1X4IA

Solution structure of phd domain in inhibitor of growth protein 3 (ing3)
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
70
structure length
70
Chain Sequence
b'GSSGSSGYCICNQVSYGEMVGCDNQDCPIEWFHYGCVGLTEAPKGKWYCPQCTAAMKRRGSRHKSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inhibitor of growth protein 3
publication title Solution structure of PHD domain in inhibitor of growth protein 3 (ING3)
rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 5
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2005-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1x4iA00
1VD4A 3O35A 5TDRA 2VPGA 2YURA 2ECGA 2ECIA 5B78A 2XB1A 1WEPA 2K1JA 3RTRB 4I7BA 3N9MA 5AIUA 4A4BA 1JOCA 2F6NA 2KWOA 3V43A 1X4IA 2CKLA 3T6RA 2C2VS 2MNZA 4S3OB 1WEEA 3N9PA 2MUMA 2CT2A 5H1VA 4LKAA 2KWJA 4N4FA 3I2DA 3HCTA 4LJNA 4GNEA 4R8PK 2YHOA 2KE1A 3T7LA 2KWNA 5FERA 1WEQA 2YSMA 2MT5A 3C5KA 2LXHC 2LRIC 2C2LA 2H0DA 2KGGA 3U5OA 2FSAA 2KIZA 2RI7A 1BORA 4WZ0A 1WIMA 3U5PA 1IYMA 1XWHA 1T1HA 2M1RA 1F62A 2YW8A 3HCUA 1LDJB 5G05B 2ECNA 4YATA 4AVXA 1X4UA 4YBSA 5TABA 4AYCB 2VJEA 2YT5A 4FK5A 2VJFA 1FP0A 5C13A 2YU4A 1WEWA 4LLBA 4WZ2A 5I3LA 2QJ0A 3C6WA 2M6MA 3LRQA 2LXPC 2LGVA 3M99A 5KH7A 3O36A 2JMJA 2L0BA 3KV6A 2JMDA 2MA6A 3KV5A 1VYXA 3SOUA 1JM7A 2LGLA 3GL6A 4YBTA 5G0FA 2G43A 2YSJA 3O7AA 4GNGA 3EB6A 5G04B 2EA6A 4IC2A 4GNFA 1CHCA 1WEUA 3O34A 3DPLR 5LKUA 3M63A 2EODA 4BBQA 2KFTA 1LDKC 4B7YC 2MA5A 3LQJA 2VP7A 3O37A 2LGKA 5D1LB 4A49A 2ECVA 2G6QA 3ZPV1 3MHSA 2MD8C 3M62A 1Z60A 4Q6FA 2MD7B 3GV4A 5J3XA 2BAYA 2YREA 4LK9A 4PTBA 1MM2A 1FBVA 4YABA 5B75A 2E6SA 2PNXA 3SOWA 1WEMA 2QICA 2VNFA 3L1ZB 1WEVA 2E6RA 5FB0A 2VPEA 3HTKC 4ZUXU 3EB5A 5TRBA 3FL2A 5JG6A 5EYAF 5FB1A 2K16A 2ZETC 1K2FA 4S3OC 3ZVZB 1ZBDB 4XI1A 1WILA 4YAXA 4X3GA 2CSZA 3SHBA 2H0DB 2ECJA 1U6GB 1HYIA 4A0CD 1G25A 5LCWB 4IC3A 4BHWA 4QF2A 2KWKA 3N9QA 2KYUA 5D1MB 4LADB 4L7XA 5LKTA 2MNYA 2DX8A 4YC9A 4ZQLA 5D1KB 5LKZA 4NN2A 5B8DA 3RPGB 2YQLA 2VJEB 3ZVYA 5LKXA 2G45A 2VJFB 2MIQA 4C9ZA 4F52B 3ZTGA 2UZGA 1WGMA 3LQIA 1E4UA 4AUQB 2LGGA 2NAAA 5DINA 1X4JA 2Y1MA 5B77A 3U5NA 1RMDA 1V87A 2L5UA 2HYED 3ZYQA 4B86C 2XEUA 2L75A 3N9LA 3ASLA 4UI9B 2KGIA 1MM3A 3QZVA 2ECWA 4MSXA 1Z6UA 2Y1NA 4P5OB 2K4DA 3KNVA 5AITA 4MVTA 1JM7B 3VK6A 4UP5A 3IHPA 2AN6A 4R2YA 2M85A 1WE9A 2KU3A 4W4UA 3O70A 2OXQC 4FIPA 5H1UA 3DQVR 1WESA 4UP0A 4WA6A 4CA1A 4QF3A 2FUIA 4V3KC 4N3WA 1Z2QA 2F42A 2KR4A 1VFYA 4GB0A 3N9OA 3SOXA 2CKLB 5KH3A 2LDRA 2LN0A 2CSYA 4PPEA 4GNDA 5C11A 2LQ6A 2EGPA 2ECTA 3LQHA 3PUQA 4AP4A 4A4CA 1WFKA 2HDPA 3MHHA 2QIZA 3KQIA 2YHNA 5FEYA 2F6JA 3PHDA 2YUCA 3HCSA 3ZPVE 2RSDA 2K17A 4I7CA 2LV9A 4R7EA 4TKPB 4CCGX 2Y43A 4L58A 1DVPA 4YBMA 4AYCA 2L43A 4YADA 3N9NA 2KREA 4FJCA 4I7DA 3NG2A 3PURA 2JMIA 4ZDTA 1N87A 3U5MA 3ZNIA 2IDAA 2M3HA 5TDWA 3L11A 5TBNA 5KH9A 2FUUA 3L1XA 4FO9A 1WENA 5B79A 2VPBA 5H9MA 3O33A 2JRJA 4V3LC 4WZ3B 2YQMA 2D8SA 2PUYA 1HYJA 2VPDA 2L80A 2YYRA 2I50A 5B76A 5H1TA 3RPGC 5DKAA 1WEOA 4O64A
chains in the Genus database with same CATH superfamily
1VD4A 3O35A 5TDRA 2VPGA 4F1PA 2YURA 2ECGA 2ECIA 5B78A 2XB1A 1WEPA 2K1JA 3RTRB 4I7BA 3N9MA 5AIUA 4A4BA 1JOCA 2F6NA 2KWOA 3V43A 2CRWA 1X4IA 4QQ4A 2CKLA 2IQJA 3T6RA 2C2VS 2MNZA 4S3OB 1WEEA 3N9PA 2MUMA 2CT2A 5H1VA 4LKAA 2KWJA 4N4FA 3I2DA 3FJUB 3HCTA 4LJNA 4GNEA 2XOYA 4R8PK 2XP0A 2YHOA 2M13A 2KE1A 3T7LA 2KWNA 5FERA 1WEQA 2YSMA 2MT5A 3C5KA 5SVXA 2LXHC 3SUBA 2LRIC 2C2LA 2H0DA 2JUNA 2KGGA 4Z0RA 3U5OA 2FSAA 2KIZA 2EXUA 2RI7A 1BORA 3LJUX 4WZ0A 1WIMA 3U5PA 1IYMA 1XWHA 1T1HA 2M1RA 1F62A 2YW8A 3HCUA 1LDJB 5G05B 2ECNA 4YATA 4AVXA 3FANA 2B0OE 1X4UA 4YBSA 5TABA 2FD4A 4AYCB 2VJEA 2EGMA 3FAOA 2YT5A 4FK5A 2VJFA 1FP0A 5C13A 2YU4A 1WEWA 2CSVA 4LLBA 4WZ2A 5K3QA 5I3LA 2QJ0A 3C6WA 2M6MA 3LRQA 2LXPC 2LGVA 3M99A 5KH7A 3O36A 2JMJA 2L0BA 3KV6A 2JMDA 2L7PA 2MA6A 3KV5A 5SVIB 1VYXA 3SOUA 1JM7A 2LGLA 3GL6A 4YBTA 5G0FA 2G43A 3JUEA 2YSJA 3O7AA 4GNGA 2KKXA 3EB6A 5G04B 2EA6A 4IC2A 4OGCA 4GNFA 1CHCA 1WEUA 3O34A 2DJAA 2YVRA 3DPLR 2XOZA 5LKUA 3M63A 5SVYA 2EODA 4BBQA 2KFTA 1LDKC 4B7YC 2MA5A 3LQJA 2VP7A 3O37A 2LGKA 5D1LB 3FEHA 4A49A 2ECVA 2G6QA 3ZPV1 2KKYA 3MHSA 2MD8C 3M62A 1Z60A 4Q6FA 2MD7B 3GV4A 5J3XA 2BAYA 2YREA 4LK9A 4PTBA 1MM2A 1FBVA 4YABA 5B75A 2E6SA 2PNXA 3SOWA 1WEMA 2QICA 2VNFA 4H9DA 3L1ZB 1WEVA 2E6RA 5FB0A 2VPEA 3HTKC 4ZUXU 3EB5A 5TRBA 3FL2A 5JG6A 5EYAF 5FB1A 2K16A 2ZETC 1K2FA 2CRRA 3LVQE 4S3OC 3ZVZB 1ZBDB 4XI1A 1WILA 4YAXA 4X3GA 2OWAA 2CSZA 3SHBA 2H0DB 2ECJA 1U6GB 1HYIA 4A0CD 1G25A 3Q1DA 5LCWB 4IC3A 4BHWA 4QF2A 2KWKA 3N9QA 2KYUA 2LAUA 5D1MB 4LADB 4L7XA 5LKTA 2MNYA 2DX8A 4YC9A 4ZQLA 5D1KB 5LKZA 4NN2A 5B8DA 3RPGB 2YQLA 2VJEB 3ZVYA 5LKXA 2G45A 2VJFB 2MIQA 4C9ZA 4F52B 3H7HA 3ZTGA 2UZGA 1WGMA 3LQIA 1E4UA 4AUQB 4O62A 2MKEA 2LGGA 2NAAA 5DINA 3MDBC 1X4JA 2Y1MA 2JM3A 5B77A 3U5NA 3DDTA 1RMDA 1V87A 2L5UA 2HYED 3ZYQA 4B86C 2XEUA 2L75A 3N9LA 3ASLA 4UI9B 2KGIA 1MM3A 3QZVA 2XOCA 2ECWA 4MSXA 1Z6UA 2Y1NA 4P5OB 2K4DA 3KNVA 5AITA 4MVTA 1JM7B 3O47A 3VK6A 4UP5A 3IHPA 2AN6A 4R2YA 2M85A 1WE9A 2KU3A 4W4UA 3O70A 2OXQC 1DCQA 3LVRE 1MBMA 4FIPA 2P57A 5H1UA 3DQVR 1WESA 4UP0A 4WA6A 4CA1A 3T9KA 4QF3A 2FUIA 4V3KC 4N3WA 1Z2QA 2F42A 2KR4A 3DWDA 1VFYA 4GB0A 3N9OA 3SOXA 2FFWA 2CKLB 5KH3A 2LDRA 3PLWA 4OGEA 2LN0A 2CSYA 4PPEA 3KDEC 4GNDA 5C11A 2LQ6A 2EGPA 2ECTA 3LQHA 3PUQA 4AP4A 3LDYA 4A4CA 1WFKA 2HDPA 3MHHA 2QIZA 3KQIA 2YHNA 5FEYA 2F6JA 3PHDA 2YUCA 3HCSA 3ZPVE 2RSDA 2CONA 2K17A 4I7CA 2LV9A 4R7EA 4TKPB 4Z0OA 4CCGX 2Y43A 4L58A 3E2DA 1DVPA 4YBMA 4AYCA 2L43A 4YADA 3N9NA 2KREA 4FJCA 4I7DA 3NG2A 2D8UA 3PURA 2JMIA 4ZDTA 1N87A 3U5MA 3ZNIA 2IDAA 2M3HA 5TDWA 3L11A 5TBNA 5KH9A 2RR4A 2FUUA 3L1XA 4FO9A 1WENA 3FM8C 5B79A 2VPBA 5H9MA 3O33A 5SVIA 2JRJA 3M7KA 4V3LC 4WZ3B 2YQMA 2D8SA 2E61A 2PUYA 1HYJA 2VPDA 2L80A 2YYRA 2I50A 5B76A 5H1TA 3RPGC 2DSMA 5DKAA 1WEOA 4O64A
chains in the Genus database with same CATH topology
1VD4A 3O35A 5TDRA 2VPGA 2YURA 2ECGA 2ECIA 5B78A 2XB1A 1WEPA 2K1JA 3RTRB 4I7BA 3N9MA 5AIUA 4A4BA 1JOCA 2F6NA 2KWOA 3V43A 1X4IA 2CKLA 3T6RA 2C2VS 2MNZA 4S3OB 1WEEA 3N9PA 2MUMA 2CT2A 5H1VA 4LKAA 2KWJA 4N4FA 3I2DA 3HCTA 4LJNA 4GNEA 4R8PK 2YHOA 2KE1A 3T7LA 2KWNA 5FERA 1WEQA 2YSMA 2MT5A 3C5KA 2LXHC 2LRIC 2C2LA 2H0DA 2KGGA 3U5OA 2FSAA 2KIZA 2RI7A 1BORA 4WZ0A 1WIMA 3U5PA 1IYMA 1XWHA 1T1HA 2M1RA 1F62A 2YW8A 3HCUA 1LDJB 5G05B 2ECNA 4YATA 4AVXA 1X4UA 4YBSA 5TABA 4AYCB 2VJEA 2YT5A 4FK5A 2VJFA 1FP0A 5C13A 2YU4A 1WEWA 4LLBA 4WZ2A 5I3LA 2QJ0A 3C6WA 2M6MA 3LRQA 2LXPC 2LGVA 3M99A 5KH7A 3O36A 2JMJA 2L0BA 3KV6A 2JMDA 2MA6A 3KV5A 1VYXA 3SOUA 1JM7A 2LGLA 3GL6A 4YBTA 5G0FA 2G43A 2YSJA 3O7AA 4GNGA 3EB6A 5G04B 2EA6A 4IC2A 4GNFA 1CHCA 1WEUA 3O34A 3DPLR 5LKUA 3M63A 2EODA 4BBQA 2KFTA 1LDKC 4B7YC 2MA5A 3LQJA 2VP7A 3O37A 2LGKA 5D1LB 4A49A 2ECVA 2G6QA 3ZPV1 3MHSA 2MD8C 3M62A 1Z60A 4Q6FA 2MD7B 3GV4A 5J3XA 2BAYA 2YREA 4LK9A 4PTBA 1MM2A 1FBVA 4YABA 5B75A 2E6SA 2PNXA 3SOWA 1WEMA 2QICA 2VNFA 3L1ZB 1WEVA 2E6RA 5FB0A 2VPEA 3HTKC 4ZUXU 3EB5A 5TRBA 3FL2A 5JG6A 5EYAF 5FB1A 2K16A 2ZETC 1K2FA 4S3OC 3ZVZB 1ZBDB 4XI1A 1WILA 4YAXA 4X3GA 2CSZA 3SHBA 2H0DB 2ECJA 1U6GB 1HYIA 4A0CD 1G25A 5LCWB 4IC3A 4BHWA 4QF2A 2KWKA 3N9QA 2KYUA 5D1MB 4LADB 4L7XA 5LKTA 2MNYA 2DX8A 4YC9A 4ZQLA 5D1KB 5LKZA 4NN2A 5B8DA 3RPGB 2YQLA 2VJEB 3ZVYA 5LKXA 2G45A 2VJFB 2MIQA 4C9ZA 4F52B 3ZTGA 2UZGA 1WGMA 3LQIA 1E4UA 4AUQB 2LGGA 2NAAA 5DINA 1X4JA 2Y1MA 5B77A 3U5NA 1RMDA 1V87A 2L5UA 2HYED 3ZYQA 4B86C 2XEUA 2L75A 3N9LA 3ASLA 4UI9B 2KGIA 1MM3A 3QZVA 2ECWA 4MSXA 1Z6UA 2Y1NA 4P5OB 2K4DA 3KNVA 5AITA 4MVTA 1JM7B 3VK6A 4UP5A 3IHPA 2AN6A 4R2YA 2M85A 1WE9A 2KU3A 4W4UA 3O70A 2OXQC 4FIPA 5H1UA 3DQVR 1WESA 4UP0A 4WA6A 4CA1A 4QF3A 2FUIA 4V3KC 4N3WA 1Z2QA 2F42A 2KR4A 1VFYA 4GB0A 3N9OA 3SOXA 2CKLB 5KH3A 2LDRA 2LN0A 2CSYA 4PPEA 4GNDA 5C11A 2LQ6A 2EGPA 2ECTA 3LQHA 3PUQA 4AP4A 4A4CA 1WFKA 2HDPA 3MHHA 2QIZA 3KQIA 2YHNA 5FEYA 2F6JA 3PHDA 2YUCA 3HCSA 3ZPVE 2RSDA 2K17A 4I7CA 2LV9A 4R7EA 4TKPB 4CCGX 2Y43A 4L58A 1DVPA 4YBMA 4AYCA 2L43A 4YADA 3N9NA 2KREA 4FJCA 4I7DA 3NG2A 3PURA 2JMIA 4ZDTA 1N87A 3U5MA 3ZNIA 2IDAA 2M3HA 5TDWA 3L11A 5TBNA 5KH9A 2FUUA 3L1XA 4FO9A 1WENA 5B79A 2VPBA 5H9MA 3O33A 2JRJA 4V3LC 4WZ3B 2YQMA 2D8SA 2PUYA 1HYJA 2VPDA 2L80A 2YYRA 2I50A 5B76A 5H1TA 3RPGC 5DKAA 1WEOA 4O64A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VD4 A;  3O35 A;  5TDR A;  2VPG A;  2YUR A;  2ECG A;  2ECI A;  5B78 A;  2XB1 A;  1WEP A;  2K1J A;  3RTR B;  4I7B A;  3N9M A;  5AIU A;  4A4B A;  1JOC A;  2F6N A;  2KWO A;  3V43 A;  1X4I A;  2CKL A;  3T6R A;  2C2V S;  2MNZ A;  4S3O B;  1WEE A;  3N9P A;  2MUM A;  2CT2 A;  5H1V A;  4LKA A;  2KWJ A;  4N4F A;  3I2D A;  3HCT A;  4LJN A;  4GNE A;  4R8P K;  2YHO A;  2KE1 A;  3T7L A;  2KWN A;  5FER A;  1WEQ A;  2YSM A;  2MT5 A;  3C5K A;  2LXH C;  2LRI C;  2C2L A;  2H0D A;  2KGG A;  3U5O A;  2FSA A;  2KIZ A;  2RI7 A;  1BOR A;  4WZ0 A;  1WIM A;  3U5P A;  1IYM A;  1XWH A;  1T1H A;  2M1R A;  1F62 A;  2YW8 A;  3HCU A;  1LDJ B;  5G05 B;  2ECN A;  4YAT A;  4AVX A;  1X4U A;  4YBS A;  5TAB A;  4AYC B;  2VJE A;  2YT5 A;  4FK5 A;  2VJF A;  1FP0 A;  5C13 A;  2YU4 A;  1WEW A;  4LLB A;  4WZ2 A;  5I3L A;  2QJ0 A;  3C6W A;  2M6M A;  3LRQ A;  2LXP C;  2LGV A;  3M99 A;  5KH7 A;  3O36 A;  2JMJ A;  2L0B A;  3KV6 A;  2JMD A;  2MA6 A;  3KV5 A;  1VYX A;  3SOU A;  1JM7 A;  2LGL A;  3GL6 A;  4YBT A;  5G0F A;  2G43 A;  2YSJ A;  3O7A A;  4GNG A;  3EB6 A;  5G04 B;  2EA6 A;  4IC2 A;  4GNF A;  1CHC A;  1WEU A;  3O34 A;  3DPL R;  5LKU A;  3M63 A;  2EOD A;  4BBQ A;  2KFT A;  1LDK C;  4B7Y C;  2MA5 A;  3LQJ A;  2VP7 A;  3O37 A;  2LGK A;  5D1L B;  4A49 A;  2ECV A;  2G6Q A;  3ZPV 1;  3MHS A;  2MD8 C;  3M62 A;  1Z60 A;  4Q6F A;  2MD7 B;  3GV4 A;  5J3X A;  2BAY A;  2YRE A;  4LK9 A;  4PTB A;  1MM2 A;  1FBV A;  4YAB A;  5B75 A;  2E6S A;  2PNX A;  3SOW A;  1WEM A;  2QIC A;  2VNF A;  3L1Z B;  1WEV A;  2E6R A;  5FB0 A;  2VPE A;  3HTK C;  4ZUX U;  3EB5 A;  5TRB A;  3FL2 A;  5JG6 A;  5EYA F;  5FB1 A;  2K16 A;  2ZET C;  1K2F A;  4S3O C;  3ZVZ B;  1ZBD B;  4XI1 A;  1WIL A;  4YAX A;  4X3G A;  2CSZ A;  3SHB A;  2H0D B;  2ECJ A;  1U6G B;  1HYI A;  4A0C D;  1G25 A;  5LCW B;  4IC3 A;  4BHW A;  4QF2 A;  2KWK A;  3N9Q A;  2KYU A;  5D1M B;  4LAD B;  4L7X A;  5LKT A;  2MNY A;  2DX8 A;  4YC9 A;  4ZQL A;  5D1K B;  5LKZ A;  4NN2 A;  5B8D A;  3RPG B;  2YQL A;  2VJE B;  3ZVY A;  5LKX A;  2G45 A;  2VJF B;  2MIQ A;  4C9Z A;  4F52 B;  3ZTG A;  2UZG A;  1WGM A;  3LQI A;  1E4U A;  4AUQ B;  2LGG A;  2NAA A;  5DIN A;  1X4J A;  2Y1M A;  5B77 A;  3U5N A;  1RMD A;  1V87 A;  2L5U A;  2HYE D;  3ZYQ A;  4B86 C;  2XEU A;  2L75 A;  3N9L A;  3ASL A;  4UI9 B;  2KGI A;  1MM3 A;  3QZV A;  2ECW A;  4MSX A;  1Z6U A;  2Y1N A;  4P5O B;  2K4D A;  3KNV A;  5AIT A;  4MVT A;  1JM7 B;  3VK6 A;  4UP5 A;  3IHP A;  2AN6 A;  4R2Y A;  2M85 A;  1WE9 A;  2KU3 A;  4W4U A;  3O70 A;  2OXQ C;  4FIP A;  5H1U A;  3DQV R;  1WES A;  4UP0 A;  4WA6 A;  4CA1 A;  4QF3 A;  2FUI A;  4V3K C;  4N3W A;  1Z2Q A;  2F42 A;  2KR4 A;  1VFY A;  4GB0 A;  3N9O A;  3SOX A;  2CKL B;  5KH3 A;  2LDR A;  2LN0 A;  2CSY A;  4PPE A;  4GND A;  5C11 A;  2LQ6 A;  2EGP A;  2ECT A;  3LQH A;  3PUQ A;  4AP4 A;  4A4C A;  1WFK A;  2HDP A;  3MHH A;  2QIZ A;  3KQI A;  2YHN A;  5FEY A;  2F6J A;  3PHD A;  2YUC A;  3HCS A;  3ZPV E;  2RSD A;  2K17 A;  4I7C A;  2LV9 A;  4R7E A;  4TKP B;  4CCG X;  2Y43 A;  4L58 A;  1DVP A;  4YBM A;  4AYC A;  2L43 A;  4YAD A;  3N9N A;  2KRE A;  4FJC A;  4I7D A;  3NG2 A;  3PUR A;  2JMI A;  4ZDT A;  1N87 A;  3U5M A;  3ZNI A;  2IDA A;  2M3H A;  5TDW A;  3L11 A;  5TBN A;  5KH9 A;  2FUU A;  3L1X A;  4FO9 A;  1WEN A;  5B79 A;  2VPB A;  5H9M A;  3O33 A;  2JRJ A;  4V3L C;  4WZ3 B;  2YQM A;  2D8S A;  2PUY A;  1HYJ A;  2VPD A;  2L80 A;  2YYR A;  2I50 A;  5B76 A;  5H1T A;  3RPG C;  5DKA A;  1WEO A;  4O64 A; 
#chains in the Genus database with same CATH topology
 1VD4 A;  3O35 A;  5TDR A;  2VPG A;  4F1P A;  2YUR A;  2ECG A;  2ECI A;  5B78 A;  2XB1 A;  1WEP A;  2K1J A;  3RTR B;  4I7B A;  3N9M A;  5AIU A;  4A4B A;  1JOC A;  2F6N A;  2KWO A;  3V43 A;  2CRW A;  1X4I A;  4QQ4 A;  2CKL A;  2IQJ A;  3T6R A;  2C2V S;  2MNZ A;  4S3O B;  1WEE A;  3N9P A;  2MUM A;  2CT2 A;  5H1V A;  4LKA A;  2KWJ A;  4N4F A;  3I2D A;  3FJU B;  3HCT A;  4LJN A;  4GNE A;  2XOY A;  4R8P K;  2XP0 A;  2YHO A;  2M13 A;  2KE1 A;  3T7L A;  2KWN A;  5FER A;  1WEQ A;  2YSM A;  2MT5 A;  3C5K A;  5SVX A;  2LXH C;  3SUB A;  2LRI C;  2C2L A;  2H0D A;  2JUN A;  2KGG A;  4Z0R A;  3U5O A;  2FSA A;  2KIZ A;  2EXU A;  2RI7 A;  1BOR A;  3LJU X;  4WZ0 A;  1WIM A;  3U5P A;  1IYM A;  1XWH A;  1T1H A;  2M1R A;  1F62 A;  2YW8 A;  3HCU A;  1LDJ B;  5G05 B;  2ECN A;  4YAT A;  4AVX A;  3FAN A;  2B0O E;  1X4U A;  4YBS A;  5TAB A;  2FD4 A;  4AYC B;  2VJE A;  2EGM A;  3FAO A;  2YT5 A;  4FK5 A;  2VJF A;  1FP0 A;  5C13 A;  2YU4 A;  1WEW A;  2CSV A;  4LLB A;  4WZ2 A;  5K3Q A;  5I3L A;  2QJ0 A;  3C6W A;  2M6M A;  3LRQ A;  2LXP C;  2LGV A;  3M99 A;  5KH7 A;  3O36 A;  2JMJ A;  2L0B A;  3KV6 A;  2JMD A;  2L7P A;  2MA6 A;  3KV5 A;  5SVI B;  1VYX A;  3SOU A;  1JM7 A;  2LGL A;  3GL6 A;  4YBT A;  5G0F A;  2G43 A;  3JUE A;  2YSJ A;  3O7A A;  4GNG A;  2KKX A;  3EB6 A;  5G04 B;  2EA6 A;  4IC2 A;  4OGC A;  4GNF A;  1CHC A;  1WEU A;  3O34 A;  2DJA A;  2YVR A;  3DPL R;  2XOZ A;  5LKU A;  3M63 A;  5SVY A;  2EOD A;  4BBQ A;  2KFT A;  1LDK C;  4B7Y C;  2MA5 A;  3LQJ A;  2VP7 A;  3O37 A;  2LGK A;  5D1L B;  3FEH A;  4A49 A;  2ECV A;  2G6Q A;  3ZPV 1;  2KKY A;  3MHS A;  2MD8 C;  3M62 A;  1Z60 A;  4Q6F A;  2MD7 B;  3GV4 A;  5J3X A;  2BAY A;  2YRE A;  4LK9 A;  4PTB A;  1MM2 A;  1FBV A;  4YAB A;  5B75 A;  2E6S A;  2PNX A;  3SOW A;  1WEM A;  2QIC A;  2VNF A;  4H9D A;  3L1Z B;  1WEV A;  2E6R A;  5FB0 A;  2VPE A;  3HTK C;  4ZUX U;  3EB5 A;  5TRB A;  3FL2 A;  5JG6 A;  5EYA F;  5FB1 A;  2K16 A;  2ZET C;  1K2F A;  2CRR A;  3LVQ E;  4S3O C;  3ZVZ B;  1ZBD B;  4XI1 A;  1WIL A;  4YAX A;  4X3G A;  2OWA A;  2CSZ A;  3SHB A;  2H0D B;  2ECJ A;  1U6G B;  1HYI A;  4A0C D;  1G25 A;  3Q1D A;  5LCW B;  4IC3 A;  4BHW A;  4QF2 A;  2KWK A;  3N9Q A;  2KYU A;  2LAU A;  5D1M B;  4LAD B;  4L7X A;  5LKT A;  2MNY A;  2DX8 A;  4YC9 A;  4ZQL A;  5D1K B;  5LKZ A;  4NN2 A;  5B8D A;  3RPG B;  2YQL A;  2VJE B;  3ZVY A;  5LKX A;  2G45 A;  2VJF B;  2MIQ A;  4C9Z A;  4F52 B;  3H7H A;  3ZTG A;  2UZG A;  1WGM A;  3LQI A;  1E4U A;  4AUQ B;  4O62 A;  2MKE A;  2LGG A;  2NAA A;  5DIN A;  3MDB C;  1X4J A;  2Y1M A;  2JM3 A;  5B77 A;  3U5N A;  3DDT A;  1RMD A;  1V87 A;  2L5U A;  2HYE D;  3ZYQ A;  4B86 C;  2XEU A;  2L75 A;  3N9L A;  3ASL A;  4UI9 B;  2KGI A;  1MM3 A;  3QZV A;  2XOC A;  2ECW A;  4MSX A;  1Z6U A;  2Y1N A;  4P5O B;  2K4D A;  3KNV A;  5AIT A;  4MVT A;  1JM7 B;  3O47 A;  3VK6 A;  4UP5 A;  3IHP A;  2AN6 A;  4R2Y A;  2M85 A;  1WE9 A;  2KU3 A;  4W4U A;  3O70 A;  2OXQ C;  1DCQ A;  3LVR E;  1MBM A;  4FIP A;  2P57 A;  5H1U A;  3DQV R;  1WES A;  4UP0 A;  4WA6 A;  4CA1 A;  3T9K A;  4QF3 A;  2FUI A;  4V3K C;  4N3W A;  1Z2Q A;  2F42 A;  2KR4 A;  3DWD A;  1VFY A;  4GB0 A;  3N9O A;  3SOX A;  2FFW A;  2CKL B;  5KH3 A;  2LDR A;  3PLW A;  4OGE A;  2LN0 A;  2CSY A;  4PPE A;  3KDE C;  4GND A;  5C11 A;  2LQ6 A;  2EGP A;  2ECT A;  3LQH A;  3PUQ A;  4AP4 A;  3LDY A;  4A4C A;  1WFK A;  2HDP A;  3MHH A;  2QIZ A;  3KQI A;  2YHN A;  5FEY A;  2F6J A;  3PHD A;  2YUC A;  3HCS A;  3ZPV E;  2RSD A;  2CON A;  2K17 A;  4I7C A;  2LV9 A;  4R7E A;  4TKP B;  4Z0O A;  4CCG X;  2Y43 A;  4L58 A;  3E2D A;  1DVP A;  4YBM A;  4AYC A;  2L43 A;  4YAD A;  3N9N A;  2KRE A;  4FJC A;  4I7D A;  3NG2 A;  2D8U A;  3PUR A;  2JMI A;  4ZDT A;  1N87 A;  3U5M A;  3ZNI A;  2IDA A;  2M3H A;  5TDW A;  3L11 A;  5TBN A;  5KH9 A;  2RR4 A;  2FUU A;  3L1X A;  4FO9 A;  1WEN A;  3FM8 C;  5B79 A;  2VPB A;  5H9M A;  3O33 A;  5SVI A;  2JRJ A;  3M7K A;  4V3L C;  4WZ3 B;  2YQM A;  2D8S A;  2E61 A;  2PUY A;  1HYJ A;  2VPD A;  2L80 A;  2YYR A;  2I50 A;  5B76 A;  5H1T A;  3RPG C;  2DSM A;  5DKA A;  1WEO A;  4O64 A; 
#chains in the Genus database with same CATH homology
 1VD4 A;  3O35 A;  5TDR A;  2VPG A;  2YUR A;  2ECG A;  2ECI A;  5B78 A;  2XB1 A;  1WEP A;  2K1J A;  3RTR B;  4I7B A;  3N9M A;  5AIU A;  4A4B A;  1JOC A;  2F6N A;  2KWO A;  3V43 A;  1X4I A;  2CKL A;  3T6R A;  2C2V S;  2MNZ A;  4S3O B;  1WEE A;  3N9P A;  2MUM A;  2CT2 A;  5H1V A;  4LKA A;  2KWJ A;  4N4F A;  3I2D A;  3HCT A;  4LJN A;  4GNE A;  4R8P K;  2YHO A;  2KE1 A;  3T7L A;  2KWN A;  5FER A;  1WEQ A;  2YSM A;  2MT5 A;  3C5K A;  2LXH C;  2LRI C;  2C2L A;  2H0D A;  2KGG A;  3U5O A;  2FSA A;  2KIZ A;  2RI7 A;  1BOR A;  4WZ0 A;  1WIM A;  3U5P A;  1IYM A;  1XWH A;  1T1H A;  2M1R A;  1F62 A;  2YW8 A;  3HCU A;  1LDJ B;  5G05 B;  2ECN A;  4YAT A;  4AVX A;  1X4U A;  4YBS A;  5TAB A;  4AYC B;  2VJE A;  2YT5 A;  4FK5 A;  2VJF A;  1FP0 A;  5C13 A;  2YU4 A;  1WEW A;  4LLB A;  4WZ2 A;  5I3L A;  2QJ0 A;  3C6W A;  2M6M A;  3LRQ A;  2LXP C;  2LGV A;  3M99 A;  5KH7 A;  3O36 A;  2JMJ A;  2L0B A;  3KV6 A;  2JMD A;  2MA6 A;  3KV5 A;  1VYX A;  3SOU A;  1JM7 A;  2LGL A;  3GL6 A;  4YBT A;  5G0F A;  2G43 A;  2YSJ A;  3O7A A;  4GNG A;  3EB6 A;  5G04 B;  2EA6 A;  4IC2 A;  4GNF A;  1CHC A;  1WEU A;  3O34 A;  3DPL R;  5LKU A;  3M63 A;  2EOD A;  4BBQ A;  2KFT A;  1LDK C;  4B7Y C;  2MA5 A;  3LQJ A;  2VP7 A;  3O37 A;  2LGK A;  5D1L B;  4A49 A;  2ECV A;  2G6Q A;  3ZPV 1;  3MHS A;  2MD8 C;  3M62 A;  1Z60 A;  4Q6F A;  2MD7 B;  3GV4 A;  5J3X A;  2BAY A;  2YRE A;  4LK9 A;  4PTB A;  1MM2 A;  1FBV A;  4YAB A;  5B75 A;  2E6S A;  2PNX A;  3SOW A;  1WEM A;  2QIC A;  2VNF A;  3L1Z B;  1WEV A;  2E6R A;  5FB0 A;  2VPE A;  3HTK C;  4ZUX U;  3EB5 A;  5TRB A;  3FL2 A;  5JG6 A;  5EYA F;  5FB1 A;  2K16 A;  2ZET C;  1K2F A;  4S3O C;  3ZVZ B;  1ZBD B;  4XI1 A;  1WIL A;  4YAX A;  4X3G A;  2CSZ A;  3SHB A;  2H0D B;  2ECJ A;  1U6G B;  1HYI A;  4A0C D;  1G25 A;  5LCW B;  4IC3 A;  4BHW A;  4QF2 A;  2KWK A;  3N9Q A;  2KYU A;  5D1M B;  4LAD B;  4L7X A;  5LKT A;  2MNY A;  2DX8 A;  4YC9 A;  4ZQL A;  5D1K B;  5LKZ A;  4NN2 A;  5B8D A;  3RPG B;  2YQL A;  2VJE B;  3ZVY A;  5LKX A;  2G45 A;  2VJF B;  2MIQ A;  4C9Z A;  4F52 B;  3ZTG A;  2UZG A;  1WGM A;  3LQI A;  1E4U A;  4AUQ B;  2LGG A;  2NAA A;  5DIN A;  1X4J A;  2Y1M A;  5B77 A;  3U5N A;  1RMD A;  1V87 A;  2L5U A;  2HYE D;  3ZYQ A;  4B86 C;  2XEU A;  2L75 A;  3N9L A;  3ASL A;  4UI9 B;  2KGI A;  1MM3 A;  3QZV A;  2ECW A;  4MSX A;  1Z6U A;  2Y1N A;  4P5O B;  2K4D A;  3KNV A;  5AIT A;  4MVT A;  1JM7 B;  3VK6 A;  4UP5 A;  3IHP A;  2AN6 A;  4R2Y A;  2M85 A;  1WE9 A;  2KU3 A;  4W4U A;  3O70 A;  2OXQ C;  4FIP A;  5H1U A;  3DQV R;  1WES A;  4UP0 A;  4WA6 A;  4CA1 A;  4QF3 A;  2FUI A;  4V3K C;  4N3W A;  1Z2Q A;  2F42 A;  2KR4 A;  1VFY A;  4GB0 A;  3N9O A;  3SOX A;  2CKL B;  5KH3 A;  2LDR A;  2LN0 A;  2CSY A;  4PPE A;  4GND A;  5C11 A;  2LQ6 A;  2EGP A;  2ECT A;  3LQH A;  3PUQ A;  4AP4 A;  4A4C A;  1WFK A;  2HDP A;  3MHH A;  2QIZ A;  3KQI A;  2YHN A;  5FEY A;  2F6J A;  3PHD A;  2YUC A;  3HCS A;  3ZPV E;  2RSD A;  2K17 A;  4I7C A;  2LV9 A;  4R7E A;  4TKP B;  4CCG X;  2Y43 A;  4L58 A;  1DVP A;  4YBM A;  4AYC A;  2L43 A;  4YAD A;  3N9N A;  2KRE A;  4FJC A;  4I7D A;  3NG2 A;  3PUR A;  2JMI A;  4ZDT A;  1N87 A;  3U5M A;  3ZNI A;  2IDA A;  2M3H A;  5TDW A;  3L11 A;  5TBN A;  5KH9 A;  2FUU A;  3L1X A;  4FO9 A;  1WEN A;  5B79 A;  2VPB A;  5H9M A;  3O33 A;  2JRJ A;  4V3L C;  4WZ3 B;  2YQM A;  2D8S A;  2PUY A;  1HYJ A;  2VPD A;  2L80 A;  2YYR A;  2I50 A;  5B76 A;  5H1T A;  3RPG C;  5DKA A;  1WEO A;  4O64 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...