5G0FA

Crystal structure of danio rerio hdac6 znf-ubp domain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
110
structure length
110
Chain Sequence
GPDPLPWCPHLESVRPVPAGGIDVFQPCEECGGEAENWICLFCYKVLCGRYVNQHMVTHGQESGHPVVLSFADLSVWCYACESYVHNKVLHEAKNAAHLVKFGEGIHPFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insights Into Hdac6 Tubulin Deacetylation and its Selective Inhibition
pubmed doi rcsb
source organism Danio rerio
molecule tags Cell cycle
molecule keywords HDAC6
total genus 29
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2016-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5g0fA00
4A4BA 2VPEA 1FP0A 2YURA 1XWHA 5TDWA 4L7XA 4GNGA 1G25A 4MSXA 2KWNA 2OXQC 3GL6A 2E6RA 2CT2A 3SOWA 4V3LC 1LDKC 5G0FA 2HDPA 1U6GB 4LLBA 4Q6FA 2VJFB 3MHSA 2MA5A 5LKUA 2VJFA 3ZTGA 4C9ZA 2KREA 3N9MA 4AVXA 5TBNA 5H1VA 3O7AA 2NAAA 2CKLB 4YBSA 3DQVR 2CKLA 1VFYA 1Z6UA 1WILA 2G45A 4AYCB 4R8PK 2VPGA 5TDRA 4ZUXU 2LXPC 2ECGA 4AYCA 1T1HA 3SHBA 2F6NA 5LCWB 3U5OA 4N4FA 3HTKC 3L1XA 2PNXA 2MNZA 4X3GA 3SOUA 4FJCA 3FL2A 5H9MA 3T6RA 5B78A 4BBQA 2KWOA 2YW8A 4FK5A 4N3WA 3KQIA 4WZ3B 3SOXA 5B76A 1WEUA 2AN6A 1WESA 3EB6A 3N9QA 1BORA 4AP4A 1WEEA 3PHDA 5KH3A 1WFKA 3HCTA 4FIPA 1Z2QA 2CSYA 3M99A 2K16A 4B7YC 3LQHA 3U5MA 2MD7B 3N9PA 2ECTA 4XI1A 2LGGA 5LKZA 1WENA 4GNFA 3T7LA 4LJNA 3L11A 4TKPB 2LV9A 2LGVA 4I7DA 2L43A 3U5PA 2F6JA 2MNYA 2XEUA 2FUUA 2YT5A 5D1LB 2XB1A 4GNEA 2LGLA 4V3KC 4YAXA 2QJ0A 2M6MA 3DPLR 2MUMA 1JOCA 2JMIA 2LQ6A 5C13A 1FBVA 1MM3A 1HYIA 2ECVA 5DKAA 2KYUA 4YATA 3N9NA 4A0CD 2VP7A 2L5UA 2YU4A 3EB5A 1LDJB 4PPEA 2JMJA 1X4UA 4O64A 4IC3A 5H1UA 3I2DA 3ZNIA 2I50A 5G05B 1Z60A 1X4JA 2YYRA 5DINA 3ASLA 2CSZA 1V87A 3VK6A 5D1MB 5LKTA 1ZBDB 4WZ0A 2K4DA 2LGKA 2KR4A 5TRBA 4QF2A 4P5OB 3PURA 4I7BA 5EYAF 2YREA 2DX8A 4FO9A 4UP0A 1DVPA 4YADA 3KV5A 2MD8C 4S3OB 2LDRA 3ZVYA 2M3HA 2KU3A 3QZVA 4W4UA 3ZPVE 2YHNA 2H0DB 2KIZA 4YABA 5LKXA 1WEPA 4UI9B 3GV4A 4ZDTA 4LADB 2JRJA 4YBMA 2HYED 2C2LA 2Y1MA 4I7CA 2YUCA 1WE9A 2K1JA 1N87A 2M85A 2KWKA 2KE1A 2KWJA 5B8DA 2Y43A 4R2YA 5AIUA 3LRQA 2H0DA 2ZETC 5B79A 3C6WA 5B77A 3O37A 3ZPV1 2BAYA 2RSDA 4YC9A 2YQMA 4MVTA 3L1ZB 1K2FA 4LK9A 1JM7A 1WEMA 2M1RA 3O33A 2FUIA 5G04B 3ZVZB 5KH7A 2RI7A 3RTRB 2L80A 4PTBA 2ECJA 2L0BA 1IYMA 2LN0A 5B75A 5J3XA 5FERA 2KGGA 2VJEB 3U5NA 5JG6A 4UP5A 1WEVA 2KFTA 2LRIC 3NG2A 1WEQA 3KNVA 4ZQLA 1RMDA 1VYXA 2QICA 3PUQA 3O36A 4QF3A 2G43A 2UZGA 3HCUA 2IDAA 2VPDA 4NN2A 2MT5A 2VNFA 5I3LA 1F62A 4A4CA 1VD4A 4IC2A 5H1TA 3O70A 3KV6A 3V43A 4R7EA 1X4IA 2ECIA 4A49A 2YSJA 5TABA 2EA6A 5C11A 2YHOA 3O34A 4GNDA 1JM7B 2MIQA 4CA1A 2EGPA 1WIMA 2L75A 3N9LA 2PUYA 4AUQB 2VJEA 2JMDA 5D1KB 4BHWA 3MHHA 1WEWA 3C5KA 2KGIA 4YBTA 3M62A 2C2VS 1E4UA 3IHPA 2F42A 3LQJA 2QIZA 3M63A 4S3OC 5FEYA 2E6SA 4L58A 2MA6A 2VPBA 3HCSA 5FB1A 2YQLA 2YSMA 2Y1NA 2ECWA 1MM2A 4B86C 1WEOA 4CCGX 5FB0A 3ZYQA 2FSAA 2ECNA 4WZ2A 2K17A 4LKAA 3RPGB 5KH9A 2EODA 3LQIA 1WGMA 2LXHC 2D8SA 3O35A 2G6QA 4GB0A 4WA6A 3RPGC 1CHCA 3N9OA 5AITA 1HYJA 4F52B
chains in the Genus database with same CATH superfamily
5SVXA 3MDBC 4A4BA 2VPEA 1FP0A 2YURA 1XWHA 5TDWA 2FD4A 4L7XA 4GNGA 1G25A 4MSXA 2KWNA 2OXQC 3GL6A 2XP0A 2E6RA 2CT2A 3LJUX 3SOWA 4V3LC 5SVYA 1LDKC 5G0FA 3DWDA 2HDPA 1U6GB 4LLBA 4Q6FA 2VJFB 3MHSA 2MA5A 5LKUA 2VJFA 3ZTGA 4C9ZA 2KREA 3N9MA 4AVXA 5TBNA 5H1VA 3O7AA 2NAAA 2CKLB 4YBSA 3DQVR 2CKLA 1VFYA 4F1PA 3FJUB 3KDEC 1Z6UA 1WILA 4Z0OA 2G45A 4AYCB 4R8PK 2VPGA 5TDRA 4ZUXU 2LXPC 2ECGA 4AYCA 1T1HA 3SHBA 2OWAA 2F6NA 5LCWB 2XOCA 3U5OA 4N4FA 5SVIA 3HTKC 3L1XA 2PNXA 2MNZA 4X3GA 3SOUA 4FJCA 3FL2A 5H9MA 3T6RA 5B78A 2B0OE 2CRWA 4BBQA 2KWOA 3T9KA 2YW8A 4FK5A 2FFWA 4N3WA 3KQIA 4WZ3B 3SOXA 5B76A 3FAOA 1WEUA 2AN6A 2L7PA 4OGEA 1WESA 3EB6A 3N9QA 1BORA 4AP4A 1WEEA 3PHDA 3Q1DA 2YVRA 5KH3A 1WFKA 4O62A 3HCTA 4FIPA 1Z2QA 2CSYA 3M99A 2K16A 4B7YC 3LQHA 3U5MA 2MD7B 3N9PA 2ECTA 4XI1A 2LGGA 5LKZA 1WENA 2LAUA 4GNFA 3T7LA 1MBMA 4LJNA 3L11A 4TKPB 2LV9A 2LGVA 4I7DA 2L43A 3U5PA 2F6JA 2MNYA 2XEUA 2FUUA 2YT5A 5D1LB 2XB1A 4GNEA 2LGLA 4V3KC 4YAXA 2RR4A 2M6MA 2QJ0A 3DPLR 2MUMA 1JOCA 2JMIA 2LQ6A 5C13A 1FBVA 1MM3A 1HYIA 2ECVA 5DKAA 2KYUA 4YATA 3N9NA 3LDYA 2E61A 4A0CD 2VP7A 2L5UA 2YU4A 3EB5A 1LDJB 4PPEA 2JMJA 1X4UA 4O64A 4IC3A 2KKXA 5H1UA 3I2DA 4OGCA 3ZNIA 2I50A 5G05B 3PLWA 1Z60A 1X4JA 2KKYA 2YYRA 5DINA 3ASLA 2CSZA 1V87A 3VK6A 5D1MB 5LKTA 1ZBDB 4WZ0A 2K4DA 2LGKA 2KR4A 5TRBA 3FM8C 4QF2A 3SUBA 4P5OB 3PURA 4I7BA 5EYAF 2YREA 2DX8A 4FO9A 4UP0A 1DVPA 4YADA 3KV5A 2MD8C 4S3OB 2LDRA 2MKEA 3ZVYA 2M3HA 2KU3A 3QZVA 4W4UA 2EGMA 2YHNA 3ZPVE 2H0DB 2KIZA 4YABA 5LKXA 1WEPA 4UI9B 3GV4A 4Z0RA 4ZDTA 4LADB 2JRJA 3E2DA 4YBMA 2HYED 2C2LA 2Y1MA 4I7CA 2YUCA 3LVRE 1WE9A 2CRRA 2K1JA 1N87A 2M85A 3LVQE 2KWKA 2KE1A 2KWJA 5B8DA 2Y43A 4R2YA 5AIUA 3LRQA 2H0DA 2ZETC 3H7HA 5B79A 3C6WA 5B77A 2DSMA 3O37A 3ZPV1 2BAYA 2RSDA 4YC9A 3M7KA 2YQMA 4MVTA 3L1ZB 1K2FA 4LK9A 1JM7A 1WEMA 2M1RA 3O33A 2FUIA 5G04B 3ZVZB 5KH7A 2RI7A 3RTRB 2L80A 4PTBA 2ECJA 2L0BA 4H9DA 1IYMA 2LN0A 5B75A 5J3XA 5FERA 2KGGA 2CONA 2VJEB 2CSVA 3U5NA 5JG6A 4UP5A 1WEVA 2KFTA 2LRIC 3NG2A 1WEQA 3KNVA 4ZQLA 1RMDA 1VYXA 2QICA 3PUQA 3O36A 4QF3A 2G43A 2UZGA 3HCUA 2IDAA 2VPDA 4NN2A 2MT5A 2VNFA 5I3LA 3JUEA 2M13A 4A4CA 1F62A 1VD4A 2XOZA 4IC2A 5H1TA 3O70A 3KV6A 3V43A 4R7EA 1X4IA 2ECIA 4A49A 2DJAA 2JM3A 2YSJA 5TABA 2EA6A 5C11A 2YHOA 3O34A 4GNDA 2P57A 1JM7B 2MIQA 2EXUA 4CA1A 2EGPA 1WIMA 2L75A 3N9LA 2PUYA 3DDTA 3O47A 2VJEA 4AUQB 2JMDA 5D1KB 4BHWA 1DCQA 3MHHA 1WEWA 3C5KA 2KGIA 4YBTA 3M62A 2C2VS 3FEHA 1E4UA 3IHPA 2F42A 3LQJA 2QIZA 3M63A 4S3OC 5FEYA 2E6SA 3FANA 4L58A 2MA6A 4QQ4A 2VPBA 3HCSA 2JUNA 5FB1A 2YQLA 2YSMA 2Y1NA 5K3QA 2ECWA 1MM2A 4B86C 1WEOA 5SVIB 4CCGX 5FB0A 3ZYQA 2FSAA 2ECNA 4WZ2A 2K17A 4LKAA 3RPGB 2D8UA 5KH9A 2EODA 3LQIA 1WGMA 2LXHC 2D8SA 3O35A 2G6QA 4GB0A 4WA6A 3RPGC 1CHCA 3N9OA 5AITA 2IQJA 1HYJA 4F52B 2XOYA
chains in the Genus database with same CATH topology
4A4BA 2VPEA 1FP0A 2YURA 1XWHA 5TDWA 4L7XA 4GNGA 1G25A 4MSXA 2KWNA 2OXQC 3GL6A 2E6RA 2CT2A 3SOWA 4V3LC 1LDKC 5G0FA 2HDPA 1U6GB 4LLBA 4Q6FA 2VJFB 3MHSA 2MA5A 5LKUA 2VJFA 3ZTGA 4C9ZA 2KREA 3N9MA 4AVXA 5TBNA 5H1VA 3O7AA 2NAAA 2CKLB 4YBSA 3DQVR 2CKLA 1VFYA 1Z6UA 1WILA 2G45A 4AYCB 4R8PK 2VPGA 5TDRA 4ZUXU 2LXPC 2ECGA 4AYCA 1T1HA 3SHBA 2F6NA 5LCWB 3U5OA 4N4FA 3HTKC 3L1XA 2PNXA 2MNZA 4X3GA 3SOUA 4FJCA 3FL2A 5H9MA 3T6RA 5B78A 4BBQA 2KWOA 2YW8A 4FK5A 4N3WA 3KQIA 4WZ3B 3SOXA 5B76A 1WEUA 2AN6A 1WESA 3EB6A 3N9QA 1BORA 4AP4A 1WEEA 3PHDA 5KH3A 1WFKA 3HCTA 4FIPA 1Z2QA 2CSYA 3M99A 2K16A 4B7YC 3LQHA 3U5MA 2MD7B 3N9PA 2ECTA 4XI1A 2LGGA 5LKZA 1WENA 4GNFA 3T7LA 4LJNA 3L11A 4TKPB 2LV9A 2LGVA 4I7DA 2L43A 3U5PA 2F6JA 2MNYA 2XEUA 2FUUA 2YT5A 5D1LB 2XB1A 4GNEA 2LGLA 4V3KC 4YAXA 2QJ0A 2M6MA 3DPLR 2MUMA 1JOCA 2JMIA 2LQ6A 5C13A 1FBVA 1MM3A 1HYIA 2ECVA 5DKAA 2KYUA 4YATA 3N9NA 4A0CD 2VP7A 2L5UA 2YU4A 3EB5A 1LDJB 4PPEA 2JMJA 1X4UA 4O64A 4IC3A 5H1UA 3I2DA 3ZNIA 2I50A 5G05B 1Z60A 1X4JA 2YYRA 5DINA 3ASLA 2CSZA 1V87A 3VK6A 5D1MB 5LKTA 1ZBDB 4WZ0A 2K4DA 2LGKA 2KR4A 5TRBA 4QF2A 4P5OB 3PURA 4I7BA 5EYAF 2YREA 2DX8A 4FO9A 4UP0A 1DVPA 4YADA 3KV5A 2MD8C 4S3OB 2LDRA 3ZVYA 2M3HA 2KU3A 3QZVA 4W4UA 3ZPVE 2YHNA 2H0DB 2KIZA 4YABA 5LKXA 1WEPA 4UI9B 3GV4A 4ZDTA 4LADB 2JRJA 4YBMA 2HYED 2C2LA 2Y1MA 4I7CA 2YUCA 1WE9A 2K1JA 1N87A 2M85A 2KWKA 2KE1A 2KWJA 5B8DA 2Y43A 4R2YA 5AIUA 3LRQA 2H0DA 2ZETC 5B79A 3C6WA 5B77A 3O37A 3ZPV1 2BAYA 2RSDA 4YC9A 2YQMA 4MVTA 3L1ZB 1K2FA 4LK9A 1JM7A 1WEMA 2M1RA 3O33A 2FUIA 5G04B 3ZVZB 5KH7A 2RI7A 3RTRB 2L80A 4PTBA 2ECJA 2L0BA 1IYMA 2LN0A 5B75A 5J3XA 5FERA 2KGGA 2VJEB 3U5NA 5JG6A 4UP5A 1WEVA 2KFTA 2LRIC 3NG2A 1WEQA 3KNVA 4ZQLA 1RMDA 1VYXA 2QICA 3PUQA 3O36A 4QF3A 2G43A 2UZGA 3HCUA 2IDAA 2VPDA 4NN2A 2MT5A 2VNFA 5I3LA 1F62A 4A4CA 1VD4A 4IC2A 5H1TA 3O70A 3KV6A 3V43A 4R7EA 1X4IA 2ECIA 4A49A 2YSJA 5TABA 2EA6A 5C11A 2YHOA 3O34A 4GNDA 1JM7B 2MIQA 4CA1A 2EGPA 1WIMA 2L75A 3N9LA 2PUYA 4AUQB 2VJEA 2JMDA 5D1KB 4BHWA 3MHHA 1WEWA 3C5KA 2KGIA 4YBTA 3M62A 2C2VS 1E4UA 3IHPA 2F42A 3LQJA 2QIZA 3M63A 4S3OC 5FEYA 2E6SA 4L58A 2MA6A 2VPBA 3HCSA 5FB1A 2YQLA 2YSMA 2Y1NA 2ECWA 1MM2A 4B86C 1WEOA 4CCGX 5FB0A 3ZYQA 2FSAA 2ECNA 4WZ2A 2K17A 4LKAA 3RPGB 5KH9A 2EODA 3LQIA 1WGMA 2LXHC 2D8SA 3O35A 2G6QA 4GB0A 4WA6A 3RPGC 1CHCA 3N9OA 5AITA 1HYJA 4F52B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A4B A;  2VPE A;  1FP0 A;  2YUR A;  1XWH A;  5TDW A;  4L7X A;  4GNG A;  1G25 A;  4MSX A;  2KWN A;  2OXQ C;  3GL6 A;  2E6R A;  2CT2 A;  3SOW A;  4V3L C;  1LDK C;  5G0F A;  2HDP A;  1U6G B;  4LLB A;  4Q6F A;  2VJF B;  3MHS A;  2MA5 A;  5LKU A;  2VJF A;  3ZTG A;  4C9Z A;  2KRE A;  3N9M A;  4AVX A;  5TBN A;  5H1V A;  3O7A A;  2NAA A;  2CKL B;  4YBS A;  3DQV R;  2CKL A;  1VFY A;  1Z6U A;  1WIL A;  2G45 A;  4AYC B;  4R8P K;  2VPG A;  5TDR A;  4ZUX U;  2LXP C;  2ECG A;  4AYC A;  1T1H A;  3SHB A;  2F6N A;  5LCW B;  3U5O A;  4N4F A;  3HTK C;  3L1X A;  2PNX A;  2MNZ A;  4X3G A;  3SOU A;  4FJC A;  3FL2 A;  5H9M A;  3T6R A;  5B78 A;  4BBQ A;  2KWO A;  2YW8 A;  4FK5 A;  4N3W A;  3KQI A;  4WZ3 B;  3SOX A;  5B76 A;  1WEU A;  2AN6 A;  1WES A;  3EB6 A;  3N9Q A;  1BOR A;  4AP4 A;  1WEE A;  3PHD A;  5KH3 A;  1WFK A;  3HCT A;  4FIP A;  1Z2Q A;  2CSY A;  3M99 A;  2K16 A;  4B7Y C;  3LQH A;  3U5M A;  2MD7 B;  3N9P A;  2ECT A;  4XI1 A;  2LGG A;  5LKZ A;  1WEN A;  4GNF A;  3T7L A;  4LJN A;  3L11 A;  4TKP B;  2LV9 A;  2LGV A;  4I7D A;  2L43 A;  3U5P A;  2F6J A;  2MNY A;  2XEU A;  2FUU A;  2YT5 A;  5D1L B;  2XB1 A;  4GNE A;  2LGL A;  4V3K C;  4YAX A;  2QJ0 A;  2M6M A;  3DPL R;  2MUM A;  1JOC A;  2JMI A;  2LQ6 A;  5C13 A;  1FBV A;  1MM3 A;  1HYI A;  2ECV A;  5DKA A;  2KYU A;  4YAT A;  3N9N A;  4A0C D;  2VP7 A;  2L5U A;  2YU4 A;  3EB5 A;  1LDJ B;  4PPE A;  2JMJ A;  1X4U A;  4O64 A;  4IC3 A;  5H1U A;  3I2D A;  3ZNI A;  2I50 A;  5G05 B;  1Z60 A;  1X4J A;  2YYR A;  5DIN A;  3ASL A;  2CSZ A;  1V87 A;  3VK6 A;  5D1M B;  5LKT A;  1ZBD B;  4WZ0 A;  2K4D A;  2LGK A;  2KR4 A;  5TRB A;  4QF2 A;  4P5O B;  3PUR A;  4I7B A;  5EYA F;  2YRE A;  2DX8 A;  4FO9 A;  4UP0 A;  1DVP A;  4YAD A;  3KV5 A;  2MD8 C;  4S3O B;  2LDR A;  3ZVY A;  2M3H A;  2KU3 A;  3QZV A;  4W4U A;  3ZPV E;  2YHN A;  2H0D B;  2KIZ A;  4YAB A;  5LKX A;  1WEP A;  4UI9 B;  3GV4 A;  4ZDT A;  4LAD B;  2JRJ A;  4YBM A;  2HYE D;  2C2L A;  2Y1M A;  4I7C A;  2YUC A;  1WE9 A;  2K1J A;  1N87 A;  2M85 A;  2KWK A;  2KE1 A;  2KWJ A;  5B8D A;  2Y43 A;  4R2Y A;  5AIU A;  3LRQ A;  2H0D A;  2ZET C;  5B79 A;  3C6W A;  5B77 A;  3O37 A;  3ZPV 1;  2BAY A;  2RSD A;  4YC9 A;  2YQM A;  4MVT A;  3L1Z B;  1K2F A;  4LK9 A;  1JM7 A;  1WEM A;  2M1R A;  3O33 A;  2FUI A;  5G04 B;  3ZVZ B;  5KH7 A;  2RI7 A;  3RTR B;  2L80 A;  4PTB A;  2ECJ A;  2L0B A;  1IYM A;  2LN0 A;  5B75 A;  5J3X A;  5FER A;  2KGG A;  2VJE B;  3U5N A;  5JG6 A;  4UP5 A;  1WEV A;  2KFT A;  2LRI C;  3NG2 A;  1WEQ A;  3KNV A;  4ZQL A;  1RMD A;  1VYX A;  2QIC A;  3PUQ A;  3O36 A;  4QF3 A;  2G43 A;  2UZG A;  3HCU A;  2IDA A;  2VPD A;  4NN2 A;  2MT5 A;  2VNF A;  5I3L A;  1F62 A;  4A4C A;  1VD4 A;  4IC2 A;  5H1T A;  3O70 A;  3KV6 A;  3V43 A;  4R7E A;  1X4I A;  2ECI A;  4A49 A;  2YSJ A;  5TAB A;  2EA6 A;  5C11 A;  2YHO A;  3O34 A;  4GND A;  1JM7 B;  2MIQ A;  4CA1 A;  2EGP A;  1WIM A;  2L75 A;  3N9L A;  2PUY A;  4AUQ B;  2VJE A;  2JMD A;  5D1K B;  4BHW A;  3MHH A;  1WEW A;  3C5K A;  2KGI A;  4YBT A;  3M62 A;  2C2V S;  1E4U A;  3IHP A;  2F42 A;  3LQJ A;  2QIZ A;  3M63 A;  4S3O C;  5FEY A;  2E6S A;  4L58 A;  2MA6 A;  2VPB A;  3HCS A;  5FB1 A;  2YQL A;  2YSM A;  2Y1N A;  2ECW A;  1MM2 A;  4B86 C;  1WEO A;  4CCG X;  5FB0 A;  3ZYQ A;  2FSA A;  2ECN A;  4WZ2 A;  2K17 A;  4LKA A;  3RPG B;  5KH9 A;  2EOD A;  3LQI A;  1WGM A;  2LXH C;  2D8S A;  3O35 A;  2G6Q A;  4GB0 A;  4WA6 A;  3RPG C;  1CHC A;  3N9O A;  5AIT A;  1HYJ A;  4F52 B; 
#chains in the Genus database with same CATH topology
 5SVX A;  3MDB C;  4A4B A;  2VPE A;  1FP0 A;  2YUR A;  1XWH A;  5TDW A;  2FD4 A;  4L7X A;  4GNG A;  1G25 A;  4MSX A;  2KWN A;  2OXQ C;  3GL6 A;  2XP0 A;  2E6R A;  2CT2 A;  3LJU X;  3SOW A;  4V3L C;  5SVY A;  1LDK C;  5G0F A;  3DWD A;  2HDP A;  1U6G B;  4LLB A;  4Q6F A;  2VJF B;  3MHS A;  2MA5 A;  5LKU A;  2VJF A;  3ZTG A;  4C9Z A;  2KRE A;  3N9M A;  4AVX A;  5TBN A;  5H1V A;  3O7A A;  2NAA A;  2CKL B;  4YBS A;  3DQV R;  2CKL A;  1VFY A;  4F1P A;  3FJU B;  3KDE C;  1Z6U A;  1WIL A;  4Z0O A;  2G45 A;  4AYC B;  4R8P K;  2VPG A;  5TDR A;  4ZUX U;  2LXP C;  2ECG A;  4AYC A;  1T1H A;  3SHB A;  2OWA A;  2F6N A;  5LCW B;  2XOC A;  3U5O A;  4N4F A;  5SVI A;  3HTK C;  3L1X A;  2PNX A;  2MNZ A;  4X3G A;  3SOU A;  4FJC A;  3FL2 A;  5H9M A;  3T6R A;  5B78 A;  2B0O E;  2CRW A;  4BBQ A;  2KWO A;  3T9K A;  2YW8 A;  4FK5 A;  2FFW A;  4N3W A;  3KQI A;  4WZ3 B;  3SOX A;  5B76 A;  3FAO A;  1WEU A;  2AN6 A;  2L7P A;  4OGE A;  1WES A;  3EB6 A;  3N9Q A;  1BOR A;  4AP4 A;  1WEE A;  3PHD A;  3Q1D A;  2YVR A;  5KH3 A;  1WFK A;  4O62 A;  3HCT A;  4FIP A;  1Z2Q A;  2CSY A;  3M99 A;  2K16 A;  4B7Y C;  3LQH A;  3U5M A;  2MD7 B;  3N9P A;  2ECT A;  4XI1 A;  2LGG A;  5LKZ A;  1WEN A;  2LAU A;  4GNF A;  3T7L A;  1MBM A;  4LJN A;  3L11 A;  4TKP B;  2LV9 A;  2LGV A;  4I7D A;  2L43 A;  3U5P A;  2F6J A;  2MNY A;  2XEU A;  2FUU A;  2YT5 A;  5D1L B;  2XB1 A;  4GNE A;  2LGL A;  4V3K C;  4YAX A;  2RR4 A;  2M6M A;  2QJ0 A;  3DPL R;  2MUM A;  1JOC A;  2JMI A;  2LQ6 A;  5C13 A;  1FBV A;  1MM3 A;  1HYI A;  2ECV A;  5DKA A;  2KYU A;  4YAT A;  3N9N A;  3LDY A;  2E61 A;  4A0C D;  2VP7 A;  2L5U A;  2YU4 A;  3EB5 A;  1LDJ B;  4PPE A;  2JMJ A;  1X4U A;  4O64 A;  4IC3 A;  2KKX A;  5H1U A;  3I2D A;  4OGC A;  3ZNI A;  2I50 A;  5G05 B;  3PLW A;  1Z60 A;  1X4J A;  2KKY A;  2YYR A;  5DIN A;  3ASL A;  2CSZ A;  1V87 A;  3VK6 A;  5D1M B;  5LKT A;  1ZBD B;  4WZ0 A;  2K4D A;  2LGK A;  2KR4 A;  5TRB A;  3FM8 C;  4QF2 A;  3SUB A;  4P5O B;  3PUR A;  4I7B A;  5EYA F;  2YRE A;  2DX8 A;  4FO9 A;  4UP0 A;  1DVP A;  4YAD A;  3KV5 A;  2MD8 C;  4S3O B;  2LDR A;  2MKE A;  3ZVY A;  2M3H A;  2KU3 A;  3QZV A;  4W4U A;  2EGM A;  2YHN A;  3ZPV E;  2H0D B;  2KIZ A;  4YAB A;  5LKX A;  1WEP A;  4UI9 B;  3GV4 A;  4Z0R A;  4ZDT A;  4LAD B;  2JRJ A;  3E2D A;  4YBM A;  2HYE D;  2C2L A;  2Y1M A;  4I7C A;  2YUC A;  3LVR E;  1WE9 A;  2CRR A;  2K1J A;  1N87 A;  2M85 A;  3LVQ E;  2KWK A;  2KE1 A;  2KWJ A;  5B8D A;  2Y43 A;  4R2Y A;  5AIU A;  3LRQ A;  2H0D A;  2ZET C;  3H7H A;  5B79 A;  3C6W A;  5B77 A;  2DSM A;  3O37 A;  3ZPV 1;  2BAY A;  2RSD A;  4YC9 A;  3M7K A;  2YQM A;  4MVT A;  3L1Z B;  1K2F A;  4LK9 A;  1JM7 A;  1WEM A;  2M1R A;  3O33 A;  2FUI A;  5G04 B;  3ZVZ B;  5KH7 A;  2RI7 A;  3RTR B;  2L80 A;  4PTB A;  2ECJ A;  2L0B A;  4H9D A;  1IYM A;  2LN0 A;  5B75 A;  5J3X A;  5FER A;  2KGG A;  2CON A;  2VJE B;  2CSV A;  3U5N A;  5JG6 A;  4UP5 A;  1WEV A;  2KFT A;  2LRI C;  3NG2 A;  1WEQ A;  3KNV A;  4ZQL A;  1RMD A;  1VYX A;  2QIC A;  3PUQ A;  3O36 A;  4QF3 A;  2G43 A;  2UZG A;  3HCU A;  2IDA A;  2VPD A;  4NN2 A;  2MT5 A;  2VNF A;  5I3L A;  3JUE A;  2M13 A;  4A4C A;  1F62 A;  1VD4 A;  2XOZ A;  4IC2 A;  5H1T A;  3O70 A;  3KV6 A;  3V43 A;  4R7E A;  1X4I A;  2ECI A;  4A49 A;  2DJA A;  2JM3 A;  2YSJ A;  5TAB A;  2EA6 A;  5C11 A;  2YHO A;  3O34 A;  4GND A;  2P57 A;  1JM7 B;  2MIQ A;  2EXU A;  4CA1 A;  2EGP A;  1WIM A;  2L75 A;  3N9L A;  2PUY A;  3DDT A;  3O47 A;  2VJE A;  4AUQ B;  2JMD A;  5D1K B;  4BHW A;  1DCQ A;  3MHH A;  1WEW A;  3C5K A;  2KGI A;  4YBT A;  3M62 A;  2C2V S;  3FEH A;  1E4U A;  3IHP A;  2F42 A;  3LQJ A;  2QIZ A;  3M63 A;  4S3O C;  5FEY A;  2E6S A;  3FAN A;  4L58 A;  2MA6 A;  4QQ4 A;  2VPB A;  3HCS A;  2JUN A;  5FB1 A;  2YQL A;  2YSM A;  2Y1N A;  5K3Q A;  2ECW A;  1MM2 A;  4B86 C;  1WEO A;  5SVI B;  4CCG X;  5FB0 A;  3ZYQ A;  2FSA A;  2ECN A;  4WZ2 A;  2K17 A;  4LKA A;  3RPG B;  2D8U A;  5KH9 A;  2EOD A;  3LQI A;  1WGM A;  2LXH C;  2D8S A;  3O35 A;  2G6Q A;  4GB0 A;  4WA6 A;  3RPG C;  1CHC A;  3N9O A;  5AIT A;  2IQJ A;  1HYJ A;  4F52 B;  2XOY A; 
#chains in the Genus database with same CATH homology
 4A4B A;  2VPE A;  1FP0 A;  2YUR A;  1XWH A;  5TDW A;  4L7X A;  4GNG A;  1G25 A;  4MSX A;  2KWN A;  2OXQ C;  3GL6 A;  2E6R A;  2CT2 A;  3SOW A;  4V3L C;  1LDK C;  5G0F A;  2HDP A;  1U6G B;  4LLB A;  4Q6F A;  2VJF B;  3MHS A;  2MA5 A;  5LKU A;  2VJF A;  3ZTG A;  4C9Z A;  2KRE A;  3N9M A;  4AVX A;  5TBN A;  5H1V A;  3O7A A;  2NAA A;  2CKL B;  4YBS A;  3DQV R;  2CKL A;  1VFY A;  1Z6U A;  1WIL A;  2G45 A;  4AYC B;  4R8P K;  2VPG A;  5TDR A;  4ZUX U;  2LXP C;  2ECG A;  4AYC A;  1T1H A;  3SHB A;  2F6N A;  5LCW B;  3U5O A;  4N4F A;  3HTK C;  3L1X A;  2PNX A;  2MNZ A;  4X3G A;  3SOU A;  4FJC A;  3FL2 A;  5H9M A;  3T6R A;  5B78 A;  4BBQ A;  2KWO A;  2YW8 A;  4FK5 A;  4N3W A;  3KQI A;  4WZ3 B;  3SOX A;  5B76 A;  1WEU A;  2AN6 A;  1WES A;  3EB6 A;  3N9Q A;  1BOR A;  4AP4 A;  1WEE A;  3PHD A;  5KH3 A;  1WFK A;  3HCT A;  4FIP A;  1Z2Q A;  2CSY A;  3M99 A;  2K16 A;  4B7Y C;  3LQH A;  3U5M A;  2MD7 B;  3N9P A;  2ECT A;  4XI1 A;  2LGG A;  5LKZ A;  1WEN A;  4GNF A;  3T7L A;  4LJN A;  3L11 A;  4TKP B;  2LV9 A;  2LGV A;  4I7D A;  2L43 A;  3U5P A;  2F6J A;  2MNY A;  2XEU A;  2FUU A;  2YT5 A;  5D1L B;  2XB1 A;  4GNE A;  2LGL A;  4V3K C;  4YAX A;  2QJ0 A;  2M6M A;  3DPL R;  2MUM A;  1JOC A;  2JMI A;  2LQ6 A;  5C13 A;  1FBV A;  1MM3 A;  1HYI A;  2ECV A;  5DKA A;  2KYU A;  4YAT A;  3N9N A;  4A0C D;  2VP7 A;  2L5U A;  2YU4 A;  3EB5 A;  1LDJ B;  4PPE A;  2JMJ A;  1X4U A;  4O64 A;  4IC3 A;  5H1U A;  3I2D A;  3ZNI A;  2I50 A;  5G05 B;  1Z60 A;  1X4J A;  2YYR A;  5DIN A;  3ASL A;  2CSZ A;  1V87 A;  3VK6 A;  5D1M B;  5LKT A;  1ZBD B;  4WZ0 A;  2K4D A;  2LGK A;  2KR4 A;  5TRB A;  4QF2 A;  4P5O B;  3PUR A;  4I7B A;  5EYA F;  2YRE A;  2DX8 A;  4FO9 A;  4UP0 A;  1DVP A;  4YAD A;  3KV5 A;  2MD8 C;  4S3O B;  2LDR A;  3ZVY A;  2M3H A;  2KU3 A;  3QZV A;  4W4U A;  3ZPV E;  2YHN A;  2H0D B;  2KIZ A;  4YAB A;  5LKX A;  1WEP A;  4UI9 B;  3GV4 A;  4ZDT A;  4LAD B;  2JRJ A;  4YBM A;  2HYE D;  2C2L A;  2Y1M A;  4I7C A;  2YUC A;  1WE9 A;  2K1J A;  1N87 A;  2M85 A;  2KWK A;  2KE1 A;  2KWJ A;  5B8D A;  2Y43 A;  4R2Y A;  5AIU A;  3LRQ A;  2H0D A;  2ZET C;  5B79 A;  3C6W A;  5B77 A;  3O37 A;  3ZPV 1;  2BAY A;  2RSD A;  4YC9 A;  2YQM A;  4MVT A;  3L1Z B;  1K2F A;  4LK9 A;  1JM7 A;  1WEM A;  2M1R A;  3O33 A;  2FUI A;  5G04 B;  3ZVZ B;  5KH7 A;  2RI7 A;  3RTR B;  2L80 A;  4PTB A;  2ECJ A;  2L0B A;  1IYM A;  2LN0 A;  5B75 A;  5J3X A;  5FER A;  2KGG A;  2VJE B;  3U5N A;  5JG6 A;  4UP5 A;  1WEV A;  2KFT A;  2LRI C;  3NG2 A;  1WEQ A;  3KNV A;  4ZQL A;  1RMD A;  1VYX A;  2QIC A;  3PUQ A;  3O36 A;  4QF3 A;  2G43 A;  2UZG A;  3HCU A;  2IDA A;  2VPD A;  4NN2 A;  2MT5 A;  2VNF A;  5I3L A;  1F62 A;  4A4C A;  1VD4 A;  4IC2 A;  5H1T A;  3O70 A;  3KV6 A;  3V43 A;  4R7E A;  1X4I A;  2ECI A;  4A49 A;  2YSJ A;  5TAB A;  2EA6 A;  5C11 A;  2YHO A;  3O34 A;  4GND A;  1JM7 B;  2MIQ A;  4CA1 A;  2EGP A;  1WIM A;  2L75 A;  3N9L A;  2PUY A;  4AUQ B;  2VJE A;  2JMD A;  5D1K B;  4BHW A;  3MHH A;  1WEW A;  3C5K A;  2KGI A;  4YBT A;  3M62 A;  2C2V S;  1E4U A;  3IHP A;  2F42 A;  3LQJ A;  2QIZ A;  3M63 A;  4S3O C;  5FEY A;  2E6S A;  4L58 A;  2MA6 A;  2VPB A;  3HCS A;  5FB1 A;  2YQL A;  2YSM A;  2Y1N A;  2ECW A;  1MM2 A;  4B86 C;  1WEO A;  4CCG X;  5FB0 A;  3ZYQ A;  2FSA A;  2ECN A;  4WZ2 A;  2K17 A;  4LKA A;  3RPG B;  5KH9 A;  2EOD A;  3LQI A;  1WGM A;  2LXH C;  2D8S A;  3O35 A;  2G6Q A;  4GB0 A;  4WA6 A;  3RPG C;  1CHC A;  3N9O A;  5AIT A;  1HYJ A;  4F52 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...