4Z0RA

Crystal structure of the cw domain of zcwpw2 mutant f78r in complex with histone h3 peptide
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
57
structure length
57
Chain Sequence
b'ENMYVNKVWVQCENENCLKWRLLSSEDSAKVDHDEPWYCFMNTDSRYNNCSISEEDR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger CW-type PWWP domain protein 2
publication title Crystal Structure of the CW domain of ZCWPW2 mutant F78R in complex with histone H3 peptide
rcsb
source organism Homo sapiens
molecule tags Protein binding/structural protein
total genus 10
structure length 57
sequence length 57
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07496 zf-CW CW-type Zinc Finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.100 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 4z0rA00
4Z0RA 4Z0OA 2L7PA 5SVYA 5SVIA 4QQ4A 4O62A 2E61A 2RR4A 5SVXA 5SVIB
chains in the Genus database with same CATH superfamily
2YREA 3JUEA 5LCWB 2L0BA 4N3WA 1WFKA 2FFWA 2KWNA 4AUQB 5I3LA 1WEOA 5LKXA 1DVPA 3RPGC 4MVTA 4YATA 4H9DA 2JMDA 4O62A 3PLWA 2F42A 3U5PA 5KH7A 4X3GA 4C9ZA 3LVRE 3HCTA 4I7BA 3DWDA 5TRBA 3ZTGA 5LKUA 2AN6A 5DINA 2Y1NA 1FP0A 4NN2A 3N9MA 5FEYA 2MKEA 4V3KC 2K16A 2P57A 3M7KA 1K2FA 4GNEA 4WA6A 2L5UA 2CT2A 3SOUA 2YSJA 3KQIA 3FL2A 4BHWA 2IQJA 3T9KA 2KWOA 2XB1A 1X4JA 1VYXA 2CRRA 2D8SA 2KGIA 5G0FA 2MT5A 4WZ3B 2F6JA 1WESA 3ZVZB 5TABA 1MM2A 3H7HA 5AIUA 3O35A 5JG6A 2DX8A 3DDTA 5TDWA 1WE9A 5FERA 1WEEA 3V43A 2JMIA 2XOCA 2LGVA 2RSDA 3EB6A 5DKAA 2LXPC 1WEVA 1JOCA 4ZDTA 4UP5A 3PHDA 4UI9B 5AITA 5B79A 2OWAA 1WILA 1XWHA 4CCGX 3ZYQA 1WENA 2KREA 4FJCA 1IYMA 2FD4A 3T6RA 3DPLR 1CHCA 4Q6FA 4A4BA 1WEUA 2Y1MA 3EB5A 5TBNA 1MM3A 2M13A 1ZBDB 3FM8C 1X4UA 4TKPB 2IDAA 3RPGB 3M63A 4LK9A 2QICA 3FANA 3LQIA 2VJEA 4ZQLA 3FAOA 3GV4A 2YYRA 1FBVA 2KGGA 2XOYA 2M1RA 3N9PA 3MDBC 1WGMA 4O64A 5G04B 1JM7B 4YABA 2YQLA 5G05B 2ECWA 1U6GB 5SVXA 2EGPA 4WZ2A 3LQHA 2KIZA 2CSZA 3I2DA 2VJFA 2YURA 4QF3A 4XI1A 2G45A 3MHSA 3LRQA 2C2LA 3IHPA 3KV6A 2MIQA 2K4DA 4R7EA 5H1UA 4YADA 2YT5A 2ECJA 4GB0A 3QZVA 3L1ZB 2YUCA 2LAUA 2ECVA 2G6QA 2YQMA 2ECNA 2VP7A 2JUNA 1HYIA 3O33A 4AP4A 2VNFA 2EA6A 4S3OB 2YHOA 3VK6A 2KE1A 4R2YA 3U5OA 3LVQE 4FK5A 2KU3A 2KWKA 2QJ0A 1JM7A 2BAYA 2UZGA 4YAXA 5J3XA 4A0CD 5KH3A 1WEWA 3NG2A 3LQJA 2ECTA 2MUMA 3L11A 3N9QA 4YBSA 2VJEB 2ZETC 1WIMA 2XOZA 4B7YC 3GL6A 2H0DA 4UP0A 2FSAA 1LDJB 5FB1A 2KFTA 3HCUA 2K1JA 2RR4A 4OGEA 2L75A 3KDEC 4Z0OA 1VFYA 3LJUX 4AVXA 3ZPV1 2KKYA 2VJFB 2PNXA 4PPEA 4L7XA 4GNDA 3Q1DA 4A49A 1Z6UA 4QQ4A 3E2DA 2CONA 5H1TA 4WZ0A 5KH9A 1X4IA 3RTRB 4LLBA 4GNFA 1BORA 4GNGA 5B78A 5TDRA 2YSMA 2MA5A 2JRJA 2KWJA 4AYCB 3KV5A 2KKXA 2YHNA 2CSVA 3FJUB 3FEHA 5H9MA 2D8UA 2LRIC 4QF2A 2K17A 4V3LC 2EODA 2L43A 2M3HA 3U5NA 1WEPA 4R8PK 3N9OA 2EXUA 3PUQA 2CKLA 2MNZA 3PURA 2ECIA 1LDKC 3L1XA 4LJNA 2LQ6A 2LGGA 2XEUA 4I7CA 5SVYA 2H0DB 2B0OE 5K3QA 1Z2QA 2MD7B 2MD8C 1F62A 3O7AA 1E4UA 2HYED 2RI7A 3ZVYA 3ZPVE 3O70A 2E6RA 4F52B 2YU4A 3M62A 2I50A 4AYCA 3C5KA 2QIZA 2VPBA 3HCSA 3O47A 1RMDA 2DSMA 2LGLA 4F1PA 2Y43A 3SOXA 1Z60A 2XP0A 2EGMA 4I7DA 2VPEA 2CSYA 3DQVR 1DCQA 2YVRA 3T7LA 3O34A 5B75A 4Z0RA 2LDRA 4MSXA 2VPDA 5FB0A 2FUIA 2CRWA 3N9NA 4YBMA 2LGKA 2VPGA 5EYAF 4PTBA 2NAAA 4W4UA 5SVIA 2G43A 4ZUXU 2L7PA 2DJAA 5C11A 3SUBA 2LXHC 4OGCA 3U5MA 4P5OB 4FO9A 2L80A 3O36A 4N4FA 2LN0A 2KYUA 1WEMA 1WEQA 4LKAA 2JM3A 2JMJA 2CKLB 3MHHA 4S3OC 3LDYA 5D1MB 1T1HA 3SOWA 1G25A 4A4CA 2E61A 2PUYA 3ASLA 4IC2A 3N9LA 5H1VA 2C2VS 3ZNIA 1V87A 2YW8A 3KNVA 2F6NA 4YBTA 2LV9A 3HTKC 2M85A 5LKTA 3C6WA 3SHBA 2FUUA 5D1KB 2HDPA 2MA6A 4B86C 5B8DA 5D1LB 4CA1A 1VD4A 4BBQA 2E6SA 2OXQC 3M99A 4IC3A 4YC9A 5B77A 2MNYA 2M6MA 4FIPA 1N87A 1HYJA 1MBMA 4LADB 2ECGA 4L58A 3O37A 2KR4A 5B76A 5LKZA 5SVIB 5C13A
chains in the Genus database with same CATH topology
2YREA 3DWDA 2CSVA 3JUEA 4F1PA 2XOCA 2L7PA 2XP0A 2EGMA 2DJAA 3Q1DA 2XOZA 5SVYA 4QQ4A 2E61A 2IQJA 3E2DA 3SUBA 3FJUB 2XOYA 2CONA 4OGCA 3T9KA 3FEHA 1DCQA 2FFWA 2D8UA 2MKEA 2CRRA 2YVRA 2B0OE 2M13A 5K3QA 3MDBC 3LVQE 2RR4A 3FM8C 4OGEA 4Z0RA 4Z0OA 3KDEC 2P57A 3H7HA 3M7KA 4H9DA 3LJUX 4O62A 5SVXA 3PLWA 2LAUA 2OWAA 2CRWA 3DDTA 2KKYA 2JM3A 2EXUA 5SVIA 2KKXA 2FD4A 3LDYA 5SVIB 3O47A 2JUNA 3LVRE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z0R A;  4Z0O A;  2L7P A;  5SVY A;  5SVI A;  4QQ4 A;  4O62 A;  2E61 A;  2RR4 A;  5SVX A;  5SVI B; 
#chains in the Genus database with same CATH topology
 2YRE A;  3JUE A;  5LCW B;  2L0B A;  4N3W A;  1WFK A;  2FFW A;  2KWN A;  4AUQ B;  5I3L A;  1WEO A;  5LKX A;  1DVP A;  3RPG C;  4MVT A;  4YAT A;  4H9D A;  2JMD A;  4O62 A;  3PLW A;  2F42 A;  3U5P A;  5KH7 A;  4X3G A;  4C9Z A;  3LVR E;  3HCT A;  4I7B A;  3DWD A;  5TRB A;  3ZTG A;  5LKU A;  2AN6 A;  5DIN A;  2Y1N A;  1FP0 A;  4NN2 A;  3N9M A;  5FEY A;  2MKE A;  4V3K C;  2K16 A;  2P57 A;  3M7K A;  1K2F A;  4GNE A;  4WA6 A;  2L5U A;  2CT2 A;  3SOU A;  2YSJ A;  3KQI A;  3FL2 A;  4BHW A;  2IQJ A;  3T9K A;  2KWO A;  2XB1 A;  1X4J A;  1VYX A;  2CRR A;  2D8S A;  2KGI A;  5G0F A;  2MT5 A;  4WZ3 B;  2F6J A;  1WES A;  3ZVZ B;  5TAB A;  1MM2 A;  3H7H A;  5AIU A;  3O35 A;  5JG6 A;  2DX8 A;  3DDT A;  5TDW A;  1WE9 A;  5FER A;  1WEE A;  3V43 A;  2JMI A;  2XOC A;  2LGV A;  2RSD A;  3EB6 A;  5DKA A;  2LXP C;  1WEV A;  1JOC A;  4ZDT A;  4UP5 A;  3PHD A;  4UI9 B;  5AIT A;  5B79 A;  2OWA A;  1WIL A;  1XWH A;  4CCG X;  3ZYQ A;  1WEN A;  2KRE A;  4FJC A;  1IYM A;  2FD4 A;  3T6R A;  3DPL R;  1CHC A;  4Q6F A;  4A4B A;  1WEU A;  2Y1M A;  3EB5 A;  5TBN A;  1MM3 A;  2M13 A;  1ZBD B;  3FM8 C;  1X4U A;  4TKP B;  2IDA A;  3RPG B;  3M63 A;  4LK9 A;  2QIC A;  3FAN A;  3LQI A;  2VJE A;  4ZQL A;  3FAO A;  3GV4 A;  2YYR A;  1FBV A;  2KGG A;  2XOY A;  2M1R A;  3N9P A;  3MDB C;  1WGM A;  4O64 A;  5G04 B;  1JM7 B;  4YAB A;  2YQL A;  5G05 B;  2ECW A;  1U6G B;  5SVX A;  2EGP A;  4WZ2 A;  3LQH A;  2KIZ A;  2CSZ A;  3I2D A;  2VJF A;  2YUR A;  4QF3 A;  4XI1 A;  2G45 A;  3MHS A;  3LRQ A;  2C2L A;  3IHP A;  3KV6 A;  2MIQ A;  2K4D A;  4R7E A;  5H1U A;  4YAD A;  2YT5 A;  2ECJ A;  4GB0 A;  3QZV A;  3L1Z B;  2YUC A;  2LAU A;  2ECV A;  2G6Q A;  2YQM A;  2ECN A;  2VP7 A;  2JUN A;  1HYI A;  3O33 A;  4AP4 A;  2VNF A;  2EA6 A;  4S3O B;  2YHO A;  3VK6 A;  2KE1 A;  4R2Y A;  3U5O A;  3LVQ E;  4FK5 A;  2KU3 A;  2KWK A;  2QJ0 A;  1JM7 A;  2BAY A;  2UZG A;  4YAX A;  5J3X A;  4A0C D;  5KH3 A;  1WEW A;  3NG2 A;  3LQJ A;  2ECT A;  2MUM A;  3L11 A;  3N9Q A;  4YBS A;  2VJE B;  2ZET C;  1WIM A;  2XOZ A;  4B7Y C;  3GL6 A;  2H0D A;  4UP0 A;  2FSA A;  1LDJ B;  5FB1 A;  2KFT A;  3HCU A;  2K1J A;  2RR4 A;  4OGE A;  2L75 A;  3KDE C;  4Z0O A;  1VFY A;  3LJU X;  4AVX A;  3ZPV 1;  2KKY A;  2VJF B;  2PNX A;  4PPE A;  4L7X A;  4GND A;  3Q1D A;  4A49 A;  1Z6U A;  4QQ4 A;  3E2D A;  2CON A;  5H1T A;  4WZ0 A;  5KH9 A;  1X4I A;  3RTR B;  4LLB A;  4GNF A;  1BOR A;  4GNG A;  5B78 A;  5TDR A;  2YSM A;  2MA5 A;  2JRJ A;  2KWJ A;  4AYC B;  3KV5 A;  2KKX A;  2YHN A;  2CSV A;  3FJU B;  3FEH A;  5H9M A;  2D8U A;  2LRI C;  4QF2 A;  2K17 A;  4V3L C;  2EOD A;  2L43 A;  2M3H A;  3U5N A;  1WEP A;  4R8P K;  3N9O A;  2EXU A;  3PUQ A;  2CKL A;  2MNZ A;  3PUR A;  2ECI A;  1LDK C;  3L1X A;  4LJN A;  2LQ6 A;  2LGG A;  2XEU A;  4I7C A;  5SVY A;  2H0D B;  2B0O E;  5K3Q A;  1Z2Q A;  2MD7 B;  2MD8 C;  1F62 A;  3O7A A;  1E4U A;  2HYE D;  2RI7 A;  3ZVY A;  3ZPV E;  3O70 A;  2E6R A;  4F52 B;  2YU4 A;  3M62 A;  2I50 A;  4AYC A;  3C5K A;  2QIZ A;  2VPB A;  3HCS A;  3O47 A;  1RMD A;  2DSM A;  2LGL A;  4F1P A;  2Y43 A;  3SOX A;  1Z60 A;  2XP0 A;  2EGM A;  4I7D A;  2VPE A;  2CSY A;  3DQV R;  1DCQ A;  2YVR A;  3T7L A;  3O34 A;  5B75 A;  4Z0R A;  2LDR A;  4MSX A;  2VPD A;  5FB0 A;  2FUI A;  2CRW A;  3N9N A;  4YBM A;  2LGK A;  2VPG A;  5EYA F;  4PTB A;  2NAA A;  4W4U A;  5SVI A;  2G43 A;  4ZUX U;  2L7P A;  2DJA A;  5C11 A;  3SUB A;  2LXH C;  4OGC A;  3U5M A;  4P5O B;  4FO9 A;  2L80 A;  3O36 A;  4N4F A;  2LN0 A;  2KYU A;  1WEM A;  1WEQ A;  4LKA A;  2JM3 A;  2JMJ A;  2CKL B;  3MHH A;  4S3O C;  3LDY A;  5D1M B;  1T1H A;  3SOW A;  1G25 A;  4A4C A;  2E61 A;  2PUY A;  3ASL A;  4IC2 A;  3N9L A;  5H1V A;  2C2V S;  3ZNI A;  1V87 A;  2YW8 A;  3KNV A;  2F6N A;  4YBT A;  2LV9 A;  3HTK C;  2M85 A;  5LKT A;  3C6W A;  3SHB A;  2FUU A;  5D1K B;  2HDP A;  2MA6 A;  4B86 C;  5B8D A;  5D1L B;  4CA1 A;  1VD4 A;  4BBQ A;  2E6S A;  2OXQ C;  3M99 A;  4IC3 A;  4YC9 A;  5B77 A;  2MNY A;  2M6M A;  4FIP A;  1N87 A;  1HYJ A;  1MBM A;  4LAD B;  2ECG A;  4L58 A;  3O37 A;  2KR4 A;  5B76 A;  5LKZ A;  5SVI B;  5C13 A; 
#chains in the Genus database with same CATH homology
 2YRE A;  3DWD A;  2CSV A;  3JUE A;  4F1P A;  2XOC A;  2L7P A;  2XP0 A;  2EGM A;  2DJA A;  3Q1D A;  2XOZ A;  5SVY A;  4QQ4 A;  2E61 A;  2IQJ A;  3E2D A;  3SUB A;  3FJU B;  2XOY A;  2CON A;  4OGC A;  3T9K A;  3FEH A;  1DCQ A;  2FFW A;  2D8U A;  2MKE A;  2CRR A;  2YVR A;  2B0O E;  2M13 A;  5K3Q A;  3MDB C;  3LVQ E;  2RR4 A;  3FM8 C;  4OGE A;  4Z0R A;  4Z0O A;  3KDE C;  2P57 A;  3H7H A;  3M7K A;  4H9D A;  3LJU X;  4O62 A;  5SVX A;  3PLW A;  2LAU A;  2OWA A;  2CRW A;  3DDT A;  2KKY A;  2JM3 A;  2EXU A;  5SVI A;  2KKX A;  2FD4 A;  3LDY A;  5SVI B;  3O47 A;  2JUN A;  3LVR E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...