1X4IA

Solution structure of phd domain in inhibitor of growth protein 3 (ing3)
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
70
structure length
70
Chain Sequence
GSSGSSGYCICNQVSYGEMVGCDNQDCPIEWFHYGCVGLTEAPKGKWYCPQCTAAMKRRGSRHKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Inhibitor of growth protein 3
publication title Solution structure of PHD domain in inhibitor of growth protein 3 (ING3)
rcsb
source organism Homo sapiens
total genus 5
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2005-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1x4iA00
2K1JA 4ZUXU 2YW8A 3N9LA 4WA6A 5C11A 3HCUA 4AP4A 1ZBDB 3DQVR 1WEUA 4FK5A 4UP0A 4CCGX 5FEYA 1WILA 2CKLA 2LXPC 3ZVYA 1WE9A 1IYMA 2ECJA 3U5OA 3O33A 2KU3A 2YYRA 5LKXA 4S3OC 2LRIC 3KV6A 5EYAF 1X4JA 1N87A 2ZETC 1WEMA 5FERA 2ECTA 2KE1A 1LDJB 2KWJA 5DINA 4WZ0A 4YBTA 2EA6A 4AUQB 5B77A 4W4UA 2HYED 1JOCA 3LQIA 3SOUA 4AYCA 1Z6UA 5B78A 2KGGA 3PURA 2YUCA 3O7AA 4ZDTA 2YQMA 2LN0A 4I7DA 1Z2QA 4PTBA 2KGIA 2JMJA 2ECGA 2MD8C 1WIMA 2F6NA 4L58A 1WESA 1WENA 3L11A 2F6JA 3M62A 3C5KA 4QF2A 1VYXA 1VD4A 2AN6A 4XI1A 4A4BA 4X3GA 5FB1A 3GV4A 3N9OA 3U5NA 1X4IA 2VJFA 4A0CD 2LGKA 5LKUA 2M1RA 3M63A 4GNGA 3QZVA 2XEUA 1WEPA 2G45A 4B7YC 2YT5A 5H9MA 4ZQLA 3O35A 4FO9A 1WEWA 2C2VS 5C13A 5TDWA 5JG6A 3U5MA 1DVPA 1FBVA 2VPDA 3O37A 2C2LA 4R7EA 5DKAA 3EB6A 3L1ZB 2E6SA 2YSJA 1HYJA 5D1LB 3O70A 1FP0A 1E4UA 4IC2A 4FIPA 4LLBA 3HCTA 4R2YA 3LQHA 5H1VA 2L5UA 5D1KB 2IDAA 5D1MB 2YHOA 3T7LA 4QF3A 4I7BA 5KH7A 4R8PK 4N3WA 3V43A 2HDPA 2KWOA 2H0DB 2EODA 1T1HA 4N4FA 2YSMA 1WGMA 2LGGA 2JMDA 3HCSA 3ZVZB 3PHDA 4O64A 3M99A 3MHHA 4I7CA 3DPLR 4MVTA 3FL2A 1CHCA 3ZYQA 2K16A 2YURA 4C9ZA 4LK9A 5B75A 3VK6A 2LQ6A 2K4DA 3IHPA 3N9NA 3MHSA 4F52B 2LXHC 5I3LA 1V87A 4GNFA 4LKAA 3RTRB 5J3XA 3C6WA 2KWNA 2MT5A 4LADB 2Y43A 5FB0A 4V3KC 2VNFA 3ZTGA 1WFKA 4PPEA 5TRBA 2LGVA 5B79A 2ECIA 3EB5A 1WEVA 2ECNA 5TBNA 1WEQA 1MM2A 5H1UA 1Z60A 2MNYA 2D8SA 3SOXA 2CSYA 4MSXA 3GL6A 4AVXA 4YABA 4BHWA 2FUUA 1F62A 1HYIA 2JRJA 3KV5A 5LKTA 1JM7A 4YAXA 2M6MA 4A49A 2KYUA 4NN2A 2H0DA 2VJEB 2PNXA 2UZGA 1G25A 2F42A 4LJNA 3O34A 1JM7B 1BORA 1K2FA 5LCWB 3SHBA 2KFTA 2MIQA 2BAYA 2LDRA 5TABA 4GNDA 2K17A 2OXQC 4A4CA 4WZ3B 2DX8A 3ASLA 2MNZA 2QIZA 2MA5A 2L0BA 2G6QA 1WEEA 2L75A 2VPGA 1RMDA 3U5PA 1XWHA 2E6RA 3NG2A 4UP5A 5LKZA 2KIZA 2LGLA 3T6RA 4YBSA 4Q6FA 2LV9A 2CKLB 4YATA 3N9PA 5KH3A 4GNEA 5H1TA 2CT2A 3RPGC 1MM3A 5B76A 2MUMA 2VPBA 3HTKC 2Y1MA 1LDKC 2MD7B 2QICA 2G43A 5G04B 2M85A 3LQJA 4YC9A 3L1XA 2PUYA 4IC3A 2KWKA 4AYCB 2KR4A 3ZNIA 4YBMA 1U6GB 4BBQA 2Y1NA 2CSZA 5G05B 2YQLA 5B8DA 2YREA 5TDRA 2M3HA 4GB0A 2VPEA 4S3OB 3ZPV1 2YU4A 3LRQA 3KQIA 5AIUA 1VFYA 4B86C 2JMIA 2VJEA 2I50A 2FUIA 2MA6A 2L43A 2NAAA 4WZ2A 5G0FA 3SOWA 2ECVA 4P5OB 2RSDA 2VJFB 3RPGB 4L7XA 2EGPA 4UI9B 3PUQA 1X4UA 3O36A 2ECWA 2VP7A 3ZPVE 2QJ0A 3I2DA 4CA1A 3N9MA 2L80A 1WEOA 2KREA 4V3LC 5KH9A 4FJCA 5AITA 2YHNA 2FSAA 2RI7A 3N9QA 3KNVA 4TKPB 2XB1A 4YADA
chains in the Genus database with same CATH superfamily
2K1JA 4ZUXU 2YW8A 3N9LA 4WA6A 5C11A 2B0OE 3HCUA 2FFWA 2EGMA 4AP4A 1ZBDB 3LVRE 4Z0OA 3DQVR 1WEUA 4FK5A 4UP0A 4CCGX 5FEYA 1WILA 2CKLA 2LXPC 3ZVYA 1WE9A 1IYMA 2ECJA 3U5OA 3O33A 2KU3A 2YYRA 4Z0RA 5LKXA 4S3OC 2LRIC 3KV6A 5EYAF 1X4JA 1N87A 2ZETC 1WEMA 5FERA 2ECTA 2KE1A 1LDJB 2KWJA 5DINA 4WZ0A 4YBTA 3M7KA 2EA6A 4AUQB 5B77A 4W4UA 2CSVA 2HYED 1JOCA 3LQIA 3SOUA 4AYCA 1Z6UA 5B78A 2CRRA 2KGGA 3PURA 2YUCA 3O7AA 4ZDTA 2YQMA 2LN0A 4I7DA 1Z2QA 4PTBA 2KGIA 2JMJA 2ECGA 2MD8C 1WIMA 2F6NA 3O47A 4L58A 1WESA 1WENA 3L11A 2F6JA 3M62A 4QQ4A 3C5KA 4QF2A 1VYXA 1VD4A 2AN6A 4XI1A 4A4BA 4X3GA 5FB1A 3GV4A 3N9OA 3U5NA 1X4IA 2VJFA 4A0CD 2LGKA 5LKUA 2DSMA 2M1RA 3FM8C 3M63A 5SVIA 4GNGA 3QZVA 4F1PA 2XEUA 1WEPA 2G45A 4B7YC 2YT5A 5H9MA 4ZQLA 3O35A 4FO9A 1WEWA 2C2VS 5C13A 5TDWA 5JG6A 3U5MA 1DVPA 1FBVA 2VPDA 3MDBC 3O37A 2C2LA 4R7EA 5DKAA 3EB6A 3L1ZB 2E6SA 2YSJA 1HYJA 4O62A 5D1LB 3O70A 1FP0A 1E4UA 4IC2A 4FIPA 4LLBA 3HCTA 4R2YA 3LQHA 5H1VA 2L5UA 5D1KB 2IDAA 5D1MB 2YHOA 5K3QA 3T7LA 4QF3A 2MKEA 4I7BA 5KH7A 2LAUA 4R8PK 4N3WA 3Q1DA 3V43A 2YVRA 2HDPA 5SVYA 2KWOA 2FD4A 2H0DB 2EODA 1T1HA 4N4FA 2EXUA 2YSMA 1WGMA 2LGGA 2JMDA 3HCSA 5SVXA 3ZVZB 3PHDA 4O64A 3M99A 3LDYA 3MHHA 4I7CA 3DPLR 4MVTA 3FL2A 1CHCA 3ZYQA 2K16A 2YURA 4C9ZA 4LK9A 5B75A 3FJUB 3VK6A 2LQ6A 2K4DA 3IHPA 3N9NA 3MHSA 4F52B 2LXHC 2M13A 5I3LA 1V87A 4GNFA 4LKAA 3RTRB 5J3XA 2JM3A 1DCQA 2OWAA 2L7PA 2KWNA 2MT5A 3C6WA 4LADB 2Y43A 5FB0A 4V3KC 4OGEA 2VNFA 3ZTGA 2D8UA 3DDTA 3FAOA 4OGCA 2IQJA 1WFKA 4PPEA 5TRBA 2LGVA 5B79A 2ECIA 3EB5A 1WEVA 2ECNA 5TBNA 1WEQA 1MM2A 5H1UA 1Z60A 3FANA 2MNYA 2CRWA 2D8SA 3SOXA 2CSYA 4MSXA 3GL6A 3FEHA 3LVQE 4AVXA 4YABA 4BHWA 2FUUA 1F62A 1HYIA 2JRJA 3KV5A 3H7HA 5LKTA 1JM7A 4YAXA 2M6MA 4A49A 2JUNA 2KYUA 4NN2A 2H0DA 2VJEB 2PNXA 3E2DA 2UZGA 3LJUX 2KKYA 1G25A 2DJAA 2F42A 4LJNA 3O34A 1JM7B 2XOYA 1BORA 1K2FA 5LCWB 3SHBA 3T9KA 2KFTA 1MBMA 3DWDA 2MIQA 2BAYA 2LDRA 5TABA 2CONA 4GNDA 2K17A 2OXQC 4A4CA 4WZ3B 2DX8A 3ASLA 2MNZA 2QIZA 2MA5A 2L0BA 2G6QA 2XOCA 1WEEA 2L75A 2VPGA 1RMDA 3U5PA 1XWHA 2E6RA 3NG2A 4UP5A 5LKZA 2KIZA 2LGLA 3T6RA 4YBSA 4Q6FA 2XP0A 2LV9A 2CKLB 3KDEC 4YATA 3N9PA 5KH3A 4GNEA 5H1TA 2CT2A 3RPGC 1MM3A 5B76A 2MUMA 2VPBA 3HTKC 2Y1MA 1LDKC 2MD7B 2QICA 2G43A 5G04B 2M85A 3LQJA 4YC9A 3L1XA 2PUYA 2P57A 4IC3A 2KWKA 4AYCB 2KR4A 3ZNIA 4YBMA 1U6GB 4BBQA 3PLWA 2Y1NA 2CSZA 5G05B 2YQLA 5B8DA 2YREA 5TDRA 2M3HA 3SUBA 4GB0A 2VPEA 4S3OB 2XOZA 3ZPV1 2YU4A 3LRQA 3KQIA 5AIUA 1VFYA 4B86C 2KKXA 2JMIA 2VJEA 2I50A 2FUIA 2MA6A 2E61A 2L43A 2NAAA 4WZ2A 3JUEA 5G0FA 3SOWA 2ECVA 4P5OB 2RSDA 2VJFB 3RPGB 4L7XA 2EGPA 4UI9B 3PUQA 1X4UA 3O36A 5SVIB 2ECWA 2VP7A 3ZPVE 2QJ0A 3I2DA 4CA1A 3N9MA 2L80A 1WEOA 4H9DA 2KREA 4V3LC 5KH9A 4FJCA 5AITA 2YHNA 2FSAA 2RI7A 3N9QA 3KNVA 4TKPB 2RR4A 2XB1A 4YADA
chains in the Genus database with same CATH topology
2K1JA 4ZUXU 2YW8A 3N9LA 4WA6A 5C11A 3HCUA 4AP4A 1ZBDB 3DQVR 1WEUA 4FK5A 4UP0A 4CCGX 5FEYA 1WILA 2CKLA 2LXPC 3ZVYA 1WE9A 1IYMA 2ECJA 3U5OA 3O33A 2KU3A 2YYRA 5LKXA 4S3OC 2LRIC 3KV6A 5EYAF 1X4JA 1N87A 2ZETC 1WEMA 5FERA 2ECTA 2KE1A 1LDJB 2KWJA 5DINA 4WZ0A 4YBTA 2EA6A 4AUQB 5B77A 4W4UA 2HYED 1JOCA 3LQIA 3SOUA 4AYCA 1Z6UA 5B78A 2KGGA 3PURA 2YUCA 3O7AA 4ZDTA 2YQMA 2LN0A 4I7DA 1Z2QA 4PTBA 2KGIA 2JMJA 2ECGA 2MD8C 1WIMA 2F6NA 4L58A 1WESA 1WENA 3L11A 2F6JA 3M62A 3C5KA 4QF2A 1VYXA 1VD4A 2AN6A 4XI1A 4A4BA 4X3GA 5FB1A 3GV4A 3N9OA 3U5NA 1X4IA 2VJFA 4A0CD 2LGKA 5LKUA 2M1RA 3M63A 4GNGA 3QZVA 2XEUA 1WEPA 2G45A 4B7YC 2YT5A 5H9MA 4ZQLA 3O35A 4FO9A 1WEWA 2C2VS 5C13A 5TDWA 5JG6A 3U5MA 1DVPA 1FBVA 2VPDA 3O37A 2C2LA 4R7EA 5DKAA 3EB6A 3L1ZB 2E6SA 2YSJA 1HYJA 5D1LB 3O70A 1FP0A 1E4UA 4IC2A 4FIPA 4LLBA 3HCTA 4R2YA 3LQHA 5H1VA 2L5UA 5D1KB 2IDAA 5D1MB 2YHOA 3T7LA 4QF3A 4I7BA 5KH7A 4R8PK 4N3WA 3V43A 2HDPA 2KWOA 2H0DB 2EODA 1T1HA 4N4FA 2YSMA 1WGMA 2LGGA 2JMDA 3HCSA 3ZVZB 3PHDA 4O64A 3M99A 3MHHA 4I7CA 3DPLR 4MVTA 3FL2A 1CHCA 3ZYQA 2K16A 2YURA 4C9ZA 4LK9A 5B75A 3VK6A 2LQ6A 2K4DA 3IHPA 3N9NA 3MHSA 4F52B 2LXHC 5I3LA 1V87A 4GNFA 4LKAA 3RTRB 5J3XA 3C6WA 2KWNA 2MT5A 4LADB 2Y43A 5FB0A 4V3KC 2VNFA 3ZTGA 1WFKA 4PPEA 5TRBA 2LGVA 5B79A 2ECIA 3EB5A 1WEVA 2ECNA 5TBNA 1WEQA 1MM2A 5H1UA 1Z60A 2MNYA 2D8SA 3SOXA 2CSYA 4MSXA 3GL6A 4AVXA 4YABA 4BHWA 2FUUA 1F62A 1HYIA 2JRJA 3KV5A 5LKTA 1JM7A 4YAXA 2M6MA 4A49A 2KYUA 4NN2A 2H0DA 2VJEB 2PNXA 2UZGA 1G25A 2F42A 4LJNA 3O34A 1JM7B 1BORA 1K2FA 5LCWB 3SHBA 2KFTA 2MIQA 2BAYA 2LDRA 5TABA 4GNDA 2K17A 2OXQC 4A4CA 4WZ3B 2DX8A 3ASLA 2MNZA 2QIZA 2MA5A 2L0BA 2G6QA 1WEEA 2L75A 2VPGA 1RMDA 3U5PA 1XWHA 2E6RA 3NG2A 4UP5A 5LKZA 2KIZA 2LGLA 3T6RA 4YBSA 4Q6FA 2LV9A 2CKLB 4YATA 3N9PA 5KH3A 4GNEA 5H1TA 2CT2A 3RPGC 1MM3A 5B76A 2MUMA 2VPBA 3HTKC 2Y1MA 1LDKC 2MD7B 2QICA 2G43A 5G04B 2M85A 3LQJA 4YC9A 3L1XA 2PUYA 4IC3A 2KWKA 4AYCB 2KR4A 3ZNIA 4YBMA 1U6GB 4BBQA 2Y1NA 2CSZA 5G05B 2YQLA 5B8DA 2YREA 5TDRA 2M3HA 4GB0A 2VPEA 4S3OB 3ZPV1 2YU4A 3LRQA 3KQIA 5AIUA 1VFYA 4B86C 2JMIA 2VJEA 2I50A 2FUIA 2MA6A 2L43A 2NAAA 4WZ2A 5G0FA 3SOWA 2ECVA 4P5OB 2RSDA 2VJFB 3RPGB 4L7XA 2EGPA 4UI9B 3PUQA 1X4UA 3O36A 2ECWA 2VP7A 3ZPVE 2QJ0A 3I2DA 4CA1A 3N9MA 2L80A 1WEOA 2KREA 4V3LC 5KH9A 4FJCA 5AITA 2YHNA 2FSAA 2RI7A 3N9QA 3KNVA 4TKPB 2XB1A 4YADA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K1J A;  4ZUX U;  2YW8 A;  3N9L A;  4WA6 A;  5C11 A;  3HCU A;  4AP4 A;  1ZBD B;  3DQV R;  1WEU A;  4FK5 A;  4UP0 A;  4CCG X;  5FEY A;  1WIL A;  2CKL A;  2LXP C;  3ZVY A;  1WE9 A;  1IYM A;  2ECJ A;  3U5O A;  3O33 A;  2KU3 A;  2YYR A;  5LKX A;  4S3O C;  2LRI C;  3KV6 A;  5EYA F;  1X4J A;  1N87 A;  2ZET C;  1WEM A;  5FER A;  2ECT A;  2KE1 A;  1LDJ B;  2KWJ A;  5DIN A;  4WZ0 A;  4YBT A;  2EA6 A;  4AUQ B;  5B77 A;  4W4U A;  2HYE D;  1JOC A;  3LQI A;  3SOU A;  4AYC A;  1Z6U A;  5B78 A;  2KGG A;  3PUR A;  2YUC A;  3O7A A;  4ZDT A;  2YQM A;  2LN0 A;  4I7D A;  1Z2Q A;  4PTB A;  2KGI A;  2JMJ A;  2ECG A;  2MD8 C;  1WIM A;  2F6N A;  4L58 A;  1WES A;  1WEN A;  3L11 A;  2F6J A;  3M62 A;  3C5K A;  4QF2 A;  1VYX A;  1VD4 A;  2AN6 A;  4XI1 A;  4A4B A;  4X3G A;  5FB1 A;  3GV4 A;  3N9O A;  3U5N A;  1X4I A;  2VJF A;  4A0C D;  2LGK A;  5LKU A;  2M1R A;  3M63 A;  4GNG A;  3QZV A;  2XEU A;  1WEP A;  2G45 A;  4B7Y C;  2YT5 A;  5H9M A;  4ZQL A;  3O35 A;  4FO9 A;  1WEW A;  2C2V S;  5C13 A;  5TDW A;  5JG6 A;  3U5M A;  1DVP A;  1FBV A;  2VPD A;  3O37 A;  2C2L A;  4R7E A;  5DKA A;  3EB6 A;  3L1Z B;  2E6S A;  2YSJ A;  1HYJ A;  5D1L B;  3O70 A;  1FP0 A;  1E4U A;  4IC2 A;  4FIP A;  4LLB A;  3HCT A;  4R2Y A;  3LQH A;  5H1V A;  2L5U A;  5D1K B;  2IDA A;  5D1M B;  2YHO A;  3T7L A;  4QF3 A;  4I7B A;  5KH7 A;  4R8P K;  4N3W A;  3V43 A;  2HDP A;  2KWO A;  2H0D B;  2EOD A;  1T1H A;  4N4F A;  2YSM A;  1WGM A;  2LGG A;  2JMD A;  3HCS A;  3ZVZ B;  3PHD A;  4O64 A;  3M99 A;  3MHH A;  4I7C A;  3DPL R;  4MVT A;  3FL2 A;  1CHC A;  3ZYQ A;  2K16 A;  2YUR A;  4C9Z A;  4LK9 A;  5B75 A;  3VK6 A;  2LQ6 A;  2K4D A;  3IHP A;  3N9N A;  3MHS A;  4F52 B;  2LXH C;  5I3L A;  1V87 A;  4GNF A;  4LKA A;  3RTR B;  5J3X A;  3C6W A;  2KWN A;  2MT5 A;  4LAD B;  2Y43 A;  5FB0 A;  4V3K C;  2VNF A;  3ZTG A;  1WFK A;  4PPE A;  5TRB A;  2LGV A;  5B79 A;  2ECI A;  3EB5 A;  1WEV A;  2ECN A;  5TBN A;  1WEQ A;  1MM2 A;  5H1U A;  1Z60 A;  2MNY A;  2D8S A;  3SOX A;  2CSY A;  4MSX A;  3GL6 A;  4AVX A;  4YAB A;  4BHW A;  2FUU A;  1F62 A;  1HYI A;  2JRJ A;  3KV5 A;  5LKT A;  1JM7 A;  4YAX A;  2M6M A;  4A49 A;  2KYU A;  4NN2 A;  2H0D A;  2VJE B;  2PNX A;  2UZG A;  1G25 A;  2F42 A;  4LJN A;  3O34 A;  1JM7 B;  1BOR A;  1K2F A;  5LCW B;  3SHB A;  2KFT A;  2MIQ A;  2BAY A;  2LDR A;  5TAB A;  4GND A;  2K17 A;  2OXQ C;  4A4C A;  4WZ3 B;  2DX8 A;  3ASL A;  2MNZ A;  2QIZ A;  2MA5 A;  2L0B A;  2G6Q A;  1WEE A;  2L75 A;  2VPG A;  1RMD A;  3U5P A;  1XWH A;  2E6R A;  3NG2 A;  4UP5 A;  5LKZ A;  2KIZ A;  2LGL A;  3T6R A;  4YBS A;  4Q6F A;  2LV9 A;  2CKL B;  4YAT A;  3N9P A;  5KH3 A;  4GNE A;  5H1T A;  2CT2 A;  3RPG C;  1MM3 A;  5B76 A;  2MUM A;  2VPB A;  3HTK C;  2Y1M A;  1LDK C;  2MD7 B;  2QIC A;  2G43 A;  5G04 B;  2M85 A;  3LQJ A;  4YC9 A;  3L1X A;  2PUY A;  4IC3 A;  2KWK A;  4AYC B;  2KR4 A;  3ZNI A;  4YBM A;  1U6G B;  4BBQ A;  2Y1N A;  2CSZ A;  5G05 B;  2YQL A;  5B8D A;  2YRE A;  5TDR A;  2M3H A;  4GB0 A;  2VPE A;  4S3O B;  3ZPV 1;  2YU4 A;  3LRQ A;  3KQI A;  5AIU A;  1VFY A;  4B86 C;  2JMI A;  2VJE A;  2I50 A;  2FUI A;  2MA6 A;  2L43 A;  2NAA A;  4WZ2 A;  5G0F A;  3SOW A;  2ECV A;  4P5O B;  2RSD A;  2VJF B;  3RPG B;  4L7X A;  2EGP A;  4UI9 B;  3PUQ A;  1X4U A;  3O36 A;  2ECW A;  2VP7 A;  3ZPV E;  2QJ0 A;  3I2D A;  4CA1 A;  3N9M A;  2L80 A;  1WEO A;  2KRE A;  4V3L C;  5KH9 A;  4FJC A;  5AIT A;  2YHN A;  2FSA A;  2RI7 A;  3N9Q A;  3KNV A;  4TKP B;  2XB1 A;  4YAD A; 
#chains in the Genus database with same CATH topology
 2K1J A;  4ZUX U;  2YW8 A;  3N9L A;  4WA6 A;  5C11 A;  2B0O E;  3HCU A;  2FFW A;  2EGM A;  4AP4 A;  1ZBD B;  3LVR E;  4Z0O A;  3DQV R;  1WEU A;  4FK5 A;  4UP0 A;  4CCG X;  5FEY A;  1WIL A;  2CKL A;  2LXP C;  3ZVY A;  1WE9 A;  1IYM A;  2ECJ A;  3U5O A;  3O33 A;  2KU3 A;  2YYR A;  4Z0R A;  5LKX A;  4S3O C;  2LRI C;  3KV6 A;  5EYA F;  1X4J A;  1N87 A;  2ZET C;  1WEM A;  5FER A;  2ECT A;  2KE1 A;  1LDJ B;  2KWJ A;  5DIN A;  4WZ0 A;  4YBT A;  3M7K A;  2EA6 A;  4AUQ B;  5B77 A;  4W4U A;  2CSV A;  2HYE D;  1JOC A;  3LQI A;  3SOU A;  4AYC A;  1Z6U A;  5B78 A;  2CRR A;  2KGG A;  3PUR A;  2YUC A;  3O7A A;  4ZDT A;  2YQM A;  2LN0 A;  4I7D A;  1Z2Q A;  4PTB A;  2KGI A;  2JMJ A;  2ECG A;  2MD8 C;  1WIM A;  2F6N A;  3O47 A;  4L58 A;  1WES A;  1WEN A;  3L11 A;  2F6J A;  3M62 A;  4QQ4 A;  3C5K A;  4QF2 A;  1VYX A;  1VD4 A;  2AN6 A;  4XI1 A;  4A4B A;  4X3G A;  5FB1 A;  3GV4 A;  3N9O A;  3U5N A;  1X4I A;  2VJF A;  4A0C D;  2LGK A;  5LKU A;  2DSM A;  2M1R A;  3FM8 C;  3M63 A;  5SVI A;  4GNG A;  3QZV A;  4F1P A;  2XEU A;  1WEP A;  2G45 A;  4B7Y C;  2YT5 A;  5H9M A;  4ZQL A;  3O35 A;  4FO9 A;  1WEW A;  2C2V S;  5C13 A;  5TDW A;  5JG6 A;  3U5M A;  1DVP A;  1FBV A;  2VPD A;  3MDB C;  3O37 A;  2C2L A;  4R7E A;  5DKA A;  3EB6 A;  3L1Z B;  2E6S A;  2YSJ A;  1HYJ A;  4O62 A;  5D1L B;  3O70 A;  1FP0 A;  1E4U A;  4IC2 A;  4FIP A;  4LLB A;  3HCT A;  4R2Y A;  3LQH A;  5H1V A;  2L5U A;  5D1K B;  2IDA A;  5D1M B;  2YHO A;  5K3Q A;  3T7L A;  4QF3 A;  2MKE A;  4I7B A;  5KH7 A;  2LAU A;  4R8P K;  4N3W A;  3Q1D A;  3V43 A;  2YVR A;  2HDP A;  5SVY A;  2KWO A;  2FD4 A;  2H0D B;  2EOD A;  1T1H A;  4N4F A;  2EXU A;  2YSM A;  1WGM A;  2LGG A;  2JMD A;  3HCS A;  5SVX A;  3ZVZ B;  3PHD A;  4O64 A;  3M99 A;  3LDY A;  3MHH A;  4I7C A;  3DPL R;  4MVT A;  3FL2 A;  1CHC A;  3ZYQ A;  2K16 A;  2YUR A;  4C9Z A;  4LK9 A;  5B75 A;  3FJU B;  3VK6 A;  2LQ6 A;  2K4D A;  3IHP A;  3N9N A;  3MHS A;  4F52 B;  2LXH C;  2M13 A;  5I3L A;  1V87 A;  4GNF A;  4LKA A;  3RTR B;  5J3X A;  2JM3 A;  1DCQ A;  2OWA A;  2L7P A;  2KWN A;  2MT5 A;  3C6W A;  4LAD B;  2Y43 A;  5FB0 A;  4V3K C;  4OGE A;  2VNF A;  3ZTG A;  2D8U A;  3DDT A;  3FAO A;  4OGC A;  2IQJ A;  1WFK A;  4PPE A;  5TRB A;  2LGV A;  5B79 A;  2ECI A;  3EB5 A;  1WEV A;  2ECN A;  5TBN A;  1WEQ A;  1MM2 A;  5H1U A;  1Z60 A;  3FAN A;  2MNY A;  2CRW A;  2D8S A;  3SOX A;  2CSY A;  4MSX A;  3GL6 A;  3FEH A;  3LVQ E;  4AVX A;  4YAB A;  4BHW A;  2FUU A;  1F62 A;  1HYI A;  2JRJ A;  3KV5 A;  3H7H A;  5LKT A;  1JM7 A;  4YAX A;  2M6M A;  4A49 A;  2JUN A;  2KYU A;  4NN2 A;  2H0D A;  2VJE B;  2PNX A;  3E2D A;  2UZG A;  3LJU X;  2KKY A;  1G25 A;  2DJA A;  2F42 A;  4LJN A;  3O34 A;  1JM7 B;  2XOY A;  1BOR A;  1K2F A;  5LCW B;  3SHB A;  3T9K A;  2KFT A;  1MBM A;  3DWD A;  2MIQ A;  2BAY A;  2LDR A;  5TAB A;  2CON A;  4GND A;  2K17 A;  2OXQ C;  4A4C A;  4WZ3 B;  2DX8 A;  3ASL A;  2MNZ A;  2QIZ A;  2MA5 A;  2L0B A;  2G6Q A;  2XOC A;  1WEE A;  2L75 A;  2VPG A;  1RMD A;  3U5P A;  1XWH A;  2E6R A;  3NG2 A;  4UP5 A;  5LKZ A;  2KIZ A;  2LGL A;  3T6R A;  4YBS A;  4Q6F A;  2XP0 A;  2LV9 A;  2CKL B;  3KDE C;  4YAT A;  3N9P A;  5KH3 A;  4GNE A;  5H1T A;  2CT2 A;  3RPG C;  1MM3 A;  5B76 A;  2MUM A;  2VPB A;  3HTK C;  2Y1M A;  1LDK C;  2MD7 B;  2QIC A;  2G43 A;  5G04 B;  2M85 A;  3LQJ A;  4YC9 A;  3L1X A;  2PUY A;  2P57 A;  4IC3 A;  2KWK A;  4AYC B;  2KR4 A;  3ZNI A;  4YBM A;  1U6G B;  4BBQ A;  3PLW A;  2Y1N A;  2CSZ A;  5G05 B;  2YQL A;  5B8D A;  2YRE A;  5TDR A;  2M3H A;  3SUB A;  4GB0 A;  2VPE A;  4S3O B;  2XOZ A;  3ZPV 1;  2YU4 A;  3LRQ A;  3KQI A;  5AIU A;  1VFY A;  4B86 C;  2KKX A;  2JMI A;  2VJE A;  2I50 A;  2FUI A;  2MA6 A;  2E61 A;  2L43 A;  2NAA A;  4WZ2 A;  3JUE A;  5G0F A;  3SOW A;  2ECV A;  4P5O B;  2RSD A;  2VJF B;  3RPG B;  4L7X A;  2EGP A;  4UI9 B;  3PUQ A;  1X4U A;  3O36 A;  5SVI B;  2ECW A;  2VP7 A;  3ZPV E;  2QJ0 A;  3I2D A;  4CA1 A;  3N9M A;  2L80 A;  1WEO A;  4H9D A;  2KRE A;  4V3L C;  5KH9 A;  4FJC A;  5AIT A;  2YHN A;  2FSA A;  2RI7 A;  3N9Q A;  3KNV A;  4TKP B;  2RR4 A;  2XB1 A;  4YAD A; 
#chains in the Genus database with same CATH homology
 2K1J A;  4ZUX U;  2YW8 A;  3N9L A;  4WA6 A;  5C11 A;  3HCU A;  4AP4 A;  1ZBD B;  3DQV R;  1WEU A;  4FK5 A;  4UP0 A;  4CCG X;  5FEY A;  1WIL A;  2CKL A;  2LXP C;  3ZVY A;  1WE9 A;  1IYM A;  2ECJ A;  3U5O A;  3O33 A;  2KU3 A;  2YYR A;  5LKX A;  4S3O C;  2LRI C;  3KV6 A;  5EYA F;  1X4J A;  1N87 A;  2ZET C;  1WEM A;  5FER A;  2ECT A;  2KE1 A;  1LDJ B;  2KWJ A;  5DIN A;  4WZ0 A;  4YBT A;  2EA6 A;  4AUQ B;  5B77 A;  4W4U A;  2HYE D;  1JOC A;  3LQI A;  3SOU A;  4AYC A;  1Z6U A;  5B78 A;  2KGG A;  3PUR A;  2YUC A;  3O7A A;  4ZDT A;  2YQM A;  2LN0 A;  4I7D A;  1Z2Q A;  4PTB A;  2KGI A;  2JMJ A;  2ECG A;  2MD8 C;  1WIM A;  2F6N A;  4L58 A;  1WES A;  1WEN A;  3L11 A;  2F6J A;  3M62 A;  3C5K A;  4QF2 A;  1VYX A;  1VD4 A;  2AN6 A;  4XI1 A;  4A4B A;  4X3G A;  5FB1 A;  3GV4 A;  3N9O A;  3U5N A;  1X4I A;  2VJF A;  4A0C D;  2LGK A;  5LKU A;  2M1R A;  3M63 A;  4GNG A;  3QZV A;  2XEU A;  1WEP A;  2G45 A;  4B7Y C;  2YT5 A;  5H9M A;  4ZQL A;  3O35 A;  4FO9 A;  1WEW A;  2C2V S;  5C13 A;  5TDW A;  5JG6 A;  3U5M A;  1DVP A;  1FBV A;  2VPD A;  3O37 A;  2C2L A;  4R7E A;  5DKA A;  3EB6 A;  3L1Z B;  2E6S A;  2YSJ A;  1HYJ A;  5D1L B;  3O70 A;  1FP0 A;  1E4U A;  4IC2 A;  4FIP A;  4LLB A;  3HCT A;  4R2Y A;  3LQH A;  5H1V A;  2L5U A;  5D1K B;  2IDA A;  5D1M B;  2YHO A;  3T7L A;  4QF3 A;  4I7B A;  5KH7 A;  4R8P K;  4N3W A;  3V43 A;  2HDP A;  2KWO A;  2H0D B;  2EOD A;  1T1H A;  4N4F A;  2YSM A;  1WGM A;  2LGG A;  2JMD A;  3HCS A;  3ZVZ B;  3PHD A;  4O64 A;  3M99 A;  3MHH A;  4I7C A;  3DPL R;  4MVT A;  3FL2 A;  1CHC A;  3ZYQ A;  2K16 A;  2YUR A;  4C9Z A;  4LK9 A;  5B75 A;  3VK6 A;  2LQ6 A;  2K4D A;  3IHP A;  3N9N A;  3MHS A;  4F52 B;  2LXH C;  5I3L A;  1V87 A;  4GNF A;  4LKA A;  3RTR B;  5J3X A;  3C6W A;  2KWN A;  2MT5 A;  4LAD B;  2Y43 A;  5FB0 A;  4V3K C;  2VNF A;  3ZTG A;  1WFK A;  4PPE A;  5TRB A;  2LGV A;  5B79 A;  2ECI A;  3EB5 A;  1WEV A;  2ECN A;  5TBN A;  1WEQ A;  1MM2 A;  5H1U A;  1Z60 A;  2MNY A;  2D8S A;  3SOX A;  2CSY A;  4MSX A;  3GL6 A;  4AVX A;  4YAB A;  4BHW A;  2FUU A;  1F62 A;  1HYI A;  2JRJ A;  3KV5 A;  5LKT A;  1JM7 A;  4YAX A;  2M6M A;  4A49 A;  2KYU A;  4NN2 A;  2H0D A;  2VJE B;  2PNX A;  2UZG A;  1G25 A;  2F42 A;  4LJN A;  3O34 A;  1JM7 B;  1BOR A;  1K2F A;  5LCW B;  3SHB A;  2KFT A;  2MIQ A;  2BAY A;  2LDR A;  5TAB A;  4GND A;  2K17 A;  2OXQ C;  4A4C A;  4WZ3 B;  2DX8 A;  3ASL A;  2MNZ A;  2QIZ A;  2MA5 A;  2L0B A;  2G6Q A;  1WEE A;  2L75 A;  2VPG A;  1RMD A;  3U5P A;  1XWH A;  2E6R A;  3NG2 A;  4UP5 A;  5LKZ A;  2KIZ A;  2LGL A;  3T6R A;  4YBS A;  4Q6F A;  2LV9 A;  2CKL B;  4YAT A;  3N9P A;  5KH3 A;  4GNE A;  5H1T A;  2CT2 A;  3RPG C;  1MM3 A;  5B76 A;  2MUM A;  2VPB A;  3HTK C;  2Y1M A;  1LDK C;  2MD7 B;  2QIC A;  2G43 A;  5G04 B;  2M85 A;  3LQJ A;  4YC9 A;  3L1X A;  2PUY A;  4IC3 A;  2KWK A;  4AYC B;  2KR4 A;  3ZNI A;  4YBM A;  1U6G B;  4BBQ A;  2Y1N A;  2CSZ A;  5G05 B;  2YQL A;  5B8D A;  2YRE A;  5TDR A;  2M3H A;  4GB0 A;  2VPE A;  4S3O B;  3ZPV 1;  2YU4 A;  3LRQ A;  3KQI A;  5AIU A;  1VFY A;  4B86 C;  2JMI A;  2VJE A;  2I50 A;  2FUI A;  2MA6 A;  2L43 A;  2NAA A;  4WZ2 A;  5G0F A;  3SOW A;  2ECV A;  4P5O B;  2RSD A;  2VJF B;  3RPG B;  4L7X A;  2EGP A;  4UI9 B;  3PUQ A;  1X4U A;  3O36 A;  2ECW A;  2VP7 A;  3ZPV E;  2QJ0 A;  3I2D A;  4CA1 A;  3N9M A;  2L80 A;  1WEO A;  2KRE A;  4V3L C;  5KH9 A;  4FJC A;  5AIT A;  2YHN A;  2FSA A;  2RI7 A;  3N9Q A;  3KNV A;  4TKP B;  2XB1 A;  4YAD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...