE A;  3DPL R;  4WZ3 B;  2LRI C;  2MNZ A;  3SUB A;  2L0B A;  3KQI A;  4ZQL A;  4IC3 A;  3ZNI A;  4Q6F A;  3N9O A;  3U5P A;  4FO9 A;  4BHW A;  5LKU A;  2LGL A;  2PUY A;  3ZPV 1;  1Z2Q A;  2G43 A;  2C2V S;  4LJN A;  4N4F A;  2MD7 B;  2ECN A;  2YSM A;  4UP0 A;  3ZVZ B;  3M7K A;  2CKL B;  2VPB A;  1WEE A;  2EGM A;  5B78 A;  1WE9 A;  2VJE B;  2K17 A;  4FIP A;  1WEQ A;  2IDA A;  2UZG A;  2YQM A;  1WES A;  3DQV R;  2ECV A;  5C13 A;  3ZYQ A;  2MT5 A;  1CHC A;  3LQJ A;  5EYA F;  2ECT A;  2D8U A;  4YAX A;  2HYE D;  1RMD A;  2KWN A;  2AN6 A;  3C5K A;  3PUQ A;  3O33 A;  3L11 A;  2LQ6 A;  4OGC A;  2KE1 A;  4GNE A;  2L80 A;  1LDK C;  2M6M A;  3E2D A;  1MM3 A;  3LQI A;  2CRR A;  3N9P A;  2FFW A;  3O47 A;  4UI9 B;  2Y43 A;  2F6N A;  1WEN A;  5D1L B;  4I7D A;  1XWH A;  4WA6 A;  3I2D A;  2E6R A;  1VD4 A;  4V3K C; 
#chains in the Genus database with same CATH homology
 2FUI A;  2LXP C;  3U5O A;  5DKA A;  5I3L A;  3IHP A;  5B75 A;  2YT5 A;  3O7A A;  2YW8 A;  4GNG A;  5H1U A;  2KRE A;  1X4U A;  1MM2 A;  2VPE A;  2I50 A;  3HCU A;  4AVX A;  4B7Y C;  2CSY A;  3N9Q A;  3PHD A;  2KWJ A;  2MA6 A;  2KGI A;  3O37 A;  5JG6 A;  4AUQ B;  3PUR A;  5LCW B;  3ZTG A;  3O34 A;  3HTK C;  2LV9 A;  3ASL A;  3VK6 A;  2K1J A;  4WZ2 A;  2EOD A;  2L5U A;  4QF2 A;  4X3G A;  2M85 A;  2ECJ A;  5B79 A;  4FJC A;  3SOX A;  2YHO A;  1X4I A;  4R7E A;  2VNF A;  2G45 A;  3M99 A;  2KWO A;  2EGP A;  1HYI A;  5G04 B;  3HCS A;  3O35 A;  4GND A;  4XI1 A;  1FP0 A;  2DX8 A;  3N9N A;  2M1R A;  3KV5 A;  1WEU A;  5LKZ A;  2MD8 C;  4YBS A;  4L58 A;  2K4D A;  4MSX A;  4LKA A;  4WZ0 A;  2YSJ A;  5LKX A;  2PNX A;  5B76 A;  4CCG X;  3T6R A;  4P5O B;  5FER A;  5TBN A;  3RPG C;  3KNV A;  4R2Y A;  1WGM A;  5J3X A;  2YQL A;  2JMD A;  2VPG A;  4FK5 A;  2LGG A;  5TAB A;  3N9L A;  4F52 B;  3SOW A;  4YAD A;  3KV6 A;  4PTB A;  2KYU A;  4A4B A;  2LDR A;  4A0C D;  5KH7 A;  1VYX A;  2M3H A;  1WEM A;  2L43 A;  4TKP B;  1WFK A;  2BAY A;  2QIC A;  5FB1 A;  4MVT A;  3SHB A;  4W4U A;  1K2F A;  3LQH A;  4S3O B;  3L1X A;  3C6W A;  1WEW A;  3EB6 A;  4GNF A;  5AIT A;  2MA5 A;  4YAB A;  1WEP A;  2VPD A;  5G05 B;  5TDR A;  5H9M A;  2VJF B;  5LKT A;  5H1V A;  3ZVY A;  4O64 A;  5D1M B;  3RPG B;  1BOR A;  2XEU A;  4YC9 A;  3M62 A;  3SOU A;  3HCT A;  3NG2 A;  2JRJ A;  3GV4 A;  5TDW A;  2LXH C;  4NN2 A;  1IYM A;  2OXQ C;  1JOC A;  1JM7 B;  5AIU A;  1VFY A;  4AYC B;  3MHS A;  3U5M A;  4YBM A;  2JMI A;  4QF3 A;  3O36 A;  2LGV A;  1X4J A;  4S3O C;  2LGK A;  2KWK A;  4N3W A;  2ECG A;  3O70 A;  4A4C A;  2YHN A;  4B86 C;  5KH3 A;  5B77 A;  4V3L C;  1N87 A;  2KFT A;  3M63 A;  2YU4 A;  2H0D B;  5KH9 A;  4PPE A;  4ZUX U;  2EA6 A;  2CT2 A;  5C11 A;  2YUC A;  4I7C A;  4A49 A;  3L1Z B;  2YUR A;  2ZET C;  3EB5 A;  3FL2 A;  2KU3 A;  5FB0 A;  3RTR B;  4IC2 A;  2Y1M A;  2RSD A;  2YYR A;  1Z60 A;  5DIN A;  2VJE A;  1E4U A;  1FBV A;  5FEY A;  4UP5 A;  1WEV A;  2VP7 A;  2LN0 A;  2D8S A;  1HYJ A;  3QZV A;  2YRE A;  1WIL A;  2MUM A;  3T7L A;  3LRQ A;  4LAD B;  3ZPV E;  4LK9 A;  4YBT A;  4L7X A;  2C2L A;  2G6Q A;  3GL6 A;  4YAT A;  1F62 A;  5TRB A;  2HDP A;  4CA1 A;  4I7B A;  1ZBD B;  4LLB A;  2E6S A;  2VJF A;  2F6J A;  2ECI A;  2K16 A;  4C9Z A;  4GB0 A;  1WEO A;  5B8D A;  4R8P K;  2L75 A;  5D1K B;  2FUU A;  3U5N A;  1G25 A;  2Y1N A;  5H1T A;  2KGG A;  3N9M A;  5G0F A;  2JMJ A;  2ECW A;  1JM7 A;  1V87 A;  2NAA A;  4AYC A;  2FSA A;  2KR4 A;  2RI7 A;  3V43 A;  2QJ0 A;  1WIM A;  1U6G B;  3MHH A;  2QIZ A;  1LDJ B;  2F42 A;  4AP4 A;  2MIQ A;  4ZDT A;  4BBQ A;  2CKL A;  2MNY A;  2KIZ A;  1DVP A;  2CSZ A;  1T1H A;  2XB1 A;  1Z6U A;  2H0D A;  3DPL R;  4WZ3 B;  2LRI C;  2MNZ A;  2L0B A;  3KQI A;  4ZQL A;  4IC3 A;  3ZNI A;  4Q6F A;  3N9O A;  3U5P A;  4FO9 A;  4BHW A;  5LKU A;  2LGL A;  2PUY A;  3ZPV 1;  1Z2Q A;  2G43 A;  2C2V S;  4LJN A;  4N4F A;  2MD7 B;  2ECN A;  2YSM A;  4UP0 A;  3ZVZ B;  2CKL B;  2VPB A;  1WEE A;  5B78 A;  1WE9 A;  2VJE B;  2K17 A;  4FIP A;  1WEQ A;  2IDA A;  2UZG A;  2YQM A;  1WES A;  3DQV R;  2ECV A;  5C13 A;  3ZYQ A;  2MT5 A;  1CHC A;  3LQJ A;  5EYA F;  2ECT A;  4YAX A;  2HYE D;  1RMD A;  2KWN A;  2AN6 A;  3C5K A;  3PUQ A;  3O33 A;  3L11 A;  2LQ6 A;  2KE1 A;  4GNE A;  2L80 A;  1LDK C;  2M6M A;  1MM3 A;  3LQI A;  3N9P A;  4UI9 B;  2Y43 A;  2F6N A;  1WEN A;  5D1L B;  4I7D A;  1XWH A;  4WA6 A;  3I2D A;  2E6R A;  1VD4 A;  4V3K C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...