4Z0RA

Crystal structure of the cw domain of zcwpw2 mutant f78r in complex with histone h3 peptide
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
57
structure length
57
Chain Sequence
ENMYVNKVWVQCENENCLKWRLLSSEDSAKVDHDEPWYCFMNTDSRYNNCSISEEDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding/structural protein
molecule keywords Zinc finger CW-type PWWP domain protein 2
publication title Crystal Structure of the CW domain of ZCWPW2 mutant F78R in complex with histone H3 peptide
rcsb
source organism Homo sapiens
total genus 10
structure length 57
sequence length 57
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07496 zf-CW CW-type Zinc Finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.100 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 4z0rA00
5SVYA 4O62A 5SVXA 4Z0RA 2L7PA 2E61A 4Z0OA 5SVIA 2RR4A 5SVIB 4QQ4A
chains in the Genus database with same CATH superfamily
3O37A 2KKXA 4FJCA 2MA6A 3KV6A 1WEUA 3HTKC 2CONA 3N9QA 2L5UA 2MKEA 3T9KA 1WIMA 2MUMA 4B86C 4C9ZA 2KWOA 2MD8C 2K1JA 5B75A 4BHWA 1MM2A 1G25A 2YSMA 2YU4A 1E4UA 2YQMA 4QF2A 2VNFA 1N87A 2PNXA 3VK6A 3LVRE 1LDJB 2VJFB 2VPDA 2YSJA 4YC9A 4A4BA 1WEOA 2C2VS 2EA6A 2L7PA 2QIZA 2CRWA 1MM3A 3KNVA 4R7EA 3O36A 5TDRA 3ZPVE 2M1RA 3DDTA 4LKAA 2OWAA 4I7CA 4I7BA 3FEHA 4ZDTA 4XI1A 5TBNA 1WESA 2L0BA 3SUBA 2XOYA 5H1UA 2AN6A 4O62A 2KR4A 3N9MA 2KE1A 2CT2A 5AITA 2RR4A 5C11A 4LK9A 2VPGA 2K16A 3LJUX 4UP5A 4AVXA 4NN2A 2L43A 2LGKA 1X4IA 5FEYA 2EODA 3Q1DA 3N9NA 4FO9A 1WFKA 3L1ZB 5H1VA 4YBSA 2FUUA 2E6SA 2YW8A 3H7HA 5DINA 2KIZA 4AYCA 3N9PA 5DKAA 5LCWB 2Y43A 4H9DA 3PUQA 2F6NA 2JMIA 2LV9A 1WEVA 3MDBC 3FANA 3U5NA 2XEUA 3HCUA 5TRBA 1HYJA 5KH9A 2HDPA 2MA5A 1K2FA 2VJEA 3N9LA 3ZNIA 4YABA 5I3LA 3GL6A 3O33A 2LGVA 4GNGA 3JUEA 3C6WA 4Z0OA 2M13A 2P57A 3SHBA 2FD4A 4O64A 3O35A 1WEQA 2ZETC 2BAYA 2JMJA 3I2DA 2LXPC 3KQIA 2KGGA 2FUIA 2LGLA 4CA1A 2F6JA 2KU3A 2IQJA 2KYUA 1WEMA 2LAUA 2K4DA 4UP0A 2OXQC 2C2LA 2DJAA 5FB0A 4OGEA 5EYAF 2G45A 2YQLA 4L58A 5SVXA 3E2DA 4GNEA 2UZGA 1WEPA 5H9MA 1FP0A 3EB6A 4I7DA 4AUQB 2CKLA 5LKXA 4IC2A 1V87A 5SVIB 3SOUA 1JOCA 3L1XA 1WEEA 3FJUB 4V3LC 5LKUA 2D8SA 3U5PA 2VPEA 1ZBDB 2VPBA 2LN0A 2RSDA 4Z0RA 3V43A 3ZVYA 3LVQE 2JMDA 3KV5A 3FAOA 1DCQA 2G43A 3U5OA 2ECWA 4FIPA 1CHCA 3C5KA 5G0FA 5JG6A 3O7AA 1WILA 2B0OE 2DX8A 2M6MA 3EB5A 2ECJA 3HCTA 2NAAA 2RI7A 2JUNA 1RMDA 5KH3A 4X3GA 4LLBA 3ASLA 2L80A 3LQJA 2Y1MA 4UI9B 2M3HA 2MIQA 2ECTA 4Q6FA 4A49A 1WENA 4LADB 5D1MB 3LRQA 2CRRA 2I50A 2LQ6A 5TDWA 4YADA 4W4UA 2M85A 2YUCA 2E6RA 3PHDA 2XOCA 3ZVZB 4GNDA 1HYIA 4WZ0A 4V3KC 2YHNA 2XB1A 2YT5A 3ZYQA 3GV4A 5K3QA 3LQHA 4OGCA 3DPLR 3MHSA 2ECVA 3DQVR 4AP4A 3O70A 3HCSA 2KKYA 2EXUA 4WZ2A 2MNYA 4N4FA 2KREA 2LRIC 3PLWA 3LQIA 4BBQA 2YREA 1WGMA 1X4JA 3T6RA 4S3OB 4S3OC 1JM7A 2ECIA 3SOXA 5G05B 2H0DA 2KWJA 3T7LA 4YAXA 3RTRB 1FBVA 3M7KA 3U5MA 2CKLB 1LDKC 3RPGB 4R2YA 3RPGC 4LJNA 4WZ3B 2YVRA 3MHHA 1XWHA 2MD7B 4ZUXU 2Y1NA 4L7XA 4GNFA 4A0CD 2YYRA 5FERA 2ECNA 2EGMA 5B76A 1WEWA 2XOZA 1Z2QA 3SOWA 5B77A 2MNZA 5B8DA 3KDEC 1F62A 3DWDA 1VFYA 2JRJA 1VYXA 2PUYA 1Z6UA 2LGGA 1IYMA 3QZVA 4N3WA 5C13A 2E61A 5FB1A 4GB0A 5TABA 2CSZA 3M63A 3NG2A 5B79A 4MVTA 3IHPA 5D1LB 2K17A 4PPEA 4AYCB 3FL2A 5SVYA 2KWNA 2XP0A 2DSMA 1T1HA 2HYED 4QQ4A 5G04B 3N9OA 4ZQLA 2VJEB 3FM8C 5LKTA 2MT5A 2VJFA 5SVIA 3O47A 2YURA 5B78A 3ZTGA 4R8PK 4QF3A 3LDYA 5D1KB 4P5OB 4TKPB 5KH7A 2L75A 2IDAA 4YATA 2FFWA 1JM7B 1Z60A 2D8UA 2H0DB 1MBMA 3PURA 5J3XA 4YBTA 2QICA 2QJ0A 2G6QA 1WE9A 4MSXA 5AIUA 2YHOA 4WA6A 1BORA 2F42A 2LDRA 3ZPV1 4F52B 1VD4A 1U6GB 2CSVA 1X4UA 3M62A 4F1PA 3O34A 2KGIA 3M99A 4IC3A 4CCGX 2KWKA 2ECGA 2VP7A 4B7YC 5LKZA 2JM3A 1DVPA 2CSYA 4FK5A 2EGPA 2FSAA 2KFTA 3L11A 4PTBA 4A4CA 2LXHC 5H1TA 4YBMA
chains in the Genus database with same CATH topology
3MDBC 2EGMA 2D8UA 1DCQA 2CRRA 2E61A 3FEHA 2KKXA 2XOZA 3M7KA 2KKYA 3Q1DA 3LVRE 2IQJA 3FM8C 2JM3A 2CONA 5SVIA 2B0OE 2EXUA 2XOYA 3SUBA 2LAUA 3O47A 3KDEC 2MKEA 5SVIB 3T9KA 3DWDA 2XOCA 4O62A 2YVRA 2DJAA 2JUNA 3PLWA 2L7PA 3H7HA 3FJUB 3JUEA 4Z0OA 2M13A 2CRWA 2P57A 2YREA 4OGEA 2FD4A 2RR4A 3LDYA 5K3QA 5SVYA 5SVXA 2XP0A 3E2DA 4Z0RA 2CSVA 3DDTA 4H9DA 3LJUX 2FFWA 4OGCA 4F1PA 2OWAA 4QQ4A 3LVQE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5SVY A;  4O62 A;  5SVX A;  4Z0R A;  2L7P A;  2E61 A;  4Z0O A;  5SVI A;  2RR4 A;  5SVI B;  4QQ4 A; 
#chains in the Genus database with same CATH topology
 3O37 A;  2KKX A;  4FJC A;  2MA6 A;  3KV6 A;  1WEU A;  3HTK C;  2CON A;  3N9Q A;  2L5U A;  2MKE A;  3T9K A;  1WIM A;  2MUM A;  4B86 C;  4C9Z A;  2KWO A;  2MD8 C;  2K1J A;  5B75 A;  4BHW A;  1MM2 A;  1G25 A;  2YSM A;  2YU4 A;  1E4U A;  2YQM A;  4QF2 A;  2VNF A;  1N87 A;  2PNX A;  3VK6 A;  3LVR E;  1LDJ B;  2VJF B;  2VPD A;  2YSJ A;  4YC9 A;  4A4B A;  1WEO A;  2C2V S;  2EA6 A;  2L7P A;  2QIZ A;  2CRW A;  1MM3 A;  3KNV A;  4R7E A;  3O36 A;  5TDR A;  3ZPV E;  2M1R A;  3DDT A;  4LKA A;  2OWA A;  4I7C A;  4I7B A;  3FEH A;  4ZDT A;  4XI1 A;  5TBN A;  1WES A;  2L0B A;  3SUB A;  2XOY A;  5H1U A;  2AN6 A;  4O62 A;  2KR4 A;  3N9M A;  2KE1 A;  2CT2 A;  5AIT A;  2RR4 A;  5C11 A;  4LK9 A;  2VPG A;  2K16 A;  3LJU X;  4UP5 A;  4AVX A;  4NN2 A;  2L43 A;  2LGK A;  1X4I A;  5FEY A;  2EOD A;  3Q1D A;  3N9N A;  4FO9 A;  1WFK A;  3L1Z B;  5H1V A;  4YBS A;  2FUU A;  2E6S A;  2YW8 A;  3H7H A;  5DIN A;  2KIZ A;  4AYC A;  3N9P A;  5DKA A;  5LCW B;  2Y43 A;  4H9D A;  3PUQ A;  2F6N A;  2JMI A;  2LV9 A;  1WEV A;  3MDB C;  3FAN A;  3U5N A;  2XEU A;  3HCU A;  5TRB A;  1HYJ A;  5KH9 A;  2HDP A;  2MA5 A;  1K2F A;  2VJE A;  3N9L A;  3ZNI A;  4YAB A;  5I3L A;  3GL6 A;  3O33 A;  2LGV A;  4GNG A;  3JUE A;  3C6W A;  4Z0O A;  2M13 A;  2P57 A;  3SHB A;  2FD4 A;  4O64 A;  3O35 A;  1WEQ A;  2ZET C;  2BAY A;  2JMJ A;  3I2D A;  2LXP C;  3KQI A;  2KGG A;  2FUI A;  2LGL A;  4CA1 A;  2F6J A;  2KU3 A;  2IQJ A;  2KYU A;  1WEM A;  2LAU A;  2K4D A;  4UP0 A;  2OXQ C;  2C2L A;  2DJA A;  5FB0 A;  4OGE A;  5EYA F;  2G45 A;  2YQL A;  4L58 A;  5SVX A;  3E2D A;  4GNE A;  2UZG A;  1WEP A;  5H9M A;  1FP0 A;  3EB6 A;  4I7D A;  4AUQ B;  2CKL A;  5LKX A;  4IC2 A;  1V87 A;  5SVI B;  3SOU A;  1JOC A;  3L1X A;  1WEE A;  3FJU B;  4V3L C;  5LKU A;  2D8S A;  3U5P A;  2VPE A;  1ZBD B;  2VPB A;  2LN0 A;  2RSD A;  4Z0R A;  3V43 A;  3ZVY A;  3LVQ E;  2JMD A;  3KV5 A;  3FAO A;  1DCQ A;  2G43 A;  3U5O A;  2ECW A;  4FIP A;  1CHC A;  3C5K A;  5G0F A;  5JG6 A;  3O7A A;  1WIL A;  2B0O E;  2DX8 A;  2M6M A;  3EB5 A;  2ECJ A;  3HCT A;  2NAA A;  2RI7 A;  2JUN A;  1RMD A;  5KH3 A;  4X3G A;  4LLB A;  3ASL A;  2L80 A;  3LQJ A;  2Y1M A;  4UI9 B;  2M3H A;  2MIQ A;  2ECT A;  4Q6F A;  4A49 A;  1WEN A;  4LAD B;  5D1M B;  3LRQ A;  2CRR A;  2I50 A;  2LQ6 A;  5TDW A;  4YAD A;  4W4U A;  2M85 A;  2YUC A;  2E6R A;  3PHD A;  2XOC A;  3ZVZ B;  4GND A;  1HYI A;  4WZ0 A;  4V3K C;  2YHN A;  2XB1 A;  2YT5 A;  3ZYQ A;  3GV4 A;  5K3Q A;  3LQH A;  4OGC A;  3DPL R;  3MHS A;  2ECV A;  3DQV R;  4AP4 A;  3O70 A;  3HCS A;  2KKY A;  2EXU A;  4WZ2 A;  2MNY A;  4N4F A;  2KRE A;  2LRI C;  3PLW A;  3LQI A;  4BBQ A;  2YRE A;  1WGM A;  1X4J A;  3T6R A;  4S3O B;  4S3O C;  1JM7 A;  2ECI A;  3SOX A;  5G05 B;  2H0D A;  2KWJ A;  3T7L A;  4YAX A;  3RTR B;  1FBV A;  3M7K A;  3U5M A;  2CKL B;  1LDK C;  3RPG B;  4R2Y A;  3RPG C;  4LJN A;  4WZ3 B;  2YVR A;  3MHH A;  1XWH A;  2MD7 B;  4ZUX U;  2Y1N A;  4L7X A;  4GNF A;  4A0C D;  2YYR A;  5FER A;  2ECN A;  2EGM A;  5B76 A;  1WEW A;  2XOZ A;  1Z2Q A;  3SOW A;  5B77 A;  2MNZ A;  5B8D A;  3KDE C;  1F62 A;  3DWD A;  1VFY A;  2JRJ A;  1VYX A;  2PUY A;  1Z6U A;  2LGG A;  1IYM A;  3QZV A;  4N3W A;  5C13 A;  2E61 A;  5FB1 A;  4GB0 A;  5TAB A;  2CSZ A;  3M63 A;  3NG2 A;  5B79 A;  4MVT A;  3IHP A;  5D1L B;  2K17 A;  4PPE A;  4AYC B;  3FL2 A;  5SVY A;  2KWN A;  2XP0 A;  2DSM A;  1T1H A;  2HYE D;  4QQ4 A;  5G04 B;  3N9O A;  4ZQL A;  2VJE B;  3FM8 C;  5LKT A;  2MT5 A;  2VJF A;  5SVI A;  3O47 A;  2YUR A;  5B78 A;  3ZTG A;  4R8P K;  4QF3 A;  3LDY A;  5D1K B;  4P5O B;  4TKP B;  5KH7 A;  2L75 A;  2IDA A;  4YAT A;  2FFW A;  1JM7 B;  1Z60 A;  2D8U A;  2H0D B;  1MBM A;  3PUR A;  5J3X A;  4YBT A;  2QIC A;  2QJ0 A;  2G6Q A;  1WE9 A;  4MSX A;  5AIU A;  2YHO A;  4WA6 A;  1BOR A;  2F42 A;  2LDR A;  3ZPV 1;  4F52 B;  1VD4 A;  1U6G B;  2CSV A;  1X4U A;  3M62 A;  4F1P A;  3O34 A;  2KGI A;  3M99 A;  4IC3 A;  4CCG X;  2KWK A;  2ECG A;  2VP7 A;  4B7Y C;  5LKZ A;  2JM3 A;  1DVP A;  2CSY A;  4FK5 A;  2EGP A;  2FSA A;  2KFT A;  3L11 A;  4PTB A;  4A4C A;  2LXH C;  5H1T A;  4YBM A; 
#chains in the Genus database with same CATH homology
 3MDB C;  2EGM A;  2D8U A;  1DCQ A;  2CRR A;  2E61 A;  3FEH A;  2KKX A;  2XOZ A;  3M7K A;  2KKY A;  3Q1D A;  3LVR E;  2IQJ A;  3FM8 C;  2JM3 A;  2CON A;  5SVI A;  2B0O E;  2EXU A;  2XOY A;  3SUB A;  2LAU A;  3O47 A;  3KDE C;  2MKE A;  5SVI B;  3T9K A;  3DWD A;  2XOC A;  4O62 A;  2YVR A;  2DJA A;  2JUN A;  3PLW A;  2L7P A;  3H7H A;  3FJU B;  3JUE A;  4Z0O A;  2M13 A;  2CRW A;  2P57 A;  2YRE A;  4OGE A;  2FD4 A;  2RR4 A;  3LDY A;  5K3Q A;  5SVY A;  5SVX A;  2XP0 A;  3E2D A;  4Z0R A;  2CSV A;  3DDT A;  4H9D A;  3LJU X;  2FFW A;  4OGC A;  4F1P A;  2OWA A;  4QQ4 A;  3LVQ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...