4Z0RA

Crystal structure of the cw domain of zcwpw2 mutant f78r in complex with histone h3 peptide
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
57
structure length
57
Chain Sequence
ENMYVNKVWVQCENENCLKWRLLSSEDSAKVDHDEPWYCFMNTDSRYNNCSISEEDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the CW domain of ZCWPW2 mutant F78R in complex with histone H3 peptide
rcsb
source organism Homo sapiens
molecule tags Protein binding/structural protein
molecule keywords Zinc finger CW-type PWWP domain protein 2
total genus 10
structure length 57
sequence length 57
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07496 zf-CW CW-type Zinc Finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.100 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 4z0rA00
4Z0OA 5SVXA 5SVIA 5SVIB 4O62A 2E61A 2L7PA 4QQ4A 4Z0RA 5SVYA 2RR4A
chains in the Genus database with same CATH superfamily
5SVXA 2K4DA 4CCGX 2XOYA 5B8DA 3LQHA 1G25A 3DQVR 1WFKA 4FJCA 4O64A 5LKTA 2KFTA 4S3OB 1CHCA 5EYAF 4WZ0A 5TRBA 3DWDA 2ECNA 2KE1A 2YVRA 2MD8C 2LAUA 2CSVA 2LGKA 3L1XA 5J3XA 3M7KA 2JMDA 2CSYA 3N9OA 2M6MA 1WGMA 3O35A 3IHPA 3O34A 4LJNA 5H1VA 3M62A 3PLWA 2G43A 4CA1A 3FJUB 5G05B 2PUYA 4Z0OA 4N4FA 3MHSA 5H9MA 4B7YC 4A0CD 4YABA 1FP0A 2MNYA 2QJ0A 4YBTA 3KNVA 4UP5A 1BORA 2EGMA 4BBQA 1MM3A 1DCQA 2XOCA 3GV4A 4O62A 4UI9B 5AITA 3U5PA 5FEYA 3SUBA 1WIMA 2EGPA 1T1HA 4QQ4A 2MD7B 5D1MB 2H0DA 3ZYQA 2I50A 3LVQE 2IQJA 4LKAA 2D8SA 4A4CA 1HYJA 2JM3A 3KV6A 2Y1MA 2MA5A 4AP4A 4H9DA 1N87A 3M63A 2LXHC 5TBNA 5B75A 1MM2A 2ECIA 2QIZA 2C2LA 2LRIC 2XB1A 5B77A 2KKYA 3SOUA 4A4BA 4WZ2A 1WE9A 2CRWA 2MUMA 4A49A 2L0BA 5K3QA 4PTBA 3V43A 4R8PK 3O70A 1RMDA 1WEVA 3GL6A 2MIQA 2LXPC 2BAYA 2F42A 2E61A 4X3GA 3FAOA 2KU3A 2EA6A 3RPGB 2K16A 2KR4A 4P5OB 1WEWA 1Z60A 4Z0RA 4YAXA 2L75A 3FANA 2M3HA 3PURA 3HTKC 4QF3A 4F52B 3PUQA 3ZVZB 3H7HA 2KWJA 1Z2QA 3N9LA 5SVYA 5B78A 1E4UA 2EXUA 2DSMA 3LRQA 4I7DA 4TKPB 1XWHA 3JUEA 4FO9A 4QF2A 4ZDTA 5B79A 2E6RA 2VP7A 4I7BA 2KKXA 2ECWA 5DINA 2YSJA 3MDBC 4L7XA 3T6RA 4LLBA 1X4UA 2YU4A 2EODA 4YBSA 4LADB 4C9ZA 3O37A 3LVRE 1WEPA 4W4UA 2YSMA 2QICA 1X4IA 2KIZA 5FB0A 2L7PA 2B0OE 1IYMA 3HCSA 2KWNA 3FL2A 1VFYA 3N9QA 3LDYA 2JMJA 2YYRA 3KV5A 3PHDA 3ZPVE 2MA6A 2LGLA 5G0FA 3Q1DA 4Q6FA 2DJAA 2ECTA 1DVPA 4IC3A 1FBVA 3U5MA 5DKAA 4WZ3B 1VYXA 3VK6A 2M1RA 2KREA 2LV9A 4YATA 3LQIA 4B86C 1Z6UA 2F6JA 3QZVA 4PPEA 3T7LA 3C5KA 5TDRA 1U6GB 1K2FA 5KH3A 5I3LA 2FUIA 2L43A 2AN6A 3L11A 2YT5A 2KWKA 2LN0A 2UZGA 2KYUA 3FM8C 2KWOA 4V3KC 2M13A 5B76A 2YURA 4GNDA 5SVIA 2YW8A 4YC9A 2OXQC 3FEHA 2G45A 2FFWA 3ZPV1 4OGEA 5C11A 4V3LC 2KGGA 2RI7A 2VJFA 2VNFA 1WENA 2JUNA 3M99A 1JM7B 4UP0A 3O33A 2OWAA 5LKUA 2XEUA 1LDKC 5LKXA 3ZNIA 5TDWA 4BHWA 4R7EA 4N3WA 2LDRA 3L1ZB 2YQLA 2CRRA 3LJUX 2JMIA 2IDAA 3N9NA 2E6SA 2NAAA 2MKEA 4GNFA 2CKLA 2YUCA 2VPDA 5G04B 4AUQB 2F6NA 2CSZA 1ZBDB 2H0DB 2VPBA 3SOWA 2M85A 4MSXA 2JRJA 5D1KB 2L5UA 4S3OC 2C2VS 5D1LB 4XI1A 2CT2A 4WA6A 4L58A 1WEUA 5LCWB 4AYCB 2HYED 2XP0A 4FK5A 4FIPA 5H1TA 1WILA 2YHOA 4GNEA 2LQ6A 4R2YA 2KGIA 3U5NA 3ZTGA 4MVTA 5SVIB 2P57A 5KH7A 3ZVYA 3SOXA 4OGCA 2ZETC 2DX8A 2ECGA 3EB6A 3HCTA 4YADA 2MNZA 5KH9A 4F1PA 4IC2A 5FB1A 2MT5A 2PNXA 2Y43A 2D8UA 4I7CA 2Y1NA 2CKLB 5FERA 2RSDA 5LKZA 3NG2A 5JG6A 2VPEA 4GNGA 3KDEC 1F62A 1VD4A 1HYIA 4AVXA 3DDTA 5AIUA 1X4JA 2ECJA 2VJEB 4GB0A 1JM7A 5TABA 2XOZA 3SHBA 2RR4A 4NN2A 2L80A 2VJEA 3DPLR 2LGVA 3C6WA 3RPGC 2YQMA 1WEEA 3T9KA 2FD4A 2LGGA 2K17A 4AYCA 3O47A 3E2DA 3EB5A 3ASLA 1JOCA 2CONA 1WEQA 1WEOA 2FUUA 3RTRB 1WESA 2K1JA 2FSAA 4ZQLA 3KQIA 1WEMA 5H1UA 1MBMA 2VPGA 3N9MA 1V87A 2HDPA 3U5OA 4YBMA 3N9PA 4LK9A 3LQJA 1LDJB 2YREA 3HCUA 3MHHA 4ZUXU 3O7AA 2YHNA 3O36A 5C13A 2VJFB 3I2DA 2G6QA 2ECVA
chains in the Genus database with same CATH topology
5SVXA 2JUNA 3MDBC 2JM3A 2P57A 5SVIB 2XOYA 3KDEC 2M13A 2OWAA 4H9DA 3PLWA 1DCQA 5SVIA 3H7HA 4OGCA 2XOCA 2FD4A 3T9KA 3LDYA 3FJUB 2E61A 4O62A 3DDTA 3LVRE 3FEHA 5SVYA 2FFWA 3Q1DA 4Z0OA 2DJAA 2CRRA 3O47A 3E2DA 2EXUA 4OGEA 2KKYA 3SUBA 4F1PA 3DWDA 2L7PA 2B0OE 2YREA 3LJUX 4QQ4A 2CRWA 2CONA 2XP0A 2YVRA 2D8UA 2MKEA 3FM8C 2LAUA 2CSVA 3JUEA 2EGMA 2XOZA 3LVQE 2IQJA 5K3QA 2KKXA 3M7KA 4Z0RA 2RR4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z0O A;  5SVX A;  5SVI A;  5SVI B;  4O62 A;  2E61 A;  2L7P A;  4QQ4 A;  4Z0R A;  5SVY A;  2RR4 A; 
#chains in the Genus database with same CATH topology
 5SVX A;  2K4D A;  4CCG X;  2XOY A;  5B8D A;  3LQH A;  1G25 A;  3DQV R;  1WFK A;  4FJC A;  4O64 A;  5LKT A;  2KFT A;  4S3O B;  1CHC A;  5EYA F;  4WZ0 A;  5TRB A;  3DWD A;  2ECN A;  2KE1 A;  2YVR A;  2MD8 C;  2LAU A;  2CSV A;  2LGK A;  3L1X A;  5J3X A;  3M7K A;  2JMD A;  2CSY A;  3N9O A;  2M6M A;  1WGM A;  3O35 A;  3IHP A;  3O34 A;  4LJN A;  5H1V A;  3M62 A;  3PLW A;  2G43 A;  4CA1 A;  3FJU B;  5G05 B;  2PUY A;  4Z0O A;  4N4F A;  3MHS A;  5H9M A;  4B7Y C;  4A0C D;  4YAB A;  1FP0 A;  2MNY A;  2QJ0 A;  4YBT A;  3KNV A;  4UP5 A;  1BOR A;  2EGM A;  4BBQ A;  1MM3 A;  1DCQ A;  2XOC A;  3GV4 A;  4O62 A;  4UI9 B;  5AIT A;  3U5P A;  5FEY A;  3SUB A;  1WIM A;  2EGP A;  1T1H A;  4QQ4 A;  2MD7 B;  5D1M B;  2H0D A;  3ZYQ A;  2I50 A;  3LVQ E;  2IQJ A;  4LKA A;  2D8S A;  4A4C A;  1HYJ A;  2JM3 A;  3KV6 A;  2Y1M A;  2MA5 A;  4AP4 A;  4H9D A;  1N87 A;  3M63 A;  2LXH C;  5TBN A;  5B75 A;  1MM2 A;  2ECI A;  2QIZ A;  2C2L A;  2LRI C;  2XB1 A;  5B77 A;  2KKY A;  3SOU A;  4A4B A;  4WZ2 A;  1WE9 A;  2CRW A;  2MUM A;  4A49 A;  2L0B A;  5K3Q A;  4PTB A;  3V43 A;  4R8P K;  3O70 A;  1RMD A;  1WEV A;  3GL6 A;  2MIQ A;  2LXP C;  2BAY A;  2F42 A;  2E61 A;  4X3G A;  3FAO A;  2KU3 A;  2EA6 A;  3RPG B;  2K16 A;  2KR4 A;  4P5O B;  1WEW A;  1Z60 A;  4Z0R A;  4YAX A;  2L75 A;  3FAN A;  2M3H A;  3PUR A;  3HTK C;  4QF3 A;  4F52 B;  3PUQ A;  3ZVZ B;  3H7H A;  2KWJ A;  1Z2Q A;  3N9L A;  5SVY A;  5B78 A;  1E4U A;  2EXU A;  2DSM A;  3LRQ A;  4I7D A;  4TKP B;  1XWH A;  3JUE A;  4FO9 A;  4QF2 A;  4ZDT A;  5B79 A;  2E6R A;  2VP7 A;  4I7B A;  2KKX A;  2ECW A;  5DIN A;  2YSJ A;  3MDB C;  4L7X A;  3T6R A;  4LLB A;  1X4U A;  2YU4 A;  2EOD A;  4YBS A;  4LAD B;  4C9Z A;  3O37 A;  3LVR E;  1WEP A;  4W4U A;  2YSM A;  2QIC A;  1X4I A;  2KIZ A;  5FB0 A;  2L7P A;  2B0O E;  1IYM A;  3HCS A;  2KWN A;  3FL2 A;  1VFY A;  3N9Q A;  3LDY A;  2JMJ A;  2YYR A;  3KV5 A;  3PHD A;  3ZPV E;  2MA6 A;  2LGL A;  5G0F A;  3Q1D A;  4Q6F A;  2DJA A;  2ECT A;  1DVP A;  4IC3 A;  1FBV A;  3U5M A;  5DKA A;  4WZ3 B;  1VYX A;  3VK6 A;  2M1R A;  2KRE A;  2LV9 A;  4YAT A;  3LQI A;  4B86 C;  1Z6U A;  2F6J A;  3QZV A;  4PPE A;  3T7L A;  3C5K A;  5TDR A;  1U6G B;  1K2F A;  5KH3 A;  5I3L A;  2FUI A;  2L43 A;  2AN6 A;  3L11 A;  2YT5 A;  2KWK A;  2LN0 A;  2UZG A;  2KYU A;  3FM8 C;  2KWO A;  4V3K C;  2M13 A;  5B76 A;  2YUR A;  4GND A;  5SVI A;  2YW8 A;  4YC9 A;  2OXQ C;  3FEH A;  2G45 A;  2FFW A;  3ZPV 1;  4OGE A;  5C11 A;  4V3L C;  2KGG A;  2RI7 A;  2VJF A;  2VNF A;  1WEN A;  2JUN A;  3M99 A;  1JM7 B;  4UP0 A;  3O33 A;  2OWA A;  5LKU A;  2XEU A;  1LDK C;  5LKX A;  3ZNI A;  5TDW A;  4BHW A;  4R7E A;  4N3W A;  2LDR A;  3L1Z B;  2YQL A;  2CRR A;  3LJU X;  2JMI A;  2IDA A;  3N9N A;  2E6S A;  2NAA A;  2MKE A;  4GNF A;  2CKL A;  2YUC A;  2VPD A;  5G04 B;  4AUQ B;  2F6N A;  2CSZ A;  1ZBD B;  2H0D B;  2VPB A;  3SOW A;  2M85 A;  4MSX A;  2JRJ A;  5D1K B;  2L5U A;  4S3O C;  2C2V S;  5D1L B;  4XI1 A;  2CT2 A;  4WA6 A;  4L58 A;  1WEU A;  5LCW B;  4AYC B;  2HYE D;  2XP0 A;  4FK5 A;  4FIP A;  5H1T A;  1WIL A;  2YHO A;  4GNE A;  2LQ6 A;  4R2Y A;  2KGI A;  3U5N A;  3ZTG A;  4MVT A;  5SVI B;  2P57 A;  5KH7 A;  3ZVY A;  3SOX A;  4OGC A;  2ZET C;  2DX8 A;  2ECG A;  3EB6 A;  3HCT A;  4YAD A;  2MNZ A;  5KH9 A;  4F1P A;  4IC2 A;  5FB1 A;  2MT5 A;  2PNX A;  2Y43 A;  2D8U A;  4I7C A;  2Y1N A;  2CKL B;  5FER A;  2RSD A;  5LKZ A;  3NG2 A;  5JG6 A;  2VPE A;  4GNG A;  3KDE C;  1F62 A;  1VD4 A;  1HYI A;  4AVX A;  3DDT A;  5AIU A;  1X4J A;  2ECJ A;  2VJE B;  4GB0 A;  1JM7 A;  5TAB A;  2XOZ A;  3SHB A;  2RR4 A;  4NN2 A;  2L80 A;  2VJE A;  3DPL R;  2LGV A;  3C6W A;  3RPG C;  2YQM A;  1WEE A;  3T9K A;  2FD4 A;  2LGG A;  2K17 A;  4AYC A;  3O47 A;  3E2D A;  3EB5 A;  3ASL A;  1JOC A;  2CON A;  1WEQ A;  1WEO A;  2FUU A;  3RTR B;  1WES A;  2K1J A;  2FSA A;  4ZQL A;  3KQI A;  1WEM A;  5H1U A;  1MBM A;  2VPG A;  3N9M A;  1V87 A;  2HDP A;  3U5O A;  4YBM A;  3N9P A;  4LK9 A;  3LQJ A;  1LDJ B;  2YRE A;  3HCU A;  3MHH A;  4ZUX U;  3O7A A;  2YHN A;  3O36 A;  5C13 A;  2VJF B;  3I2D A;  2G6Q A;  2ECV A; 
#chains in the Genus database with same CATH homology
 5SVX A;  2JUN A;  3MDB C;  2JM3 A;  2P57 A;  5SVI B;  2XOY A;  3KDE C;  2M13 A;  2OWA A;  4H9D A;  3PLW A;  1DCQ A;  5SVI A;  3H7H A;  4OGC A;  2XOC A;  2FD4 A;  3T9K A;  3LDY A;  3FJU B;  2E61 A;  4O62 A;  3DDT A;  3LVR E;  3FEH A;  5SVY A;  2FFW A;  3Q1D A;  4Z0O A;  2DJA A;  2CRR A;  3O47 A;  3E2D A;  2EXU A;  4OGE A;  2KKY A;  3SUB A;  4F1P A;  3DWD A;  2L7P A;  2B0O E;  2YRE A;  3LJU X;  4QQ4 A;  2CRW A;  2CON A;  2XP0 A;  2YVR A;  2D8U A;  2MKE A;  3FM8 C;  2LAU A;  2CSV A;  3JUE A;  2EGM A;  2XOZ A;  3LVQ E;  2IQJ A;  5K3Q A;  2KKX A;  3M7K A;  4Z0R A;  2RR4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...