1X4IA

Solution structure of phd domain in inhibitor of growth protein 3 (ing3)
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
70
structure length
70
Chain Sequence
GSSGSSGYCICNQVSYGEMVGCDNQDCPIEWFHYGCVGLTEAPKGKWYCPQCTAAMKRRGSRHKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of PHD domain in inhibitor of growth protein 3 (ING3)
rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Inhibitor of growth protein 3
total genus 5
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2005-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1x4iA00
5TBNA 4W4UA 3RPGB 2F6JA 2PNXA 2VPEA 1BORA 4XI1A 1VYXA 5LKZA 2C2LA 2VPBA 1X4JA 4R2YA 2VJFB 2YHNA 1WILA 1WE9A 4ZQLA 2MD7B 3ZYQA 2ECTA 2KWOA 1WGMA 5B78A 2G43A 3ZTGA 1HYIA 2VPDA 4YC9A 3KNVA 3N9OA 2PUYA 3O7AA 3T7LA 4N3WA 3DQVR 1RMDA 4LLBA 2ECNA 4IC3A 3O34A 2LXPC 5KH9A 4YAXA 4A4CA 4L7XA 4GB0A 3L1ZB 2ECWA 4GNEA 4GNGA 1X4IA 1HYJA 3IHPA 3KQIA 1N87A 2YHOA 3V43A 2CSYA 2LDRA 4WZ0A 2HYED 2ZETC 4CCGX 2VNFA 4GNDA 5H1TA 5J3XA 4YATA 2F42A 5LKXA 2M3HA 2L75A 3LQHA 4FIPA 3GV4A 4IC2A 2FUIA 3C5KA 4AVXA 2E6SA 4BHWA 4LK9A 2KR4A 3SOXA 2ECIA 3U5OA 1K2FA 1WFKA 5C11A 1WIMA 3DPLR 4L58A 2YREA 2CSZA 4B86C 4A49A 2K17A 2H0DB 4CA1A 3HCSA 5H1VA 2MNYA 2VP7A 2ECVA 2H0DA 4Q6FA 5FB1A 4O64A 4S3OB 1DVPA 2LRIC 2MA6A 4WZ2A 5EYAF 2MIQA 4AYCB 4PTBA 3ZVYA 2YU4A 5TABA 1X4UA 2BAYA 2M1RA 2D8SA 4I7DA 2CKLA 4R7EA 5FERA 1WEUA 2MNZA 3ZPV1 1V87A 4UP5A 2KU3A 2YQMA 4YBTA 1G25A 1VFYA 1Z2QA 3L1XA 3SHBA 2LGVA 2EGPA 2LXHC 2EODA 3ASLA 5FB0A 3SOUA 3U5NA 2Y43A 3HTKC 4R8PK 5AIUA 2Y1NA 4A4BA 4WZ3B 4GNFA 3SOWA 2K1JA 5LCWB 3I2DA 5B77A 5AITA 1U6GB 3U5MA 1LDKC 2YW8A 3RPGC 5JG6A 1WESA 1Z60A 5G05B 5LKUA 3EB6A 4UI9B 4V3LC 2JMDA 1JM7A 2M6MA 5TDWA 2QIZA 2YT5A 2DX8A 2XB1A 2C2VS 4YBSA 2MA5A 2KWNA 5B75A 2UZGA 3NG2A 4B7YC 4TKPB 2E6RA 2L0BA 4YBMA 2HDPA 2KIZA 2L80A 1FBVA 2KWJA 2JMJA 4BBQA 1WEMA 2Y1MA 4C9ZA 2CKLB 2QICA 2K4DA 2YYRA 4AP4A 3O36A 1VD4A 2RI7A 3N9MA 3O37A 5KH7A 2VPGA 3T6RA 3MHSA 2VJEA 2KE1A 4AUQB 3EB5A 3ZVZB 1WEEA 3LQJA 1WEWA 5B79A 2LN0A 2MT5A 1WEQA 3VK6A 5B76A 1WEPA 4FK5A 4A0CD 4YABA 4X3GA 2QJ0A 2VJEB 4YADA 2KWKA 2YSMA 1CHCA 5TRBA 4F52B 2KGGA 3GL6A 2M85A 2CT2A 4P5OB 2JRJA 4PPEA 3RTRB 3C6WA 4WA6A 2AN6A 5I3LA 5C13A 1Z6UA 3KV5A 2LQ6A 2K16A 3O70A 4MSXA 2G6QA 5G0FA 2NAAA 5KH3A 3PURA 2LV9A 1F62A 3O33A 4FO9A 5B8DA 2ECGA 5FEYA 4FJCA 4V3KC 2LGKA 2MD8C 3PHDA 2I50A 2KFTA 4UP0A 1T1HA 2LGGA 1WEVA 4QF2A 3ZNIA 3M99A 3M62A 2FSAA 2JMIA 1IYMA 2MUMA 2KREA 5DINA 4I7CA 4S3OC 2YQLA 3QZVA 2VJFA 2L43A 3MHHA 3L11A 5D1KB 4I7BA 1E4UA 3ZPVE 3N9QA 5D1LB 2F6NA 5G04B 1WEOA 2OXQC 5DKAA 2L5UA 3U5PA 4LKAA 4N4FA 1WENA 2YUCA 1FP0A 2ECJA 3FL2A 3LQIA 3HCTA 2KGIA 5D1MB 2G45A 4ZUXU 5H9MA 3PUQA 3N9LA 2YURA 1MM2A 1MM3A 2KYUA 4LADB 5TDRA 3KV6A 2IDAA 3HCUA 2LGLA 5LKTA 1XWHA 4AYCA 1LDJB 3N9NA 4LJNA 1ZBDB 4ZDTA 2XEUA 2EA6A 4QF3A 5H1UA 3O35A 1JOCA 3M63A 2FUUA 3N9PA 2RSDA 3LRQA 4NN2A 2YSJA 4MVTA 1JM7B
chains in the Genus database with same CATH superfamily
5TBNA 4W4UA 3RPGB 2F6JA 2PNXA 2VPEA 1BORA 4XI1A 1VYXA 5LKZA 2C2LA 2VPBA 3DWDA 1X4JA 4R2YA 2XOCA 3LVRE 3M7KA 2VJFB 2YHNA 1WILA 2FD4A 3Q1DA 1WE9A 4ZQLA 2MD7B 3ZYQA 2FFWA 2ECTA 2KWOA 1WGMA 3FJUB 5B78A 2G43A 3ZTGA 4QQ4A 1HYIA 2VPDA 4YC9A 3KNVA 3N9OA 2PUYA 3O7AA 3T7LA 4N3WA 3DQVR 1RMDA 4LLBA 2ECNA 4IC3A 3O34A 2LXPC 5KH9A 4YAXA 3LJUX 4L7XA 4A4CA 4GB0A 2LAUA 3L1ZB 2ECWA 3H7HA 4GNGA 4GNEA 1X4IA 1HYJA 2JUNA 3IHPA 3KQIA 2JM3A 1N87A 2YHOA 3FAOA 3V43A 2CSYA 2LDRA 2P57A 2OWAA 4WZ0A 2HYED 2ZETC 4CCGX 2VNFA 4GNDA 2YVRA 5H1TA 5J3XA 4YATA 2F42A 5LKXA 2M3HA 2L75A 3LQHA 4FIPA 3GV4A 4IC2A 2FUIA 3C5KA 4AVXA 2E6SA 4BHWA 4LK9A 2KR4A 3SOXA 2ECIA 3U5OA 2E61A 1K2FA 1WFKA 5C11A 1WIMA 3DPLR 4L58A 2YREA 2CSZA 4B86C 2DJAA 4A49A 2K17A 2H0DB 4CA1A 3HCSA 2L7PA 5H1VA 4F1PA 2MNYA 2VP7A 3LVQE 2ECVA 3JUEA 2H0DA 4Q6FA 5FB1A 4O64A 4S3OB 1DVPA 2LRIC 2MA6A 4WZ2A 5EYAF 2MIQA 4AYCB 4PTBA 3ZVYA 2YU4A 5TABA 1X4UA 4O62A 2D8UA 2BAYA 2M1RA 2D8SA 4Z0OA 4I7DA 2CKLA 4R7EA 5FERA 1WEUA 2MNZA 3ZPV1 1V87A 4UP5A 2KU3A 2YQMA 4YBTA 1G25A 1VFYA 1Z2QA 3L1XA 3SHBA 2M13A 2LGVA 2EGPA 2LXHC 2EODA 3ASLA 3SUBA 5FB0A 3SOUA 3U5NA 2Y43A 3HTKC 4R8PK 5AIUA 2Y1NA 4A4BA 4WZ3B 4GNFA 3SOWA 2K1JA 5LCWB 3I2DA 5B77A 5SVIB 5AITA 1U6GB 3U5MA 2EXUA 1LDKC 2YW8A 3RPGC 5JG6A 1WESA 1Z60A 5G05B 5LKUA 3EB6A 4UI9B 4V3LC 2JMDA 1JM7A 2M6MA 2XOZA 5TDWA 2QIZA 2YT5A 2DX8A 2XB1A 2C2VS 4YBSA 2MA5A 2KWNA 5B75A 2UZGA 3NG2A 4B7YC 3KDEC 4TKPB 2E6RA 2L0BA 4YBMA 2HDPA 2CRWA 2KIZA 2L80A 1FBVA 2KWJA 2JMJA 4BBQA 1WEMA 2Y1MA 4C9ZA 2CKLB 2QICA 2K4DA 2YYRA 4AP4A 3O36A 1VD4A 2RI7A 3N9MA 3O37A 3E2DA 2KKXA 5KH7A 2VPGA 3T6RA 3MDBC 3MHSA 2VJEA 2KE1A 4AUQB 3EB5A 3ZVZB 1WEEA 3LQJA 1WEWA 5B79A 2LN0A 2MT5A 1WEQA 3VK6A 5B76A 1WEPA 4FK5A 4A0CD 4YABA 4X3GA 2QJ0A 2VJEB 4YADA 2KWKA 2YSMA 1CHCA 5TRBA 3FANA 4F52B 2KGGA 3GL6A 2XP0A 2M85A 2CT2A 4P5OB 3T9KA 2JRJA 4PPEA 3RTRB 3C6WA 3DDTA 4WA6A 2AN6A 5I3LA 5C13A 1Z6UA 3KV5A 2LQ6A 2K16A 3O70A 4MSXA 2G6QA 2KKYA 5G0FA 2NAAA 4OGEA 5KH3A 3PURA 2LV9A 1F62A 3O33A 4FO9A 3LDYA 5B8DA 2ECGA 5FEYA 4FJCA 4V3KC 5K3QA 3FEHA 2LGKA 2MD8C 2MKEA 2I50A 3PHDA 2KFTA 4UP0A 4H9DA 1T1HA 2LGGA 1WEVA 4QF2A 3ZNIA 3M99A 3M62A 2FSAA 2JMIA 1IYMA 2MUMA 2KREA 5DINA 4I7CA 4S3OC 2YQLA 3QZVA 2CSVA 2VJFA 2L43A 3MHHA 3L11A 5D1KB 3FM8C 4I7BA 1E4UA 3ZPVE 3N9QA 2CONA 5D1LB 2EGMA 2F6NA 4OGCA 2RR4A 5G04B 1WEOA 2OXQC 5SVYA 5DKAA 2L5UA 3U5PA 4LKAA 4N4FA 1WENA 2YUCA 1FP0A 2XOYA 2ECJA 3FL2A 4Z0RA 3LQIA 5SVIA 1MBMA 3HCTA 2KGIA 5D1MB 2G45A 4ZUXU 5H9MA 2IQJA 3PUQA 3N9LA 2YURA 1MM2A 1MM3A 2KYUA 4LADB 5TDRA 3KV6A 2IDAA 3HCUA 5SVXA 2B0OE 2LGLA 5LKTA 1XWHA 4AYCA 1LDJB 3N9NA 2CRRA 1ZBDB 4LJNA 4ZDTA 2XEUA 2EA6A 3O47A 3PLWA 4QF3A 5H1UA 3O35A 1DCQA 1JOCA 3M63A 2FUUA 3N9PA 2RSDA 2DSMA 3LRQA 4NN2A 2YSJA 4MVTA 1JM7B
chains in the Genus database with same CATH topology
5TBNA 4W4UA 3RPGB 2F6JA 2PNXA 2VPEA 1BORA 4XI1A 1VYXA 5LKZA 2C2LA 2VPBA 1X4JA 4R2YA 2VJFB 2YHNA 1WILA 1WE9A 4ZQLA 2MD7B 3ZYQA 2ECTA 2KWOA 1WGMA 5B78A 2G43A 3ZTGA 1HYIA 2VPDA 4YC9A 3KNVA 3N9OA 2PUYA 3O7AA 3T7LA 4N3WA 3DQVR 1RMDA 4LLBA 2ECNA 4IC3A 3O34A 2LXPC 5KH9A 4YAXA 4A4CA 4L7XA 4GB0A 3L1ZB 2ECWA 4GNEA 4GNGA 1X4IA 1HYJA 3IHPA 3KQIA 1N87A 2YHOA 3V43A 2CSYA 2LDRA 4WZ0A 2HYED 2ZETC 4CCGX 2VNFA 4GNDA 5H1TA 5J3XA 4YATA 2F42A 5LKXA 2M3HA 2L75A 3LQHA 4FIPA 3GV4A 4IC2A 2FUIA 3C5KA 4AVXA 2E6SA 4BHWA 4LK9A 2KR4A 3SOXA 2ECIA 3U5OA 1K2FA 1WFKA 5C11A 1WIMA 3DPLR 4L58A 2YREA 2CSZA 4B86C 4A49A 2K17A 2H0DB 4CA1A 3HCSA 5H1VA 2MNYA 2VP7A 2ECVA 2H0DA 4Q6FA 5FB1A 4O64A 4S3OB 1DVPA 2LRIC 2MA6A 4WZ2A 5EYAF 2MIQA 4AYCB 4PTBA 3ZVYA 2YU4A 5TABA 1X4UA 2BAYA 2M1RA 2D8SA 4I7DA 2CKLA 4R7EA 5FERA 1WEUA 2MNZA 3ZPV1 1V87A 4UP5A 2KU3A 2YQMA 4YBTA 1G25A 1VFYA 1Z2QA 3L1XA 3SHBA 2LGVA 2EGPA 2LXHC 2EODA 3ASLA 5FB0A 3SOUA 3U5NA 2Y43A 3HTKC 4R8PK 5AIUA 2Y1NA 4A4BA 4WZ3B 4GNFA 3SOWA 2K1JA 5LCWB 3I2DA 5B77A 5AITA 1U6GB 3U5MA 1LDKC 2YW8A 3RPGC 5JG6A 1WESA 1Z60A 5G05B 5LKUA 3EB6A 4UI9B 4V3LC 2JMDA 1JM7A 2M6MA 5TDWA 2QIZA 2YT5A 2DX8A 2XB1A 2C2VS 4YBSA 2MA5A 2KWNA 5B75A 2UZGA 3NG2A 4B7YC 4TKPB 2E6RA 2L0BA 4YBMA 2HDPA 2KIZA 2L80A 1FBVA 2KWJA 2JMJA 4BBQA 1WEMA 2Y1MA 4C9ZA 2CKLB 2QICA 2K4DA 2YYRA 4AP4A 3O36A 1VD4A 2RI7A 3N9MA 3O37A 5KH7A 2VPGA 3T6RA 3MHSA 2VJEA 2KE1A 4AUQB 3EB5A 3ZVZB 1WEEA 3LQJA 1WEWA 5B79A 2LN0A 2MT5A 1WEQA 3VK6A 5B76A 1WEPA 4FK5A 4A0CD 4YABA 4X3GA 2QJ0A 2VJEB 4YADA 2KWKA 2YSMA 1CHCA 5TRBA 4F52B 2KGGA 3GL6A 2M85A 2CT2A 4P5OB 2JRJA 4PPEA 3RTRB 3C6WA 4WA6A 2AN6A 5I3LA 5C13A 1Z6UA 3KV5A 2LQ6A 2K16A 3O70A 4MSXA 2G6QA 5G0FA 2NAAA 5KH3A 3PURA 2LV9A 1F62A 3O33A 4FO9A 5B8DA 2ECGA 5FEYA 4FJCA 4V3KC 2LGKA 2MD8C 3PHDA 2I50A 2KFTA 4UP0A 1T1HA 2LGGA 1WEVA 4QF2A 3ZNIA 3M99A 3M62A 2FSAA 2JMIA 1IYMA 2MUMA 2KREA 5DINA 4I7CA 4S3OC 2YQLA 3QZVA 2VJFA 2L43A 3MHHA 3L11A 5D1KB 4I7BA 1E4UA 3ZPVE 3N9QA 5D1LB 2F6NA 5G04B 1WEOA 2OXQC 5DKAA 2L5UA 3U5PA 4LKAA 4N4FA 1WENA 2YUCA 1FP0A 2ECJA 3FL2A 3LQIA 3HCTA 2KGIA 5D1MB 2G45A 4ZUXU 5H9MA 3PUQA 3N9LA 2YURA 1MM2A 1MM3A 2KYUA 4LADB 5TDRA 3KV6A 2IDAA 3HCUA 2LGLA 5LKTA 1XWHA 4AYCA 1LDJB 3N9NA 4LJNA 1ZBDB 4ZDTA 2XEUA 2EA6A 4QF3A 5H1UA 3O35A 1JOCA 3M63A 2FUUA 3N9PA 2RSDA 3LRQA 4NN2A 2YSJA 4MVTA 1JM7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TBN A;  4W4U A;  3RPG B;  2F6J A;  2PNX A;  2VPE A;  1BOR A;  4XI1 A;  1VYX A;  5LKZ A;  2C2L A;  2VPB A;  1X4J A;  4R2Y A;  2VJF B;  2YHN A;  1WIL A;  1WE9 A;  4ZQL A;  2MD7 B;  3ZYQ A;  2ECT A;  2KWO A;  1WGM A;  5B78 A;  2G43 A;  3ZTG A;  1HYI A;  2VPD A;  4YC9 A;  3KNV A;  3N9O A;  2PUY A;  3O7A A;  3T7L A;  4N3W A;  3DQV R;  1RMD A;  4LLB A;  2ECN A;  4IC3 A;  3O34 A;  2LXP C;  5KH9 A;  4YAX A;  4A4C A;  4L7X A;  4GB0 A;  3L1Z B;  2ECW A;  4GNE A;  4GNG A;  1X4I A;  1HYJ A;  3IHP A;  3KQI A;  1N87 A;  2YHO A;  3V43 A;  2CSY A;  2LDR A;  4WZ0 A;  2HYE D;  2ZET C;  4CCG X;  2VNF A;  4GND A;  5H1T A;  5J3X A;  4YAT A;  2F42 A;  5LKX A;  2M3H A;  2L75 A;  3LQH A;  4FIP A;  3GV4 A;  4IC2 A;  2FUI A;  3C5K A;  4AVX A;  2E6S A;  4BHW A;  4LK9 A;  2KR4 A;  3SOX A;  2ECI A;  3U5O A;  1K2F A;  1WFK A;  5C11 A;  1WIM A;  3DPL R;  4L58 A;  2YRE A;  2CSZ A;  4B86 C;  4A49 A;  2K17 A;  2H0D B;  4CA1 A;  3HCS A;  5H1V A;  2MNY A;  2VP7 A;  2ECV A;  2H0D A;  4Q6F A;  5FB1 A;  4O64 A;  4S3O B;  1DVP A;  2LRI C;  2MA6 A;  4WZ2 A;  5EYA F;  2MIQ A;  4AYC B;  4PTB A;  3ZVY A;  2YU4 A;  5TAB A;  1X4U A;  2BAY A;  2M1R A;  2D8S A;  4I7D A;  2CKL A;  4R7E A;  5FER A;  1WEU A;  2MNZ A;  3ZPV 1;  1V87 A;  4UP5 A;  2KU3 A;  2YQM A;  4YBT A;  1G25 A;  1VFY A;  1Z2Q A;  3L1X A;  3SHB A;  2LGV A;  2EGP A;  2LXH C;  2EOD A;  3ASL A;  5FB0 A;  3SOU A;  3U5N A;  2Y43 A;  3HTK C;  4R8P K;  5AIU A;  2Y1N A;  4A4B A;  4WZ3 B;  4GNF A;  3SOW A;  2K1J A;  5LCW B;  3I2D A;  5B77 A;  5AIT A;  1U6G B;  3U5M A;  1LDK C;  2YW8 A;  3RPG C;  5JG6 A;  1WES A;  1Z60 A;  5G05 B;  5LKU A;  3EB6 A;  4UI9 B;  4V3L C;  2JMD A;  1JM7 A;  2M6M A;  5TDW A;  2QIZ A;  2YT5 A;  2DX8 A;  2XB1 A;  2C2V S;  4YBS A;  2MA5 A;  2KWN A;  5B75 A;  2UZG A;  3NG2 A;  4B7Y C;  4TKP B;  2E6R A;  2L0B A;  4YBM A;  2HDP A;  2KIZ A;  2L80 A;  1FBV A;  2KWJ A;  2JMJ A;  4BBQ A;  1WEM A;  2Y1M A;  4C9Z A;  2CKL B;  2QIC A;  2K4D A;  2YYR A;  4AP4 A;  3O36 A;  1VD4 A;  2RI7 A;  3N9M A;  3O37 A;  5KH7 A;  2VPG A;  3T6R A;  3MHS A;  2VJE A;  2KE1 A;  4AUQ B;  3EB5 A;  3ZVZ B;  1WEE A;  3LQJ A;  1WEW A;  5B79 A;  2LN0 A;  2MT5 A;  1WEQ A;  3VK6 A;  5B76 A;  1WEP A;  4FK5 A;  4A0C D;  4YAB A;  4X3G A;  2QJ0 A;  2VJE B;  4YAD A;  2KWK A;  2YSM A;  1CHC A;  5TRB A;  4F52 B;  2KGG A;  3GL6 A;  2M85 A;  2CT2 A;  4P5O B;  2JRJ A;  4PPE A;  3RTR B;  3C6W A;  4WA6 A;  2AN6 A;  5I3L A;  5C13 A;  1Z6U A;  3KV5 A;  2LQ6 A;  2K16 A;  3O70 A;  4MSX A;  2G6Q A;  5G0F A;  2NAA A;  5KH3 A;  3PUR A;  2LV9 A;  1F62 A;  3O33 A;  4FO9 A;  5B8D A;  2ECG A;  5FEY A;  4FJC A;  4V3K C;  2LGK A;  2MD8 C;  3PHD A;  2I50 A;  2KFT A;  4UP0 A;  1T1H A;  2LGG A;  1WEV A;  4QF2 A;  3ZNI A;  3M99 A;  3M62 A;  2FSA A;  2JMI A;  1IYM A;  2MUM A;  2KRE A;  5DIN A;  4I7C A;  4S3O C;  2YQL A;  3QZV A;  2VJF A;  2L43 A;  3MHH A;  3L11 A;  5D1K B;  4I7B A;  1E4U A;  3ZPV E;  3N9Q A;  5D1L B;  2F6N A;  5G04 B;  1WEO A;  2OXQ C;  5DKA A;  2L5U A;  3U5P A;  4LKA A;  4N4F A;  1WEN A;  2YUC A;  1FP0 A;  2ECJ A;  3FL2 A;  3LQI A;  3HCT A;  2KGI A;  5D1M B;  2G45 A;  4ZUX U;  5H9M A;  3PUQ A;  3N9L A;  2YUR A;  1MM2 A;  1MM3 A;  2KYU A;  4LAD B;  5TDR A;  3KV6 A;  2IDA A;  3HCU A;  2LGL A;  5LKT A;  1XWH A;  4AYC A;  1LDJ B;  3N9N A;  4LJN A;  1ZBD B;  4ZDT A;  2XEU A;  2EA6 A;  4QF3 A;  5H1U A;  3O35 A;  1JOC A;  3M63 A;  2FUU A;  3N9P A;  2RSD A;  3LRQ A;  4NN2 A;  2YSJ A;  4MVT A;  1JM7 B; 
#chains in the Genus database with same CATH topology
 5TBN A;  4W4U A;  3RPG B;  2F6J A;  2PNX A;  2VPE A;  1BOR A;  4XI1 A;  1VYX A;  5LKZ A;  2C2L A;  2VPB A;  3DWD A;  1X4J A;  4R2Y A;  2XOC A;  3LVR E;  3M7K A;  2VJF B;  2YHN A;  1WIL A;  2FD4 A;  3Q1D A;  1WE9 A;  4ZQL A;  2MD7 B;  3ZYQ A;  2FFW A;  2ECT A;  2KWO A;  1WGM A;  3FJU B;  5B78 A;  2G43 A;  3ZTG A;  4QQ4 A;  1HYI A;  2VPD A;  4YC9 A;  3KNV A;  3N9O A;  2PUY A;  3O7A A;  3T7L A;  4N3W A;  3DQV R;  1RMD A;  4LLB A;  2ECN A;  4IC3 A;  3O34 A;  2LXP C;  5KH9 A;  4YAX A;  3LJU X;  4L7X A;  4A4C A;  4GB0 A;  2LAU A;  3L1Z B;  2ECW A;  3H7H A;  4GNG A;  4GNE A;  1X4I A;  1HYJ A;  2JUN A;  3IHP A;  3KQI A;  2JM3 A;  1N87 A;  2YHO A;  3FAO A;  3V43 A;  2CSY A;  2LDR A;  2P57 A;  2OWA A;  4WZ0 A;  2HYE D;  2ZET C;  4CCG X;  2VNF A;  4GND A;  2YVR A;  5H1T A;  5J3X A;  4YAT A;  2F42 A;  5LKX A;  2M3H A;  2L75 A;  3LQH A;  4FIP A;  3GV4 A;  4IC2 A;  2FUI A;  3C5K A;  4AVX A;  2E6S A;  4BHW A;  4LK9 A;  2KR4 A;  3SOX A;  2ECI A;  3U5O A;  2E61 A;  1K2F A;  1WFK A;  5C11 A;  1WIM A;  3DPL R;  4L58 A;  2YRE A;  2CSZ A;  4B86 C;  2DJA A;  4A49 A;  2K17 A;  2H0D B;  4CA1 A;  3HCS A;  2L7P A;  5H1V A;  4F1P A;  2MNY A;  2VP7 A;  3LVQ E;  2ECV A;  3JUE A;  2H0D A;  4Q6F A;  5FB1 A;  4O64 A;  4S3O B;  1DVP A;  2LRI C;  2MA6 A;  4WZ2 A;  5EYA F;  2MIQ A;  4AYC B;  4PTB A;  3ZVY A;  2YU4 A;  5TAB A;  1X4U A;  4O62 A;  2D8U A;  2BAY A;  2M1R A;  2D8S A;  4Z0O A;  4I7D A;  2CKL A;  4R7E A;  5FER A;  1WEU A;  2MNZ A;  3ZPV 1;  1V87 A;  4UP5 A;  2KU3 A;  2YQM A;  4YBT A;  1G25 A;  1VFY A;  1Z2Q A;  3L1X A;  3SHB A;  2M13 A;  2LGV A;  2EGP A;  2LXH C;  2EOD A;  3ASL A;  3SUB A;  5FB0 A;  3SOU A;  3U5N A;  2Y43 A;  3HTK C;  4R8P K;  5AIU A;  2Y1N A;  4A4B A;  4WZ3 B;  4GNF A;  3SOW A;  2K1J A;  5LCW B;  3I2D A;  5B77 A;  5SVI B;  5AIT A;  1U6G B;  3U5M A;  2EXU A;  1LDK C;  2YW8 A;  3RPG C;  5JG6 A;  1WES A;  1Z60 A;  5G05 B;  5LKU A;  3EB6 A;  4UI9 B;  4V3L C;  2JMD A;  1JM7 A;  2M6M A;  2XOZ A;  5TDW A;  2QIZ A;  2YT5 A;  2DX8 A;  2XB1 A;  2C2V S;  4YBS A;  2MA5 A;  2KWN A;  5B75 A;  2UZG A;  3NG2 A;  4B7Y C;  3KDE C;  4TKP B;  2E6R A;  2L0B A;  4YBM A;  2HDP A;  2CRW A;  2KIZ A;  2L80 A;  1FBV A;  2KWJ A;  2JMJ A;  4BBQ A;  1WEM A;  2Y1M A;  4C9Z A;  2CKL B;  2QIC A;  2K4D A;  2YYR A;  4AP4 A;  3O36 A;  1VD4 A;  2RI7 A;  3N9M A;  3O37 A;  3E2D A;  2KKX A;  5KH7 A;  2VPG A;  3T6R A;  3MDB C;  3MHS A;  2VJE A;  2KE1 A;  4AUQ B;  3EB5 A;  3ZVZ B;  1WEE A;  3LQJ A;  1WEW A;  5B79 A;  2LN0 A;  2MT5 A;  1WEQ A;  3VK6 A;  5B76 A;  1WEP A;  4FK5 A;  4A0C D;  4YAB A;  4X3G A;  2QJ0 A;  2VJE B;  4YAD A;  2KWK A;  2YSM A;  1CHC A;  5TRB A;  3FAN A;  4F52 B;  2KGG A;  3GL6 A;  2XP0 A;  2M85 A;  2CT2 A;  4P5O B;  3T9K A;  2JRJ A;  4PPE A;  3RTR B;  3C6W A;  3DDT A;  4WA6 A;  2AN6 A;  5I3L A;  5C13 A;  1Z6U A;  3KV5 A;  2LQ6 A;  2K16 A;  3O70 A;  4MSX A;  2G6Q A;  2KKY A;  5G0F A;  2NAA A;  4OGE A;  5KH3 A;  3PUR A;  2LV9 A;  1F62 A;  3O33 A;  4FO9 A;  3LDY A;  5B8D A;  2ECG A;  5FEY A;  4FJC A;  4V3K C;  5K3Q A;  3FEH A;  2LGK A;  2MD8 C;  2MKE A;  2I50 A;  3PHD A;  2KFT A;  4UP0 A;  4H9D A;  1T1H A;  2LGG A;  1WEV A;  4QF2 A;  3ZNI A;  3M99 A;  3M62 A;  2FSA A;  2JMI A;  1IYM A;  2MUM A;  2KRE A;  5DIN A;  4I7C A;  4S3O C;  2YQL A;  3QZV A;  2CSV A;  2VJF A;  2L43 A;  3MHH A;  3L11 A;  5D1K B;  3FM8 C;  4I7B A;  1E4U A;  3ZPV E;  3N9Q A;  2CON A;  5D1L B;  2EGM A;  2F6N A;  4OGC A;  2RR4 A;  5G04 B;  1WEO A;  2OXQ C;  5SVY A;  5DKA A;  2L5U A;  3U5P A;  4LKA A;  4N4F A;  1WEN A;  2YUC A;  1FP0 A;  2XOY A;  2ECJ A;  3FL2 A;  4Z0R A;  3LQI A;  5SVI A;  1MBM A;  3HCT A;  2KGI A;  5D1M B;  2G45 A;  4ZUX U;  5H9M A;  2IQJ A;  3PUQ A;  3N9L A;  2YUR A;  1MM2 A;  1MM3 A;  2KYU A;  4LAD B;  5TDR A;  3KV6 A;  2IDA A;  3HCU A;  5SVX A;  2B0O E;  2LGL A;  5LKT A;  1XWH A;  4AYC A;  1LDJ B;  3N9N A;  2CRR A;  1ZBD B;  4LJN A;  4ZDT A;  2XEU A;  2EA6 A;  3O47 A;  3PLW A;  4QF3 A;  5H1U A;  3O35 A;  1DCQ A;  1JOC A;  3M63 A;  2FUU A;  3N9P A;  2RSD A;  2DSM A;  3LRQ A;  4NN2 A;  2YSJ A;  4MVT A;  1JM7 B; 
#chains in the Genus database with same CATH homology
 5TBN A;  4W4U A;  3RPG B;  2F6J A;  2PNX A;  2VPE A;  1BOR A;  4XI1 A;  1VYX A;  5LKZ A;  2C2L A;  2VPB A;  1X4J A;  4R2Y A;  2VJF B;  2YHN A;  1WIL A;  1WE9 A;  4ZQL A;  2MD7 B;  3ZYQ A;  2ECT A;  2KWO A;  1WGM A;  5B78 A;  2G43 A;  3ZTG A;  1HYI A;  2VPD A;  4YC9 A;  3KNV A;  3N9O A;  2PUY A;  3O7A A;  3T7L A;  4N3W A;  3DQV R;  1RMD A;  4LLB A;  2ECN A;  4IC3 A;  3O34 A;  2LXP C;  5KH9 A;  4YAX A;  4A4C A;  4L7X A;  4GB0 A;  3L1Z B;  2ECW A;  4GNE A;  4GNG A;  1X4I A;  1HYJ A;  3IHP A;  3KQI A;  1N87 A;  2YHO A;  3V43 A;  2CSY A;  2LDR A;  4WZ0 A;  2HYE D;  2ZET C;  4CCG X;  2VNF A;  4GND A;  5H1T A;  5J3X A;  4YAT A;  2F42 A;  5LKX A;  2M3H A;  2L75 A;  3LQH A;  4FIP A;  3GV4 A;  4IC2 A;  2FUI A;  3C5K A;  4AVX A;  2E6S A;  4BHW A;  4LK9 A;  2KR4 A;  3SOX A;  2ECI A;  3U5O A;  1K2F A;  1WFK A;  5C11 A;  1WIM A;  3DPL R;  4L58 A;  2YRE A;  2CSZ A;  4B86 C;  4A49 A;  2K17 A;  2H0D B;  4CA1 A;  3HCS A;  5H1V A;  2MNY A;  2VP7 A;  2ECV A;  2H0D A;  4Q6F A;  5FB1 A;  4O64 A;  4S3O B;  1DVP A;  2LRI C;  2MA6 A;  4WZ2 A;  5EYA F;  2MIQ A;  4AYC B;  4PTB A;  3ZVY A;  2YU4 A;  5TAB A;  1X4U A;  2BAY A;  2M1R A;  2D8S A;  4I7D A;  2CKL A;  4R7E A;  5FER A;  1WEU A;  2MNZ A;  3ZPV 1;  1V87 A;  4UP5 A;  2KU3 A;  2YQM A;  4YBT A;  1G25 A;  1VFY A;  1Z2Q A;  3L1X A;  3SHB A;  2LGV A;  2EGP A;  2LXH C;  2EOD A;  3ASL A;  5FB0 A;  3SOU A;  3U5N A;  2Y43 A;  3HTK C;  4R8P K;  5AIU A;  2Y1N A;  4A4B A;  4WZ3 B;  4GNF A;  3SOW A;  2K1J A;  5LCW B;  3I2D A;  5B77 A;  5AIT A;  1U6G B;  3U5M A;  1LDK C;  2YW8 A;  3RPG C;  5JG6 A;  1WES A;  1Z60 A;  5G05 B;  5LKU A;  3EB6 A;  4UI9 B;  4V3L C;  2JMD A;  1JM7 A;  2M6M A;  5TDW A;  2QIZ A;  2YT5 A;  2DX8 A;  2XB1 A;  2C2V S;  4YBS A;  2MA5 A;  2KWN A;  5B75 A;  2UZG A;  3NG2 A;  4B7Y C;  4TKP B;  2E6R A;  2L0B A;  4YBM A;  2HDP A;  2KIZ A;  2L80 A;  1FBV A;  2KWJ A;  2JMJ A;  4BBQ A;  1WEM A;  2Y1M A;  4C9Z A;  2CKL B;  2QIC A;  2K4D A;  2YYR A;  4AP4 A;  3O36 A;  1VD4 A;  2RI7 A;  3N9M A;  3O37 A;  5KH7 A;  2VPG A;  3T6R A;  3MHS A;  2VJE A;  2KE1 A;  4AUQ B;  3EB5 A;  3ZVZ B;  1WEE A;  3LQJ A;  1WEW A;  5B79 A;  2LN0 A;  2MT5 A;  1WEQ A;  3VK6 A;  5B76 A;  1WEP A;  4FK5 A;  4A0C D;  4YAB A;  4X3G A;  2QJ0 A;  2VJE B;  4YAD A;  2KWK A;  2YSM A;  1CHC A;  5TRB A;  4F52 B;  2KGG A;  3GL6 A;  2M85 A;  2CT2 A;  4P5O B;  2JRJ A;  4PPE A;  3RTR B;  3C6W A;  4WA6 A;  2AN6 A;  5I3L A;  5C13 A;  1Z6U A;  3KV5 A;  2LQ6 A;  2K16 A;  3O70 A;  4MSX A;  2G6Q A;  5G0F A;  2NAA A;  5KH3 A;  3PUR A;  2LV9 A;  1F62 A;  3O33 A;  4FO9 A;  5B8D A;  2ECG A;  5FEY A;  4FJC A;  4V3K C;  2LGK A;  2MD8 C;  3PHD A;  2I50 A;  2KFT A;  4UP0 A;  1T1H A;  2LGG A;  1WEV A;  4QF2 A;  3ZNI A;  3M99 A;  3M62 A;  2FSA A;  2JMI A;  1IYM A;  2MUM A;  2KRE A;  5DIN A;  4I7C A;  4S3O C;  2YQL A;  3QZV A;  2VJF A;  2L43 A;  3MHH A;  3L11 A;  5D1K B;  4I7B A;  1E4U A;  3ZPV E;  3N9Q A;  5D1L B;  2F6N A;  5G04 B;  1WEO A;  2OXQ C;  5DKA A;  2L5U A;  3U5P A;  4LKA A;  4N4F A;  1WEN A;  2YUC A;  1FP0 A;  2ECJ A;  3FL2 A;  3LQI A;  3HCT A;  2KGI A;  5D1M B;  2G45 A;  4ZUX U;  5H9M A;  3PUQ A;  3N9L A;  2YUR A;  1MM2 A;  1MM3 A;  2KYU A;  4LAD B;  5TDR A;  3KV6 A;  2IDA A;  3HCU A;  2LGL A;  5LKT A;  1XWH A;  4AYC A;  1LDJ B;  3N9N A;  4LJN A;  1ZBD B;  4ZDT A;  2XEU A;  2EA6 A;  4QF3 A;  5H1U A;  3O35 A;  1JOC A;  3M63 A;  2FUU A;  3N9P A;  2RSD A;  3LRQ A;  4NN2 A;  2YSJ A;  4MVT A;  1JM7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...