4Z0RA

Crystal structure of the cw domain of zcwpw2 mutant f78r in complex with histone h3 peptide
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
57
structure length
57
Chain Sequence
ENMYVNKVWVQCENENCLKWRLLSSEDSAKVDHDEPWYCFMNTDSRYNNCSISEEDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger CW-type PWWP domain protein 2
publication title Crystal Structure of the CW domain of ZCWPW2 mutant F78R in complex with histone H3 peptide
rcsb
source organism Homo sapiens
molecule tags Protein binding/structural protein
total genus 10
structure length 57
sequence length 57
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07496 zf-CW CW-type Zinc Finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.100 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 4z0rA00
5SVIA 2L7PA 4O62A 5SVYA 5SVXA 4Z0RA 2E61A 4QQ4A 2RR4A 4Z0OA 5SVIB
chains in the Genus database with same CATH superfamily
2L75A 2OXQC 2VP7A 2L43A 3LQIA 2YREA 4CCGX 3Q1DA 2YW8A 3U5OA 5TDWA 4N3WA 4QF2A 5H1UA 2MNYA 3SOUA 1WEQA 3FL2A 4LJNA 4AYCA 1V87A 4MVTA 5JG6A 2YUCA 4QQ4A 2H0DA 5D1KB 2VPEA 2KYUA 3GV4A 2Y1MA 1WEVA 3FANA 1WESA 5AIUA 3DWDA 2XP0A 1VYXA 5J3XA 2K17A 2XOZA 2CSYA 2CONA 1LDKC 2M3HA 2KWNA 4BBQA 2RR4A 2KR4A 2MA5A 4R2YA 2YQLA 2VJEB 2LGGA 1WEMA 2F6NA 1WFKA 5H1VA 4UP5A 4GNGA 1X4IA 2KKXA 4AVXA 3FJUB 1WGMA 2YT5A 2ECGA 2K1JA 2M1RA 2FFWA 3O7AA 3LVQE 2B0OE 5H9MA 3O37A 3U5MA 2YURA 2RSDA 4AUQB 2YSMA 3ZPV1 4Z0OA 3KV6A 4P5OB 2DX8A 1IYMA 3MHSA 3ZTGA 1U6GB 4PTBA 2CSVA 5B79A 4AP4A 1FP0A 3N9PA 4FIPA 2VJFB 2ECVA 3KQIA 4I7DA 3ZPVE 5TDRA 4X3GA 3E2DA 2UZGA 4BHWA 4LADB 2MUMA 2VNFA 5SVIB 5TBNA 2KWKA 4O62A 2ECWA 2E61A 4A4BA 2OWAA 2NAAA 2JUNA 5TABA 1G25A 3N9QA 5FB1A 1FBVA 2DSMA 3LJUX 3SHBA 4R7EA 3C5KA 3L11A 3DDTA 4NN2A 2LGKA 2Y1NA 4GNEA 5FERA 2DJAA 1K2FA 1WEUA 2KREA 2G43A 4O64A 2HYED 1Z60A 1WENA 3O36A 4YBTA 2ECNA 1N87A 3O47A 4C9ZA 5SVYA 4WZ0A 2MKEA 2M6MA 2Y43A 4YABA 1HYIA 3O35A 3PURA 4PPEA 2EA6A 2HDPA 2JMJA 2XEUA 5LKZA 3LQJA 3MDBC 3U5PA 4R8PK 5DINA 3T6RA 2LXHC 1X4UA 4YBMA 3FEHA 3LQHA 4OGCA 4Q6FA 3C6WA 4CA1A 1E4UA 5LKUA 1WEPA 5KH3A 5B78A 4ZUXU 2CRWA 1VFYA 1MM3A 4A4CA 3O34A 3ZVZB 5B76A 2I50A 4ZDTA 2AN6A 2L7PA 2KWJA 3GL6A 4UP0A 2P57A 4FO9A 2LGLA 5I3LA 3HCUA 3V43A 2XB1A 4LK9A 3IHPA 1X4JA 2C2LA 2E6RA 2MNZA 1WEWA 4L58A 1F62A 3M7KA 2PUYA 2QICA 1Z2QA 2CKLB 4GNFA 4AYCB 2YU4A 3DQVR 5SVIA 5LKTA 2LAUA 4UI9B 2H0DB 2LQ6A 3U5NA 5AITA 2JMDA 4I7BA 1MM2A 1ZBDB 2PNXA 4IC2A 2KU3A 2D8SA 4F1PA 5B8DA 3LRQA 2LGVA 3M62A 5H1TA 3MHHA 2ZETC 2D8UA 2M85A 2L5UA 4YATA 1RMDA 2MA6A 5K3QA 2FUUA 1MBMA 4MSXA 3EB6A 2EODA 2L0BA 2LV9A 2MD7B 3T9KA 3NG2A 3SOXA 3QZVA 3KDEC 5C11A 2QJ0A 2ECIA 4IC3A 2RI7A 2MIQA 4V3KC 3ZYQA 2ECTA 2KWOA 4YAXA 2K4DA 3N9LA 3N9MA 2G6QA 3LDYA 4WA6A 3RPGC 3VK6A 3ZNIA 3T7LA 2YYRA 2YVRA 1T1HA 2ECJA 4TKPB 2JM3A 4S3OC 1JOCA 2YSJA 5G05B 3L1XA 2KIZA 1DCQA 1JM7B 3HTKC 2VJEA 2M13A 3N9NA 2BAYA 5EYAF 1WEEA 3HCTA 3RTRB 2JMIA 3ASLA 4QF3A 2XOYA 4GB0A 4XI1A 3PHDA 5LKXA 4H9DA 3N9OA 1BORA 4L7XA 3HCSA 2KFTA 2VPGA 3JUEA 3PUQA 5B75A 4WZ3B 5D1LB 4FK5A 2CKLA 1VD4A 4A49A 1DVPA 3M99A 4WZ2A 2K16A 2CRRA 2LRIC 2JRJA 3H7HA 4YC9A 1WIMA 2LN0A 2EGMA 2FD4A 2LXPC 4Z0RA 4YADA 4F52B 1XWHA 1HYJA 2E6SA 2CT2A 4W4UA 5SVXA 2VJFA 2G45A 2EXUA 3KNVA 1WILA 3M63A 2C2VS 4B7YC 4LLBA 2MD8C 1WE9A 3SUBA 3FAOA 3O33A 4LKAA 4N4FA 5FB0A 2YHOA 5G04B 2MT5A 2VPBA 5FEYA 5C13A 5D1MB 4V3LC 2YHNA 2CSZA 2FSAA 2QIZA 3DPLR 3KV5A 3PLWA 2KGGA 1LDJB 3L1ZB 3RPGB 5LCWB 2IQJA 3ZVYA 2LDRA 1WEOA 5DKAA 3SOWA 3I2DA 4S3OB 4GNDA 5TRBA 3EB5A 2VPDA 2KE1A 4I7CA 1Z6UA 4FJCA 4B86C 2F42A 5KH7A 1JM7A 4A0CD 4ZQLA 2FUIA 5B77A 2EGPA 2KKYA 4OGEA 2F6JA 2IDAA 2L80A 3FM8C 2YQMA 4YBSA 5G0FA 3O70A 1CHCA 2XOCA 3LVRE 2KGIA 5KH9A
chains in the Genus database with same CATH topology
3MDBC 5SVIA 5K3QA 3PLWA 2L7PA 2LAUA 4O62A 1DCQA 2DJAA 2CRRA 2E61A 4QQ4A 3H7HA 4Z0OA 3SUBA 2P57A 3LDYA 2OWAA 2EGMA 2FD4A 2IQJA 2JUNA 2CSVA 2M13A 2YVRA 3FEHA 4OGCA 2YREA 4Z0RA 3Q1DA 3DWDA 2XP0A 2XOYA 2KKYA 3O47A 4OGEA 2KKXA 5SVXA 3T9KA 2XOZA 2CRWA 3FJUB 4H9DA 3FM8C 5SVYA 4F1PA 2EXUA 3KDEC 3LJUX 2CONA 2MKEA 3M7KA 2JM3A 3E2DA 2FFWA 2D8UA 2XOCA 3DDTA 3JUEA 3LVRE 3LVQE 2RR4A 2B0OE 5SVIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5SVI A;  2L7P A;  4O62 A;  5SVY A;  5SVX A;  4Z0R A;  2E61 A;  4QQ4 A;  2RR4 A;  4Z0O A;  5SVI B; 
#chains in the Genus database with same CATH topology
 2L75 A;  2OXQ C;  2VP7 A;  2L43 A;  3LQI A;  2YRE A;  4CCG X;  3Q1D A;  2YW8 A;  3U5O A;  5TDW A;  4N3W A;  4QF2 A;  5H1U A;  2MNY A;  3SOU A;  1WEQ A;  3FL2 A;  4LJN A;  4AYC A;  1V87 A;  4MVT A;  5JG6 A;  2YUC A;  4QQ4 A;  2H0D A;  5D1K B;  2VPE A;  2KYU A;  3GV4 A;  2Y1M A;  1WEV A;  3FAN A;  1WES A;  5AIU A;  3DWD A;  2XP0 A;  1VYX A;  5J3X A;  2K17 A;  2XOZ A;  2CSY A;  2CON A;  1LDK C;  2M3H A;  2KWN A;  4BBQ A;  2RR4 A;  2KR4 A;  2MA5 A;  4R2Y A;  2YQL A;  2VJE B;  2LGG A;  1WEM A;  2F6N A;  1WFK A;  5H1V A;  4UP5 A;  4GNG A;  1X4I A;  2KKX A;  4AVX A;  3FJU B;  1WGM A;  2YT5 A;  2ECG A;  2K1J A;  2M1R A;  2FFW A;  3O7A A;  3LVQ E;  2B0O E;  5H9M A;  3O37 A;  3U5M A;  2YUR A;  2RSD A;  4AUQ B;  2YSM A;  3ZPV 1;  4Z0O A;  3KV6 A;  4P5O B;  2DX8 A;  1IYM A;  3MHS A;  3ZTG A;  1U6G B;  4PTB A;  2CSV A;  5B79 A;  4AP4 A;  1FP0 A;  3N9P A;  4FIP A;  2VJF B;  2ECV A;  3KQI A;  4I7D A;  3ZPV E;  5TDR A;  4X3G A;  3E2D A;  2UZG A;  4BHW A;  4LAD B;  2MUM A;  2VNF A;  5SVI B;  5TBN A;  2KWK A;  4O62 A;  2ECW A;  2E61 A;  4A4B A;  2OWA A;  2NAA A;  2JUN A;  5TAB A;  1G25 A;  3N9Q A;  5FB1 A;  1FBV A;  2DSM A;  3LJU X;  3SHB A;  4R7E A;  3C5K A;  3L11 A;  3DDT A;  4NN2 A;  2LGK A;  2Y1N A;  4GNE A;  5FER A;  2DJA A;  1K2F A;  1WEU A;  2KRE A;  2G43 A;  4O64 A;  2HYE D;  1Z60 A;  1WEN A;  3O36 A;  4YBT A;  2ECN A;  1N87 A;  3O47 A;  4C9Z A;  5SVY A;  4WZ0 A;  2MKE A;  2M6M A;  2Y43 A;  4YAB A;  1HYI A;  3O35 A;  3PUR A;  4PPE A;  2EA6 A;  2HDP A;  2JMJ A;  2XEU A;  5LKZ A;  3LQJ A;  3MDB C;  3U5P A;  4R8P K;  5DIN A;  3T6R A;  2LXH C;  1X4U A;  4YBM A;  3FEH A;  3LQH A;  4OGC A;  4Q6F A;  3C6W A;  4CA1 A;  1E4U A;  5LKU A;  1WEP A;  5KH3 A;  5B78 A;  4ZUX U;  2CRW A;  1VFY A;  1MM3 A;  4A4C A;  3O34 A;  3ZVZ B;  5B76 A;  2I50 A;  4ZDT A;  2AN6 A;  2L7P A;  2KWJ A;  3GL6 A;  4UP0 A;  2P57 A;  4FO9 A;  2LGL A;  5I3L A;  3HCU A;  3V43 A;  2XB1 A;  4LK9 A;  3IHP A;  1X4J A;  2C2L A;  2E6R A;  2MNZ A;  1WEW A;  4L58 A;  1F62 A;  3M7K A;  2PUY A;  2QIC A;  1Z2Q A;  2CKL B;  4GNF A;  4AYC B;  2YU4 A;  3DQV R;  5SVI A;  5LKT A;  2LAU A;  4UI9 B;  2H0D B;  2LQ6 A;  3U5N A;  5AIT A;  2JMD A;  4I7B A;  1MM2 A;  1ZBD B;  2PNX A;  4IC2 A;  2KU3 A;  2D8S A;  4F1P A;  5B8D A;  3LRQ A;  2LGV A;  3M62 A;  5H1T A;  3MHH A;  2ZET C;  2D8U A;  2M85 A;  2L5U A;  4YAT A;  1RMD A;  2MA6 A;  5K3Q A;  2FUU A;  1MBM A;  4MSX A;  3EB6 A;  2EOD A;  2L0B A;  2LV9 A;  2MD7 B;  3T9K A;  3NG2 A;  3SOX A;  3QZV A;  3KDE C;  5C11 A;  2QJ0 A;  2ECI A;  4IC3 A;  2RI7 A;  2MIQ A;  4V3K C;  3ZYQ A;  2ECT A;  2KWO A;  4YAX A;  2K4D A;  3N9L A;  3N9M A;  2G6Q A;  3LDY A;  4WA6 A;  3RPG C;  3VK6 A;  3ZNI A;  3T7L A;  2YYR A;  2YVR A;  1T1H A;  2ECJ A;  4TKP B;  2JM3 A;  4S3O C;  1JOC A;  2YSJ A;  5G05 B;  3L1X A;  2KIZ A;  1DCQ A;  1JM7 B;  3HTK C;  2VJE A;  2M13 A;  3N9N A;  2BAY A;  5EYA F;  1WEE A;  3HCT A;  3RTR B;  2JMI A;  3ASL A;  4QF3 A;  2XOY A;  4GB0 A;  4XI1 A;  3PHD A;  5LKX A;  4H9D A;  3N9O A;  1BOR A;  4L7X A;  3HCS A;  2KFT A;  2VPG A;  3JUE A;  3PUQ A;  5B75 A;  4WZ3 B;  5D1L B;  4FK5 A;  2CKL A;  1VD4 A;  4A49 A;  1DVP A;  3M99 A;  4WZ2 A;  2K16 A;  2CRR A;  2LRI C;  2JRJ A;  3H7H A;  4YC9 A;  1WIM A;  2LN0 A;  2EGM A;  2FD4 A;  2LXP C;  4Z0R A;  4YAD A;  4F52 B;  1XWH A;  1HYJ A;  2E6S A;  2CT2 A;  4W4U A;  5SVX A;  2VJF A;  2G45 A;  2EXU A;  3KNV A;  1WIL A;  3M63 A;  2C2V S;  4B7Y C;  4LLB A;  2MD8 C;  1WE9 A;  3SUB A;  3FAO A;  3O33 A;  4LKA A;  4N4F A;  5FB0 A;  2YHO A;  5G04 B;  2MT5 A;  2VPB A;  5FEY A;  5C13 A;  5D1M B;  4V3L C;  2YHN A;  2CSZ A;  2FSA A;  2QIZ A;  3DPL R;  3KV5 A;  3PLW A;  2KGG A;  1LDJ B;  3L1Z B;  3RPG B;  5LCW B;  2IQJ A;  3ZVY A;  2LDR A;  1WEO A;  5DKA A;  3SOW A;  3I2D A;  4S3O B;  4GND A;  5TRB A;  3EB5 A;  2VPD A;  2KE1 A;  4I7C A;  1Z6U A;  4FJC A;  4B86 C;  2F42 A;  5KH7 A;  1JM7 A;  4A0C D;  4ZQL A;  2FUI A;  5B77 A;  2EGP A;  2KKY A;  4OGE A;  2F6J A;  2IDA A;  2L80 A;  3FM8 C;  2YQM A;  4YBS A;  5G0F A;  3O70 A;  1CHC A;  2XOC A;  3LVR E;  2KGI A;  5KH9 A; 
#chains in the Genus database with same CATH homology
 3MDB C;  5SVI A;  5K3Q A;  3PLW A;  2L7P A;  2LAU A;  4O62 A;  1DCQ A;  2DJA A;  2CRR A;  2E61 A;  4QQ4 A;  3H7H A;  4Z0O A;  3SUB A;  2P57 A;  3LDY A;  2OWA A;  2EGM A;  2FD4 A;  2IQJ A;  2JUN A;  2CSV A;  2M13 A;  2YVR A;  3FEH A;  4OGC A;  2YRE A;  4Z0R A;  3Q1D A;  3DWD A;  2XP0 A;  2XOY A;  2KKY A;  3O47 A;  4OGE A;  2KKX A;  5SVX A;  3T9K A;  2XOZ A;  2CRW A;  3FJU B;  4H9D A;  3FM8 C;  5SVY A;  4F1P A;  2EXU A;  3KDE C;  3LJU X;  2CON A;  2MKE A;  3M7K A;  2JM3 A;  3E2D A;  2FFW A;  2D8U A;  2XOC A;  3DDT A;  3JUE A;  3LVR E;  3LVQ E;  2RR4 A;  2B0O E;  5SVI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...