1X4IA

Solution structure of phd domain in inhibitor of growth protein 3 (ing3)
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
70
structure length
70
Chain Sequence
GSSGSSGYCICNQVSYGEMVGCDNQDCPIEWFHYGCVGLTEAPKGKWYCPQCTAAMKRRGSRHKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inhibitor of growth protein 3
publication title Solution structure of PHD domain in inhibitor of growth protein 3 (ING3)
rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 5
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2005-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1x4iA00
2RI7A 2M6MA 2JMIA 5G04B 3N9OA 2KYUA 5KH7A 2VJFA 3PUQA 2CT2A 2E6RA 4A0CD 2MNZA 1RMDA 2E6SA 2LN0A 3HCSA 3ZTGA 1Z60A 2YQMA 5FEYA 3O33A 3SOWA 2YHNA 3L11A 1Z2QA 4GB0A 2ECNA 4UP0A 3ASLA 2VJEA 2M1RA 5TDWA 1WILA 2XEUA 2YU4A 3O34A 4YBMA 4B7YC 3RPGC 3SOUA 3O35A 4YBTA 5TABA 5G05B 4R7EA 5G0FA 2EA6A 2MD8C 4F52B 2LQ6A 1X4JA 2PUYA 4TKPB 4WZ3B 5LKUA 3U5NA 4LADB 4I7DA 4L58A 2H0DB 3KQIA 2VP7A 4FK5A 3HTKC 2ECJA 5EYAF 3IHPA 4YC9A 2CKLA 1IYMA 4NN2A 1WEWA 2FUIA 4ZDTA 2CSYA 2JRJA 2YSMA 3PURA 4X3GA 3EB6A 4YADA 2YW8A 4CA1A 1K2FA 5B78A 4S3OC 4QF2A 1WEEA 2KE1A 2LDRA 3C6WA 3KV5A 2K17A 4UP5A 4AYCB 3M99A 5KH9A 3FL2A 4FIPA 4UI9B 5B79A 1V87A 2KIZA 4WZ2A 2K4DA 2F42A 4N4FA 3QZVA 2CSZA 2FSAA 4ZQLA 2M85A 5LKXA 2MD7B 3EB5A 5TRBA 1WEVA 1G25A 1JM7B 2LXPC 1HYIA 1WEQA 3GV4A 4I7CA 3M62A 4A49A 3DQVR 5LCWB 2ECVA 2C2VS 2K1JA 4YBSA 2BAYA 2LXHC 4V3KC 3RTRB 1JOCA 4W4UA 2YYRA 2KR4A 2VPEA 5H1UA 4C9ZA 4BBQA 3M63A 1WEPA 3VK6A 1CHCA 4LJNA 3SOXA 2MA5A 4LLBA 2L5UA 2AN6A 2KWOA 4GNEA 5B76A 1DVPA 2F6NA 4IC3A 4B86C 3MHHA 2LGVA 4GNDA 4IC2A 2HYED 3ZPVE 2Y1MA 2OXQC 3ZNIA 1WGMA 1Z6UA 3HCUA 2NAAA 2VNFA 1HYJA 4WA6A 2KGGA 2LRIC 3LQIA 4AP4A 4LK9A 4PPEA 4ZUXU 5H9MA 4A4BA 3O70A 4P5OB 5B77A 3T7LA 1WEOA 3KV6A 2L43A 1N87A 2KFTA 3V43A 1BORA 5JG6A 2JMDA 3L1XA 4GNGA 3O7AA 5TBNA 4R8PK 4MSXA 4I7BA 5FB1A 5B8DA 2H0DA 2YUCA 3U5PA 3PHDA 2KWKA 2YQLA 5AIUA 3LRQA 2XB1A 3N9MA 3ZYQA 2VJFB 3N9PA 2QJ0A 3C5KA 2Y43A 4V3LC 4PTBA 2VPDA 4R2YA 2ECTA 3KNVA 3DPLR 5FB0A 2MA6A 1ZBDB 4CCGX 5FERA 1LDJB 2VJEB 3RPGB 2ECWA 3ZVZB 1WIMA 4AYCA 3U5MA 3I2DA 2VPGA 2JMJA 2KREA 2LGKA 2YHOA 2QIZA 5AITA 5C13A 4N3WA 5I3LA 3MHSA 5H1TA 4YATA 2G43A 3ZVYA 2LGLA 1WENA 1X4IA 2KU3A 5KH3A 2L0BA 1JM7A 3NG2A 5LKTA 1FBVA 2I50A 1WEMA 2KWNA 2LGGA 2PNXA 3U5OA 1WESA 2CKLB 5DINA 1E4UA 4XI1A 4YAXA 2KWJA 5DKAA 4S3OB 3N9NA 3LQJA 2FUUA 1VD4A 2ECIA 5H1VA 2YSJA 3HCTA 2L75A 5TDRA 4BHWA 3L1ZB 4QF3A 1WE9A 5J3XA 2YURA 4WZ0A 3O36A 2MIQA 1WEUA 2DX8A 3ZPV1 1MM3A 5B75A 3SHBA 3T6RA 3LQHA 1VYXA 2IDAA 2G6QA 2ECGA 4MVTA 2QICA 1U6GB 1WFKA 2HDPA 2C2LA 2MT5A 2UZGA 4FJCA 5D1LB 4A4CA 2Y1NA 2YREA 5C11A 1XWHA 3GL6A 1F62A 4AVXA 3N9LA 4O64A 4GNFA 3O37A 2EODA 2VPBA 4Q6FA 1X4UA 4YABA 4FO9A 5D1MB 2YT5A 5D1KB 1T1HA 4AUQB 2G45A 2L80A 2D8SA 4L7XA 1LDKC 4LKAA 1VFYA 2MNYA 2LV9A 2M3HA 2ZETC 1FP0A 2K16A 2F6JA 2EGPA 5LKZA 1MM2A 2KGIA 2RSDA 3N9QA 2MUMA
chains in the Genus database with same CATH superfamily
2RI7A 2M6MA 2JMIA 5G04B 3N9OA 2KYUA 5KH7A 2VJFA 3PUQA 2CT2A 2E6RA 4A0CD 3JUEA 2MNZA 1RMDA 2OWAA 2E6SA 2LN0A 3HCSA 3ZTGA 1Z60A 2YQMA 5FEYA 3O33A 3SOWA 2YHNA 3L11A 1Z2QA 4GB0A 2ECNA 4UP0A 1DCQA 3ASLA 2VJEA 2M1RA 5TDWA 1WILA 2XEUA 2YU4A 3O34A 4YBMA 4B7YC 3RPGC 3SOUA 3O35A 4YBTA 3LVQE 2D8UA 5TABA 5G05B 4R7EA 5G0FA 2EA6A 3Q1DA 2MD8C 4F52B 2LQ6A 1X4JA 2PUYA 4TKPB 4WZ3B 5LKUA 3U5NA 4LADB 4I7DA 2XP0A 2CRWA 4L58A 2H0DB 3KQIA 5K3QA 2KKXA 2VP7A 4FK5A 3HTKC 2ECJA 5EYAF 3IHPA 4YC9A 2CKLA 1IYMA 4NN2A 1WEWA 2FUIA 4ZDTA 2CSYA 4OGEA 2JRJA 2YSMA 3PURA 4X3GA 3EB6A 4YADA 2YW8A 4CA1A 1K2FA 5B78A 4S3OC 4QF2A 2FFWA 1WEEA 2KE1A 2LDRA 2IQJA 3C6WA 3KV5A 2K17A 4UP5A 4AYCB 1MBMA 3FEHA 3M99A 5KH9A 3FL2A 4FIPA 4UI9B 2JM3A 5B79A 1V87A 2KIZA 4WZ2A 5SVYA 2K4DA 2F42A 4N4FA 3QZVA 2CSZA 2CONA 3DDTA 5SVIB 2FSAA 3DWDA 4ZQLA 2M85A 5LKXA 2MD7B 3EB5A 2EXUA 5TRBA 1WEVA 1G25A 1JM7B 2LXPC 3FJUB 1HYIA 1WEQA 3GV4A 4I7CA 3M62A 4A49A 3DQVR 5LCWB 2ECVA 2C2VS 2K1JA 4YBSA 2BAYA 2LXHC 3SUBA 4V3KC 3RTRB 1JOCA 2LAUA 4W4UA 2YYRA 2KR4A 2VPEA 5H1UA 4C9ZA 4BBQA 3M63A 1WEPA 3FAOA 3VK6A 1CHCA 4LJNA 2EGMA 3SOXA 2MA5A 4LLBA 2L5UA 3PLWA 2AN6A 2KWOA 4GNEA 5B76A 1DVPA 2RR4A 2DJAA 2F6NA 4IC3A 4B86C 3MHHA 2LGVA 4GNDA 4IC2A 2HYED 3ZPVE 2Y1MA 2OXQC 3LJUX 3ZNIA 1WGMA 1Z6UA 3HCUA 2NAAA 2VNFA 1HYJA 4WA6A 2KGGA 2LRIC 3LQIA 4H9DA 4AP4A 4O62A 4LK9A 4PPEA 4QQ4A 4ZUXU 3T9KA 3O47A 2XOZA 5H9MA 4A4BA 3O70A 4P5OB 5B77A 3T7LA 1WEOA 3KV6A 2L43A 1N87A 2KFTA 3V43A 1BORA 5JG6A 2JMDA 5SVXA 2XOYA 3L1XA 4GNGA 3O7AA 5TBNA 4R8PK 4MSXA 4I7BA 5FB1A 5B8DA 2H0DA 2YUCA 2E61A 3U5PA 3PHDA 2KWKA 2YQLA 5AIUA 3LRQA 2XB1A 3N9MA 3ZYQA 2VJFB 3N9PA 2QJ0A 3C5KA 2CRRA 2B0OE 2Y43A 4V3LC 4PTBA 2VPDA 4R2YA 3M7KA 2ECTA 3KNVA 3DPLR 5FB0A 2MA6A 1ZBDB 4CCGX 5FERA 1LDJB 2VJEB 3RPGB 2ECWA 2DSMA 3ZVZB 1WIMA 4AYCA 3U5MA 3I2DA 2VPGA 2JMJA 2KREA 4Z0RA 2LGKA 2YHOA 2QIZA 5AITA 5C13A 4N3WA 5SVIA 5I3LA 3MHSA 3E2DA 5H1TA 2CSVA 4YATA 2G43A 3ZVYA 2LGLA 1WENA 1X4IA 2KU3A 5KH3A 4Z0OA 2L0BA 1JM7A 3NG2A 5LKTA 1FBVA 2I50A 1WEMA 2KWNA 3LVRE 2XOCA 2LGGA 2PNXA 3U5OA 2MKEA 2JUNA 1WESA 2CKLB 5DINA 1E4UA 4XI1A 4YAXA 2KWJA 3MDBC 5DKAA 4S3OB 3N9NA 3LQJA 2FUUA 1VD4A 2ECIA 5H1VA 2YSJA 3HCTA 2L75A 5TDRA 4BHWA 3L1ZB 4QF3A 1WE9A 3FM8C 5J3XA 2YURA 2P57A 3KDEC 4WZ0A 3O36A 2MIQA 1WEUA 2DX8A 3ZPV1 1MM3A 5B75A 3SHBA 3T6RA 3LQHA 1VYXA 2IDAA 2G6QA 4F1PA 2ECGA 2L7PA 4MVTA 2QICA 1U6GB 3H7HA 1WFKA 2HDPA 2C2LA 2FD4A 2MT5A 2UZGA 4FJCA 2M13A 5D1LB 4A4CA 2Y1NA 3LDYA 2YREA 5C11A 1XWHA 3GL6A 1F62A 4AVXA 3N9LA 4O64A 4GNFA 3O37A 2EODA 2VPBA 4Q6FA 1X4UA 4YABA 4FO9A 5D1MB 2YVRA 2YT5A 5D1KB 1T1HA 4AUQB 2G45A 4OGCA 2L80A 2D8SA 4L7XA 1LDKC 4LKAA 1VFYA 2MNYA 2LV9A 2M3HA 2ZETC 2KKYA 1FP0A 2K16A 3FANA 2F6JA 2EGPA 5LKZA 1MM2A 2KGIA 2RSDA 3N9QA 2MUMA
chains in the Genus database with same CATH topology
2RI7A 2M6MA 2JMIA 5G04B 3N9OA 2KYUA 5KH7A 2VJFA 3PUQA 2CT2A 2E6RA 4A0CD 2MNZA 1RMDA 2E6SA 2LN0A 3HCSA 3ZTGA 1Z60A 2YQMA 5FEYA 3O33A 3SOWA 2YHNA 3L11A 1Z2QA 4GB0A 2ECNA 4UP0A 3ASLA 2VJEA 2M1RA 5TDWA 1WILA 2XEUA 2YU4A 3O34A 4YBMA 4B7YC 3RPGC 3SOUA 3O35A 4YBTA 5TABA 5G05B 4R7EA 5G0FA 2EA6A 2MD8C 4F52B 2LQ6A 1X4JA 2PUYA 4TKPB 4WZ3B 5LKUA 3U5NA 4LADB 4I7DA 4L58A 2H0DB 3KQIA 2VP7A 4FK5A 3HTKC 2ECJA 5EYAF 3IHPA 4YC9A 2CKLA 1IYMA 4NN2A 1WEWA 2FUIA 4ZDTA 2CSYA 2JRJA 2YSMA 3PURA 4X3GA 3EB6A 4YADA 2YW8A 4CA1A 1K2FA 5B78A 4S3OC 4QF2A 1WEEA 2KE1A 2LDRA 3C6WA 3KV5A 2K17A 4UP5A 4AYCB 3M99A 5KH9A 3FL2A 4FIPA 4UI9B 5B79A 1V87A 2KIZA 4WZ2A 2K4DA 2F42A 4N4FA 3QZVA 2CSZA 2FSAA 4ZQLA 2M85A 5LKXA 2MD7B 3EB5A 5TRBA 1WEVA 1G25A 1JM7B 2LXPC 1HYIA 1WEQA 3GV4A 4I7CA 3M62A 4A49A 3DQVR 5LCWB 2ECVA 2C2VS 2K1JA 4YBSA 2BAYA 2LXHC 4V3KC 3RTRB 1JOCA 4W4UA 2YYRA 2KR4A 2VPEA 5H1UA 4C9ZA 4BBQA 3M63A 1WEPA 3VK6A 1CHCA 4LJNA 3SOXA 2MA5A 4LLBA 2L5UA 2AN6A 2KWOA 4GNEA 5B76A 1DVPA 2F6NA 4IC3A 4B86C 3MHHA 2LGVA 4GNDA 4IC2A 2HYED 3ZPVE 2Y1MA 2OXQC 3ZNIA 1WGMA 1Z6UA 3HCUA 2NAAA 2VNFA 1HYJA 4WA6A 2KGGA 2LRIC 3LQIA 4AP4A 4LK9A 4PPEA 4ZUXU 5H9MA 4A4BA 3O70A 4P5OB 5B77A 3T7LA 1WEOA 3KV6A 2L43A 1N87A 2KFTA 3V43A 1BORA 5JG6A 2JMDA 3L1XA 4GNGA 3O7AA 5TBNA 4R8PK 4MSXA 4I7BA 5FB1A 5B8DA 2H0DA 2YUCA 3U5PA 3PHDA 2KWKA 2YQLA 5AIUA 3LRQA 2XB1A 3N9MA 3ZYQA 2VJFB 3N9PA 2QJ0A 3C5KA 2Y43A 4V3LC 4PTBA 2VPDA 4R2YA 2ECTA 3KNVA 3DPLR 5FB0A 2MA6A 1ZBDB 4CCGX 5FERA 1LDJB 2VJEB 3RPGB 2ECWA 3ZVZB 1WIMA 4AYCA 3U5MA 3I2DA 2VPGA 2JMJA 2KREA 2LGKA 2YHOA 2QIZA 5AITA 5C13A 4N3WA 5I3LA 3MHSA 5H1TA 4YATA 2G43A 3ZVYA 2LGLA 1WENA 1X4IA 2KU3A 5KH3A 2L0BA 1JM7A 3NG2A 5LKTA 1FBVA 2I50A 1WEMA 2KWNA 2LGGA 2PNXA 3U5OA 1WESA 2CKLB 5DINA 1E4UA 4XI1A 4YAXA 2KWJA 5DKAA 4S3OB 3N9NA 3LQJA 2FUUA 1VD4A 2ECIA 5H1VA 2YSJA 3HCTA 2L75A 5TDRA 4BHWA 3L1ZB 4QF3A 1WE9A 5J3XA 2YURA 4WZ0A 3O36A 2MIQA 1WEUA 2DX8A 3ZPV1 1MM3A 5B75A 3SHBA 3T6RA 3LQHA 1VYXA 2IDAA 2G6QA 2ECGA 4MVTA 2QICA 1U6GB 1WFKA 2HDPA 2C2LA 2MT5A 2UZGA 4FJCA 5D1LB 4A4CA 2Y1NA 2YREA 5C11A 1XWHA 3GL6A 1F62A 4AVXA 3N9LA 4O64A 4GNFA 3O37A 2EODA 2VPBA 4Q6FA 1X4UA 4YABA 4FO9A 5D1MB 2YT5A 5D1KB 1T1HA 4AUQB 2G45A 2L80A 2D8SA 4L7XA 1LDKC 4LKAA 1VFYA 2MNYA 2LV9A 2M3HA 2ZETC 1FP0A 2K16A 2F6JA 2EGPA 5LKZA 1MM2A 2KGIA 2RSDA 3N9QA 2MUMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RI7 A;  2M6M A;  2JMI A;  5G04 B;  3N9O A;  2KYU A;  5KH7 A;  2VJF A;  3PUQ A;  2CT2 A;  2E6R A;  4A0C D;  2MNZ A;  1RMD A;  2E6S A;  2LN0 A;  3HCS A;  3ZTG A;  1Z60 A;  2YQM A;  5FEY A;  3O33 A;  3SOW A;  2YHN A;  3L11 A;  1Z2Q A;  4GB0 A;  2ECN A;  4UP0 A;  3ASL A;  2VJE A;  2M1R A;  5TDW A;  1WIL A;  2XEU A;  2YU4 A;  3O34 A;  4YBM A;  4B7Y C;  3RPG C;  3SOU A;  3O35 A;  4YBT A;  5TAB A;  5G05 B;  4R7E A;  5G0F A;  2EA6 A;  2MD8 C;  4F52 B;  2LQ6 A;  1X4J A;  2PUY A;  4TKP B;  4WZ3 B;  5LKU A;  3U5N A;  4LAD B;  4I7D A;  4L58 A;  2H0D B;  3KQI A;  2VP7 A;  4FK5 A;  3HTK C;  2ECJ A;  5EYA F;  3IHP A;  4YC9 A;  2CKL A;  1IYM A;  4NN2 A;  1WEW A;  2FUI A;  4ZDT A;  2CSY A;  2JRJ A;  2YSM A;  3PUR A;  4X3G A;  3EB6 A;  4YAD A;  2YW8 A;  4CA1 A;  1K2F A;  5B78 A;  4S3O C;  4QF2 A;  1WEE A;  2KE1 A;  2LDR A;  3C6W A;  3KV5 A;  2K17 A;  4UP5 A;  4AYC B;  3M99 A;  5KH9 A;  3FL2 A;  4FIP A;  4UI9 B;  5B79 A;  1V87 A;  2KIZ A;  4WZ2 A;  2K4D A;  2F42 A;  4N4F A;  3QZV A;  2CSZ A;  2FSA A;  4ZQL A;  2M85 A;  5LKX A;  2MD7 B;  3EB5 A;  5TRB A;  1WEV A;  1G25 A;  1JM7 B;  2LXP C;  1HYI A;  1WEQ A;  3GV4 A;  4I7C A;  3M62 A;  4A49 A;  3DQV R;  5LCW B;  2ECV A;  2C2V S;  2K1J A;  4YBS A;  2BAY A;  2LXH C;  4V3K C;  3RTR B;  1JOC A;  4W4U A;  2YYR A;  2KR4 A;  2VPE A;  5H1U A;  4C9Z A;  4BBQ A;  3M63 A;  1WEP A;  3VK6 A;  1CHC A;  4LJN A;  3SOX A;  2MA5 A;  4LLB A;  2L5U A;  2AN6 A;  2KWO A;  4GNE A;  5B76 A;  1DVP A;  2F6N A;  4IC3 A;  4B86 C;  3MHH A;  2LGV A;  4GND A;  4IC2 A;  2HYE D;  3ZPV E;  2Y1M A;  2OXQ C;  3ZNI A;  1WGM A;  1Z6U A;  3HCU A;  2NAA A;  2VNF A;  1HYJ A;  4WA6 A;  2KGG A;  2LRI C;  3LQI A;  4AP4 A;  4LK9 A;  4PPE A;  4ZUX U;  5H9M A;  4A4B A;  3O70 A;  4P5O B;  5B77 A;  3T7L A;  1WEO A;  3KV6 A;  2L43 A;  1N87 A;  2KFT A;  3V43 A;  1BOR A;  5JG6 A;  2JMD A;  3L1X A;  4GNG A;  3O7A A;  5TBN A;  4R8P K;  4MSX A;  4I7B A;  5FB1 A;  5B8D A;  2H0D A;  2YUC A;  3U5P A;  3PHD A;  2KWK A;  2YQL A;  5AIU A;  3LRQ A;  2XB1 A;  3N9M A;  3ZYQ A;  2VJF B;  3N9P A;  2QJ0 A;  3C5K A;  2Y43 A;  4V3L C;  4PTB A;  2VPD A;  4R2Y A;  2ECT A;  3KNV A;  3DPL R;  5FB0 A;  2MA6 A;  1ZBD B;  4CCG X;  5FER A;  1LDJ B;  2VJE B;  3RPG B;  2ECW A;  3ZVZ B;  1WIM A;  4AYC A;  3U5M A;  3I2D A;  2VPG A;  2JMJ A;  2KRE A;  2LGK A;  2YHO A;  2QIZ A;  5AIT A;  5C13 A;  4N3W A;  5I3L A;  3MHS A;  5H1T A;  4YAT A;  2G43 A;  3ZVY A;  2LGL A;  1WEN A;  1X4I A;  2KU3 A;  5KH3 A;  2L0B A;  1JM7 A;  3NG2 A;  5LKT A;  1FBV A;  2I50 A;  1WEM A;  2KWN A;  2LGG A;  2PNX A;  3U5O A;  1WES A;  2CKL B;  5DIN A;  1E4U A;  4XI1 A;  4YAX A;  2KWJ A;  5DKA A;  4S3O B;  3N9N A;  3LQJ A;  2FUU A;  1VD4 A;  2ECI A;  5H1V A;  2YSJ A;  3HCT A;  2L75 A;  5TDR A;  4BHW A;  3L1Z B;  4QF3 A;  1WE9 A;  5J3X A;  2YUR A;  4WZ0 A;  3O36 A;  2MIQ A;  1WEU A;  2DX8 A;  3ZPV 1;  1MM3 A;  5B75 A;  3SHB A;  3T6R A;  3LQH A;  1VYX A;  2IDA A;  2G6Q A;  2ECG A;  4MVT A;  2QIC A;  1U6G B;  1WFK A;  2HDP A;  2C2L A;  2MT5 A;  2UZG A;  4FJC A;  5D1L B;  4A4C A;  2Y1N A;  2YRE A;  5C11 A;  1XWH A;  3GL6 A;  1F62 A;  4AVX A;  3N9L A;  4O64 A;  4GNF A;  3O37 A;  2EOD A;  2VPB A;  4Q6F A;  1X4U A;  4YAB A;  4FO9 A;  5D1M B;  2YT5 A;  5D1K B;  1T1H A;  4AUQ B;  2G45 A;  2L80 A;  2D8S A;  4L7X A;  1LDK C;  4LKA A;  1VFY A;  2MNY A;  2LV9 A;  2M3H A;  2ZET C;  1FP0 A;  2K16 A;  2F6J A;  2EGP A;  5LKZ A;  1MM2 A;  2KGI A;  2RSD A;  3N9Q A;  2MUM A; 
#chains in the Genus database with same CATH topology
 2RI7 A;  2M6M A;  2JMI A;  5G04 B;  3N9O A;  2KYU A;  5KH7 A;  2VJF A;  3PUQ A;  2CT2 A;  2E6R A;  4A0C D;  3JUE A;  2MNZ A;  1RMD A;  2OWA A;  2E6S A;  2LN0 A;  3HCS A;  3ZTG A;  1Z60 A;  2YQM A;  5FEY A;  3O33 A;  3SOW A;  2YHN A;  3L11 A;  1Z2Q A;  4GB0 A;  2ECN A;  4UP0 A;  1DCQ A;  3ASL A;  2VJE A;  2M1R A;  5TDW A;  1WIL A;  2XEU A;  2YU4 A;  3O34 A;  4YBM A;  4B7Y C;  3RPG C;  3SOU A;  3O35 A;  4YBT A;  3LVQ E;  2D8U A;  5TAB A;  5G05 B;  4R7E A;  5G0F A;  2EA6 A;  3Q1D A;  2MD8 C;  4F52 B;  2LQ6 A;  1X4J A;  2PUY A;  4TKP B;  4WZ3 B;  5LKU A;  3U5N A;  4LAD B;  4I7D A;  2XP0 A;  2CRW A;  4L58 A;  2H0D B;  3KQI A;  5K3Q A;  2KKX A;  2VP7 A;  4FK5 A;  3HTK C;  2ECJ A;  5EYA F;  3IHP A;  4YC9 A;  2CKL A;  1IYM A;  4NN2 A;  1WEW A;  2FUI A;  4ZDT A;  2CSY A;  4OGE A;  2JRJ A;  2YSM A;  3PUR A;  4X3G A;  3EB6 A;  4YAD A;  2YW8 A;  4CA1 A;  1K2F A;  5B78 A;  4S3O C;  4QF2 A;  2FFW A;  1WEE A;  2KE1 A;  2LDR A;  2IQJ A;  3C6W A;  3KV5 A;  2K17 A;  4UP5 A;  4AYC B;  1MBM A;  3FEH A;  3M99 A;  5KH9 A;  3FL2 A;  4FIP A;  4UI9 B;  2JM3 A;  5B79 A;  1V87 A;  2KIZ A;  4WZ2 A;  5SVY A;  2K4D A;  2F42 A;  4N4F A;  3QZV A;  2CSZ A;  2CON A;  3DDT A;  5SVI B;  2FSA A;  3DWD A;  4ZQL A;  2M85 A;  5LKX A;  2MD7 B;  3EB5 A;  2EXU A;  5TRB A;  1WEV A;  1G25 A;  1JM7 B;  2LXP C;  3FJU B;  1HYI A;  1WEQ A;  3GV4 A;  4I7C A;  3M62 A;  4A49 A;  3DQV R;  5LCW B;  2ECV A;  2C2V S;  2K1J A;  4YBS A;  2BAY A;  2LXH C;  3SUB A;  4V3K C;  3RTR B;  1JOC A;  2LAU A;  4W4U A;  2YYR A;  2KR4 A;  2VPE A;  5H1U A;  4C9Z A;  4BBQ A;  3M63 A;  1WEP A;  3FAO A;  3VK6 A;  1CHC A;  4LJN A;  2EGM A;  3SOX A;  2MA5 A;  4LLB A;  2L5U A;  3PLW A;  2AN6 A;  2KWO A;  4GNE A;  5B76 A;  1DVP A;  2RR4 A;  2DJA A;  2F6N A;  4IC3 A;  4B86 C;  3MHH A;  2LGV A;  4GND A;  4IC2 A;  2HYE D;  3ZPV E;  2Y1M A;  2OXQ C;  3LJU X;  3ZNI A;  1WGM A;  1Z6U A;  3HCU A;  2NAA A;  2VNF A;  1HYJ A;  4WA6 A;  2KGG A;  2LRI C;  3LQI A;  4H9D A;  4AP4 A;  4O62 A;  4LK9 A;  4PPE A;  4QQ4 A;  4ZUX U;  3T9K A;  3O47 A;  2XOZ A;  5H9M A;  4A4B A;  3O70 A;  4P5O B;  5B77 A;  3T7L A;  1WEO A;  3KV6 A;  2L43 A;  1N87 A;  2KFT A;  3V43 A;  1BOR A;  5JG6 A;  2JMD A;  5SVX A;  2XOY A;  3L1X A;  4GNG A;  3O7A A;  5TBN A;  4R8P K;  4MSX A;  4I7B A;  5FB1 A;  5B8D A;  2H0D A;  2YUC A;  2E61 A;  3U5P A;  3PHD A;  2KWK A;  2YQL A;  5AIU A;  3LRQ A;  2XB1 A;  3N9M A;  3ZYQ A;  2VJF B;  3N9P A;  2QJ0 A;  3C5K A;  2CRR A;  2B0O E;  2Y43 A;  4V3L C;  4PTB A;  2VPD A;  4R2Y A;  3M7K A;  2ECT A;  3KNV A;  3DPL R;  5FB0 A;  2MA6 A;  1ZBD B;  4CCG X;  5FER A;  1LDJ B;  2VJE B;  3RPG B;  2ECW A;  2DSM A;  3ZVZ B;  1WIM A;  4AYC A;  3U5M A;  3I2D A;  2VPG A;  2JMJ A;  2KRE A;  4Z0R A;  2LGK A;  2YHO A;  2QIZ A;  5AIT A;  5C13 A;  4N3W A;  5SVI A;  5I3L A;  3MHS A;  3E2D A;  5H1T A;  2CSV A;  4YAT A;  2G43 A;  3ZVY A;  2LGL A;  1WEN A;  1X4I A;  2KU3 A;  5KH3 A;  4Z0O A;  2L0B A;  1JM7 A;  3NG2 A;  5LKT A;  1FBV A;  2I50 A;  1WEM A;  2KWN A;  3LVR E;  2XOC A;  2LGG A;  2PNX A;  3U5O A;  2MKE A;  2JUN A;  1WES A;  2CKL B;  5DIN A;  1E4U A;  4XI1 A;  4YAX A;  2KWJ A;  3MDB C;  5DKA A;  4S3O B;  3N9N A;  3LQJ A;  2FUU A;  1VD4 A;  2ECI A;  5H1V A;  2YSJ A;  3HCT A;  2L75 A;  5TDR A;  4BHW A;  3L1Z B;  4QF3 A;  1WE9 A;  3FM8 C;  5J3X A;  2YUR A;  2P57 A;  3KDE C;  4WZ0 A;  3O36 A;  2MIQ A;  1WEU A;  2DX8 A;  3ZPV 1;  1MM3 A;  5B75 A;  3SHB A;  3T6R A;  3LQH A;  1VYX A;  2IDA A;  2G6Q A;  4F1P A;  2ECG A;  2L7P A;  4MVT A;  2QIC A;  1U6G B;  3H7H A;  1WFK A;  2HDP A;  2C2L A;  2FD4 A;  2MT5 A;  2UZG A;  4FJC A;  2M13 A;  5D1L B;  4A4C A;  2Y1N A;  3LDY A;  2YRE A;  5C11 A;  1XWH A;  3GL6 A;  1F62 A;  4AVX A;  3N9L A;  4O64 A;  4GNF A;  3O37 A;  2EOD A;  2VPB A;  4Q6F A;  1X4U A;  4YAB A;  4FO9 A;  5D1M B;  2YVR A;  2YT5 A;  5D1K B;  1T1H A;  4AUQ B;  2G45 A;  4OGC A;  2L80 A;  2D8S A;  4L7X A;  1LDK C;  4LKA A;  1VFY A;  2MNY A;  2LV9 A;  2M3H A;  2ZET C;  2KKY A;  1FP0 A;  2K16 A;  3FAN A;  2F6J A;  2EGP A;  5LKZ A;  1MM2 A;  2KGI A;  2RSD A;  3N9Q A;  2MUM A; 
#chains in the Genus database with same CATH homology
 2RI7 A;  2M6M A;  2JMI A;  5G04 B;  3N9O A;  2KYU A;  5KH7 A;  2VJF A;  3PUQ A;  2CT2 A;  2E6R A;  4A0C D;  2MNZ A;  1RMD A;  2E6S A;  2LN0 A;  3HCS A;  3ZTG A;  1Z60 A;  2YQM A;  5FEY A;  3O33 A;  3SOW A;  2YHN A;  3L11 A;  1Z2Q A;  4GB0 A;  2ECN A;  4UP0 A;  3ASL A;  2VJE A;  2M1R A;  5TDW A;  1WIL A;  2XEU A;  2YU4 A;  3O34 A;  4YBM A;  4B7Y C;  3RPG C;  3SOU A;  3O35 A;  4YBT A;  5TAB A;  5G05 B;  4R7E A;  5G0F A;  2EA6 A;  2MD8 C;  4F52 B;  2LQ6 A;  1X4J A;  2PUY A;  4TKP B;  4WZ3 B;  5LKU A;  3U5N A;  4LAD B;  4I7D A;  4L58 A;  2H0D B;  3KQI A;  2VP7 A;  4FK5 A;  3HTK C;  2ECJ A;  5EYA F;  3IHP A;  4YC9 A;  2CKL A;  1IYM A;  4NN2 A;  1WEW A;  2FUI A;  4ZDT A;  2CSY A;  2JRJ A;  2YSM A;  3PUR A;  4X3G A;  3EB6 A;  4YAD A;  2YW8 A;  4CA1 A;  1K2F A;  5B78 A;  4S3O C;  4QF2 A;  1WEE A;  2KE1 A;  2LDR A;  3C6W A;  3KV5 A;  2K17 A;  4UP5 A;  4AYC B;  3M99 A;  5KH9 A;  3FL2 A;  4FIP A;  4UI9 B;  5B79 A;  1V87 A;  2KIZ A;  4WZ2 A;  2K4D A;  2F42 A;  4N4F A;  3QZV A;  2CSZ A;  2FSA A;  4ZQL A;  2M85 A;  5LKX A;  2MD7 B;  3EB5 A;  5TRB A;  1WEV A;  1G25 A;  1JM7 B;  2LXP C;  1HYI A;  1WEQ A;  3GV4 A;  4I7C A;  3M62 A;  4A49 A;  3DQV R;  5LCW B;  2ECV A;  2C2V S;  2K1J A;  4YBS A;  2BAY A;  2LXH C;  4V3K C;  3RTR B;  1JOC A;  4W4U A;  2YYR A;  2KR4 A;  2VPE A;  5H1U A;  4C9Z A;  4BBQ A;  3M63 A;  1WEP A;  3VK6 A;  1CHC A;  4LJN A;  3SOX A;  2MA5 A;  4LLB A;  2L5U A;  2AN6 A;  2KWO A;  4GNE A;  5B76 A;  1DVP A;  2F6N A;  4IC3 A;  4B86 C;  3MHH A;  2LGV A;  4GND A;  4IC2 A;  2HYE D;  3ZPV E;  2Y1M A;  2OXQ C;  3ZNI A;  1WGM A;  1Z6U A;  3HCU A;  2NAA A;  2VNF A;  1HYJ A;  4WA6 A;  2KGG A;  2LRI C;  3LQI A;  4AP4 A;  4LK9 A;  4PPE A;  4ZUX U;  5H9M A;  4A4B A;  3O70 A;  4P5O B;  5B77 A;  3T7L A;  1WEO A;  3KV6 A;  2L43 A;  1N87 A;  2KFT A;  3V43 A;  1BOR A;  5JG6 A;  2JMD A;  3L1X A;  4GNG A;  3O7A A;  5TBN A;  4R8P K;  4MSX A;  4I7B A;  5FB1 A;  5B8D A;  2H0D A;  2YUC A;  3U5P A;  3PHD A;  2KWK A;  2YQL A;  5AIU A;  3LRQ A;  2XB1 A;  3N9M A;  3ZYQ A;  2VJF B;  3N9P A;  2QJ0 A;  3C5K A;  2Y43 A;  4V3L C;  4PTB A;  2VPD A;  4R2Y A;  2ECT A;  3KNV A;  3DPL R;  5FB0 A;  2MA6 A;  1ZBD B;  4CCG X;  5FER A;  1LDJ B;  2VJE B;  3RPG B;  2ECW A;  3ZVZ B;  1WIM A;  4AYC A;  3U5M A;  3I2D A;  2VPG A;  2JMJ A;  2KRE A;  2LGK A;  2YHO A;  2QIZ A;  5AIT A;  5C13 A;  4N3W A;  5I3L A;  3MHS A;  5H1T A;  4YAT A;  2G43 A;  3ZVY A;  2LGL A;  1WEN A;  1X4I A;  2KU3 A;  5KH3 A;  2L0B A;  1JM7 A;  3NG2 A;  5LKT A;  1FBV A;  2I50 A;  1WEM A;  2KWN A;  2LGG A;  2PNX A;  3U5O A;  1WES A;  2CKL B;  5DIN A;  1E4U A;  4XI1 A;  4YAX A;  2KWJ A;  5DKA A;  4S3O B;  3N9N A;  3LQJ A;  2FUU A;  1VD4 A;  2ECI A;  5H1V A;  2YSJ A;  3HCT A;  2L75 A;  5TDR A;  4BHW A;  3L1Z B;  4QF3 A;  1WE9 A;  5J3X A;  2YUR A;  4WZ0 A;  3O36 A;  2MIQ A;  1WEU A;  2DX8 A;  3ZPV 1;  1MM3 A;  5B75 A;  3SHB A;  3T6R A;  3LQH A;  1VYX A;  2IDA A;  2G6Q A;  2ECG A;  4MVT A;  2QIC A;  1U6G B;  1WFK A;  2HDP A;  2C2L A;  2MT5 A;  2UZG A;  4FJC A;  5D1L B;  4A4C A;  2Y1N A;  2YRE A;  5C11 A;  1XWH A;  3GL6 A;  1F62 A;  4AVX A;  3N9L A;  4O64 A;  4GNF A;  3O37 A;  2EOD A;  2VPB A;  4Q6F A;  1X4U A;  4YAB A;  4FO9 A;  5D1M B;  2YT5 A;  5D1K B;  1T1H A;  4AUQ B;  2G45 A;  2L80 A;  2D8S A;  4L7X A;  1LDK C;  4LKA A;  1VFY A;  2MNY A;  2LV9 A;  2M3H A;  2ZET C;  1FP0 A;  2K16 A;  2F6J A;  2EGP A;  5LKZ A;  1MM2 A;  2KGI A;  2RSD A;  3N9Q A;  2MUM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...