5G0FA

Crystal structure of danio rerio hdac6 znf-ubp domain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
110
structure length
110
Chain Sequence
GPDPLPWCPHLESVRPVPAGGIDVFQPCEECGGEAENWICLFCYKVLCGRYVNQHMVTHGQESGHPVVLSFADLSVWCYACESYVHNKVLHEAKNAAHLVKFGEGIHPFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HDAC6
publication title Structural Insights Into Hdac6 Tubulin Deacetylation and its Selective Inhibition
pubmed doi rcsb
source organism Danio rerio
molecule tags Cell cycle
total genus 29
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2016-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5g0fA00
3SHBA 5G05B 4UP0A 2IDAA 5DINA 5FEYA 1FBVA 2LGKA 5H9MA 2HDPA 1RMDA 1WEQA 2AN6A 2ECJA 4PPEA 2K17A 2VJEB 5D1LB 3DPLR 2Y1MA 1WEEA 1WEWA 3U5MA 2G45A 4YBTA 2YREA 4BHWA 1V87A 2E6RA 3I2DA 5FERA 2LRIC 1WFKA 4WA6A 4QF3A 3HCTA 1Z6UA 2MD8C 3M63A 2CT2A 4A4CA 1IYMA 2L75A 2QIZA 4YADA 3SOXA 2Y1NA 4AYCA 2EGPA 2RSDA 3O34A 2MUMA 3SOWA 4UI9B 2FSAA 3KNVA 4LK9A 2VNFA 3U5OA 4GNFA 2LGLA 5AIUA 3M62A 2YHNA 1Z60A 5I3LA 4V3LC 2VJFA 4FJCA 4WZ2A 5LKUA 1WEVA 3KV6A 1WIMA 2E6SA 5LKTA 4YABA 2LV9A 4YAXA 5LKZA 2MIQA 1WEMA 2VPDA 2YSMA 3N9QA 4V3KC 4C9ZA 4NN2A 2LQ6A 3RPGB 2NAAA 2JMJA 4S3OC 4ZQLA 5G04B 3RTRB 3N9MA 5KH3A 2EA6A 2XEUA 3DQVR 3O36A 2ECNA 3GL6A 2H0DA 1LDJB 2F42A 4ZUXU 2VPEA 2M1RA 4L7XA 4GB0A 2L80A 1JM7A 1CHCA 1G25A 3HCUA 4S3OB 5H1VA 3KV5A 3U5NA 2MT5A 1XWHA 3FL2A 3ZPVE 2RI7A 4AYCB 1K2FA 1MM3A 3ZPV1 4AUQB 3LQHA 3QZVA 4AP4A 1Z2QA 1WESA 4R7EA 2M6MA 2JRJA 2MD7B 2MA6A 2D8SA 4UP5A 1VYXA 2KFTA 5FB1A 2KWNA 4I7CA 2CKLA 2QJ0A 2L43A 4YC9A 2VJFB 5DKAA 1U6GB 2G6QA 5G0FA 3O33A 3ZVYA 3LQIA 2HYED 2PNXA 4R2YA 1X4UA 4N4FA 2C2VS 2KR4A 3N9PA 1WENA 2FUIA 2LXPC 4B86C 5TRBA 3VK6A 2DX8A 2MNYA 1X4IA 2LXHC 3C5KA 4L58A 3PUQA 2PUYA 4TKPB 2K16A 2F6JA 4CCGX 2CSZA 2KWOA 2H0DB 5TABA 4LKAA 2KGIA 4QF2A 1WEPA 2K1JA 4IC3A 4P5OB 1JM7B 4GNDA 1ZBDB 4GNEA 3RPGC 4FK5A 4W4UA 3PHDA 3ZTGA 2ECWA 3U5PA 4Q6FA 5EYAF 4B7YC 2KE1A 2ECGA 2YURA 2I50A 2MNZA 3N9NA 3L1XA 5TBNA 2G43A 3O35A 2VPGA 3ZVZB 3O7AA 2L5UA 5LCWB 2M3HA 2LGVA 1WEOA 4XI1A 2KWJA 3T6RA 5D1MB 1WGMA 2YQLA 2EODA 3PURA 2LGGA 4A49A 3N9LA 2MA5A 3T7LA 3M99A 3HTKC 3C6WA 2CKLB 3O37A 3MHHA 2ECTA 3LQJA 1WE9A 4MVTA 1VD4A 1WILA 2UZGA 2KU3A 2CSYA 4WZ3B 1JOCA 2YYRA 5B77A 3EB5A 1HYJA 1E4UA 2ECVA 5C11A 3ASLA 4FIPA 3ZNIA 2JMIA 3V43A 4YBMA 2F6NA 3GV4A 1HYIA 2BAYA 5D1KB 5TDWA 4YBSA 2LN0A 2XB1A 2OXQC 2YW8A 2QICA 2KIZA 5J3XA 2K4DA 3KQIA 1X4JA 1FP0A 2VPBA 5JG6A 5B75A 4A4BA 3EB6A 5B79A 3LRQA 1DVPA 4PTBA 2KREA 4BBQA 1BORA 5H1UA 4I7DA 2KWKA 3L11A 2L0BA 5FB0A 2YQMA 5B78A 2YT5A 1VFYA 5KH7A 2KGGA 2YUCA 2VJEA 4WZ0A 1F62A 4MSXA 2Y43A 3SOUA 2ZETC 4ZDTA 2ECIA 4N3WA 2KYUA 5C13A 4LADB 4CA1A 3N9OA 4O64A 4IC2A 4AVXA 2YHOA 1WEUA 2YU4A 4LJNA 1LDKC 2FUUA 3IHPA 3NG2A 4LLBA 5AITA 4A0CD 1MM2A 5H1TA 4FO9A 5LKXA 3ZYQA 3L1ZB 3HCSA 5KH9A 3O70A 2LDRA 4YATA 2JMDA 1T1HA 2VP7A 2C2LA 5TDRA 4X3GA 2YSJA 4F52B 4GNGA 5B76A 4R8PK 3MHSA 5B8DA 2M85A 4I7BA 1N87A
chains in the Genus database with same CATH superfamily
3SHBA 5G05B 4UP0A 2IDAA 2P57A 3FJUB 5DINA 3DDTA 5FEYA 1FBVA 2LGKA 5H9MA 2HDPA 1RMDA 1WEQA 2AN6A 2ECJA 4PPEA 2K17A 2VJEB 5D1LB 3DPLR 2DSMA 2Y1MA 1WEEA 1WEWA 3U5MA 2G45A 4YBTA 2YREA 4BHWA 3KDEC 1V87A 2E6RA 2YVRA 3I2DA 5FERA 2LRIC 1WFKA 3JUEA 1DCQA 4WA6A 4QF3A 3HCTA 1Z6UA 2XP0A 2D8UA 2MD8C 3M63A 2CT2A 4A4CA 1IYMA 2L75A 2QIZA 4YADA 3SOXA 2Y1NA 4AYCA 2EGPA 2RSDA 3O34A 2MUMA 3SUBA 3LVQE 3SOWA 4UI9B 2FSAA 3KNVA 4F1PA 4LK9A 2VNFA 3MDBC 3U5OA 4GNFA 2LGLA 5AIUA 3Q1DA 3M62A 2YHNA 1Z60A 5I3LA 4V3LC 2VJFA 4FJCA 4WZ2A 5LKUA 1WEVA 2MKEA 3KV6A 1WIMA 2E6SA 5LKTA 4YABA 2XOCA 2LV9A 4YAXA 5LKZA 2MIQA 2JUNA 2DJAA 1WEMA 2VPDA 2YSMA 3N9QA 4V3KC 4C9ZA 4NN2A 2LQ6A 3RPGB 2NAAA 2JMJA 4OGCA 4S3OC 4ZQLA 5G04B 3RTRB 3N9MA 5KH3A 2EA6A 2XEUA 2B0OE 3DQVR 3O36A 3FAOA 2ECNA 3GL6A 2H0DA 1LDJB 2F42A 4ZUXU 2VPEA 2M1RA 4L7XA 4GB0A 2L80A 1JM7A 4OGEA 1CHCA 2RR4A 1G25A 3HCUA 4S3OB 5H1VA 3KV5A 3U5NA 2MT5A 1XWHA 3FL2A 3ZPVE 2RI7A 4AYCB 1K2FA 1MM3A 3ZPV1 4AUQB 3LQHA 2CRWA 3QZVA 4AP4A 1Z2QA 2FD4A 2M13A 1WESA 4R7EA 2M6MA 2XOYA 4QQ4A 2JRJA 2MD7B 3O47A 3H7HA 2MA6A 2D8SA 4UP5A 1VYXA 2KFTA 2L7PA 5FB1A 2KWNA 4I7CA 2CKLA 2QJ0A 3LJUX 2L43A 4YC9A 2VJFB 5DKAA 1U6GB 2G6QA 5G0FA 3O33A 3ZVYA 3LQIA 2HYED 3E2DA 3LDYA 4R2YA 2PNXA 1X4UA 4N4FA 2C2VS 2KR4A 3N9PA 1WENA 2FUIA 2LXPC 4B86C 5TRBA 3VK6A 2DX8A 2MNYA 1X4IA 4Z0OA 2LXHC 3C5KA 4L58A 3PUQA 2PUYA 4TKPB 2K16A 2F6JA 4CCGX 2CSZA 2KWOA 4O62A 2H0DB 5TABA 4LKAA 2KGIA 4QF2A 1WEPA 2K1JA 4IC3A 4P5OB 1JM7B 4GNDA 1ZBDB 4GNEA 3RPGC 4FK5A 4W4UA 3PHDA 3ZTGA 2ECWA 3U5PA 4Q6FA 3FEHA 5EYAF 4B7YC 2LAUA 2KE1A 2ECGA 2YURA 2I50A 2MNZA 3N9NA 2FFWA 3L1XA 5TBNA 2G43A 3O35A 2CRRA 2VPGA 3ZVZB 3O7AA 2L5UA 5LCWB 3PLWA 2M3HA 2LGVA 1WEOA 4XI1A 5SVIA 2KWJA 3T6RA 5D1MB 1WGMA 2YQLA 2KKYA 2EODA 3PURA 2LGGA 4A49A 3N9LA 2MA5A 3T7LA 3LVRE 5SVXA 3M99A 3HTKC 3C6WA 2CKLB 3O37A 3MHHA 2ECTA 3LQJA 1WE9A 4MVTA 1VD4A 1WILA 2UZGA 2KU3A 2CSYA 4WZ3B 1JOCA 2YYRA 2XOZA 5B77A 3EB5A 1HYJA 1E4UA 2ECVA 5C11A 3ASLA 4FIPA 5K3QA 3ZNIA 2JMIA 3V43A 4YBMA 2F6NA 3GV4A 1HYIA 2BAYA 5D1KB 2JM3A 5TDWA 4YBSA 2LN0A 2XB1A 2OXQC 2YW8A 2QICA 1MBMA 2KIZA 5J3XA 2K4DA 3KQIA 1X4JA 1FP0A 2VPBA 2KKXA 5B75A 5JG6A 4A4BA 3EB6A 5B79A 2IQJA 3LRQA 1DVPA 4PTBA 2KREA 4BBQA 1BORA 2EGMA 5H1UA 4I7DA 2KWKA 3L11A 2L0BA 5FB0A 2YQMA 5B78A 2YT5A 1VFYA 5KH7A 2KGGA 2YUCA 2VJEA 5SVIB 4WZ0A 1F62A 4MSXA 2Y43A 3SOUA 2ZETC 2CONA 4ZDTA 3FM8C 2ECIA 4N3WA 2KYUA 5C13A 4LADB 4CA1A 3N9OA 4O64A 4IC2A 4AVXA 2YHOA 1WEUA 2YU4A 3M7KA 4LJNA 1LDKC 2FUUA 3IHPA 2OWAA 3NG2A 4LLBA 3T9KA 5AITA 4A0CD 5SVYA 1MM2A 5H1TA 4FO9A 5LKXA 3DWDA 3L1ZB 3ZYQA 3HCSA 5KH9A 3O70A 2LDRA 4YATA 2JMDA 1T1HA 2VP7A 2E61A 3FANA 2C2LA 2CSVA 4Z0RA 5TDRA 4X3GA 2YSJA 4F52B 2EXUA 4H9DA 4GNGA 5B76A 4R8PK 3MHSA 5B8DA 2M85A 4I7BA 1N87A
chains in the Genus database with same CATH topology
3SHBA 5G05B 4UP0A 2IDAA 5DINA 5FEYA 1FBVA 2LGKA 5H9MA 2HDPA 1RMDA 1WEQA 2AN6A 2ECJA 4PPEA 2K17A 2VJEB 5D1LB 3DPLR 2Y1MA 1WEEA 1WEWA 3U5MA 2G45A 4YBTA 2YREA 4BHWA 1V87A 2E6RA 3I2DA 5FERA 2LRIC 1WFKA 4WA6A 4QF3A 3HCTA 1Z6UA 2MD8C 3M63A 2CT2A 4A4CA 1IYMA 2L75A 2QIZA 4YADA 3SOXA 2Y1NA 4AYCA 2EGPA 2RSDA 3O34A 2MUMA 3SOWA 4UI9B 2FSAA 3KNVA 4LK9A 2VNFA 3U5OA 4GNFA 2LGLA 5AIUA 3M62A 2YHNA 1Z60A 5I3LA 4V3LC 2VJFA 4FJCA 4WZ2A 5LKUA 1WEVA 3KV6A 1WIMA 2E6SA 5LKTA 4YABA 2LV9A 4YAXA 5LKZA 2MIQA 1WEMA 2VPDA 2YSMA 3N9QA 4V3KC 4C9ZA 4NN2A 2LQ6A 3RPGB 2NAAA 2JMJA 4S3OC 4ZQLA 5G04B 3RTRB 3N9MA 5KH3A 2EA6A 2XEUA 3DQVR 3O36A 2ECNA 3GL6A 2H0DA 1LDJB 2F42A 4ZUXU 2VPEA 2M1RA 4L7XA 4GB0A 2L80A 1JM7A 1CHCA 1G25A 3HCUA 4S3OB 5H1VA 3KV5A 3U5NA 2MT5A 1XWHA 3FL2A 3ZPVE 2RI7A 4AYCB 1K2FA 1MM3A 3ZPV1 4AUQB 3LQHA 3QZVA 4AP4A 1Z2QA 1WESA 4R7EA 2M6MA 2JRJA 2MD7B 2MA6A 2D8SA 4UP5A 1VYXA 2KFTA 5FB1A 2KWNA 4I7CA 2CKLA 2QJ0A 2L43A 4YC9A 2VJFB 5DKAA 1U6GB 2G6QA 5G0FA 3O33A 3ZVYA 3LQIA 2HYED 2PNXA 4R2YA 1X4UA 4N4FA 2C2VS 2KR4A 3N9PA 1WENA 2FUIA 2LXPC 4B86C 5TRBA 3VK6A 2DX8A 2MNYA 1X4IA 2LXHC 3C5KA 4L58A 3PUQA 2PUYA 4TKPB 2K16A 2F6JA 4CCGX 2CSZA 2KWOA 2H0DB 5TABA 4LKAA 2KGIA 4QF2A 1WEPA 2K1JA 4IC3A 4P5OB 1JM7B 4GNDA 1ZBDB 4GNEA 3RPGC 4FK5A 4W4UA 3PHDA 3ZTGA 2ECWA 3U5PA 4Q6FA 5EYAF 4B7YC 2KE1A 2ECGA 2YURA 2I50A 2MNZA 3N9NA 3L1XA 5TBNA 2G43A 3O35A 2VPGA 3ZVZB 3O7AA 2L5UA 5LCWB 2M3HA 2LGVA 1WEOA 4XI1A 2KWJA 3T6RA 5D1MB 1WGMA 2YQLA 2EODA 3PURA 2LGGA 4A49A 3N9LA 2MA5A 3T7LA 3M99A 3HTKC 3C6WA 2CKLB 3O37A 3MHHA 2ECTA 3LQJA 1WE9A 4MVTA 1VD4A 1WILA 2UZGA 2KU3A 2CSYA 4WZ3B 1JOCA 2YYRA 5B77A 3EB5A 1HYJA 1E4UA 2ECVA 5C11A 3ASLA 4FIPA 3ZNIA 2JMIA 3V43A 4YBMA 2F6NA 3GV4A 1HYIA 2BAYA 5D1KB 5TDWA 4YBSA 2LN0A 2XB1A 2OXQC 2YW8A 2QICA 2KIZA 5J3XA 2K4DA 3KQIA 1X4JA 1FP0A 2VPBA 5JG6A 5B75A 4A4BA 3EB6A 5B79A 3LRQA 1DVPA 4PTBA 2KREA 4BBQA 1BORA 5H1UA 4I7DA 2KWKA 3L11A 2L0BA 5FB0A 2YQMA 5B78A 2YT5A 1VFYA 5KH7A 2KGGA 2YUCA 2VJEA 4WZ0A 1F62A 4MSXA 2Y43A 3SOUA 2ZETC 4ZDTA 2ECIA 4N3WA 2KYUA 5C13A 4LADB 4CA1A 3N9OA 4O64A 4IC2A 4AVXA 2YHOA 1WEUA 2YU4A 4LJNA 1LDKC 2FUUA 3IHPA 3NG2A 4LLBA 5AITA 4A0CD 1MM2A 5H1TA 4FO9A 5LKXA 3ZYQA 3L1ZB 3HCSA 5KH9A 3O70A 2LDRA 4YATA 2JMDA 1T1HA 2VP7A 2C2LA 5TDRA 4X3GA 2YSJA 4F52B 4GNGA 5B76A 4R8PK 3MHSA 5B8DA 2M85A 4I7BA 1N87A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SHB A;  5G05 B;  4UP0 A;  2IDA A;  5DIN A;  5FEY A;  1FBV A;  2LGK A;  5H9M A;  2HDP A;  1RMD A;  1WEQ A;  2AN6 A;  2ECJ A;  4PPE A;  2K17 A;  2VJE B;  5D1L B;  3DPL R;  2Y1M A;  1WEE A;  1WEW A;  3U5M A;  2G45 A;  4YBT A;  2YRE A;  4BHW A;  1V87 A;  2E6R A;  3I2D A;  5FER A;  2LRI C;  1WFK A;  4WA6 A;  4QF3 A;  3HCT A;  1Z6U A;  2MD8 C;  3M63 A;  2CT2 A;  4A4C A;  1IYM A;  2L75 A;  2QIZ A;  4YAD A;  3SOX A;  2Y1N A;  4AYC A;  2EGP A;  2RSD A;  3O34 A;  2MUM A;  3SOW A;  4UI9 B;  2FSA A;  3KNV A;  4LK9 A;  2VNF A;  3U5O A;  4GNF A;  2LGL A;  5AIU A;  3M62 A;  2YHN A;  1Z60 A;  5I3L A;  4V3L C;  2VJF A;  4FJC A;  4WZ2 A;  5LKU A;  1WEV A;  3KV6 A;  1WIM A;  2E6S A;  5LKT A;  4YAB A;  2LV9 A;  4YAX A;  5LKZ A;  2MIQ A;  1WEM A;  2VPD A;  2YSM A;  3N9Q A;  4V3K C;  4C9Z A;  4NN2 A;  2LQ6 A;  3RPG B;  2NAA A;  2JMJ A;  4S3O C;  4ZQL A;  5G04 B;  3RTR B;  3N9M A;  5KH3 A;  2EA6 A;  2XEU A;  3DQV R;  3O36 A;  2ECN A;  3GL6 A;  2H0D A;  1LDJ B;  2F42 A;  4ZUX U;  2VPE A;  2M1R A;  4L7X A;  4GB0 A;  2L80 A;  1JM7 A;  1CHC A;  1G25 A;  3HCU A;  4S3O B;  5H1V A;  3KV5 A;  3U5N A;  2MT5 A;  1XWH A;  3FL2 A;  3ZPV E;  2RI7 A;  4AYC B;  1K2F A;  1MM3 A;  3ZPV 1;  4AUQ B;  3LQH A;  3QZV A;  4AP4 A;  1Z2Q A;  1WES A;  4R7E A;  2M6M A;  2JRJ A;  2MD7 B;  2MA6 A;  2D8S A;  4UP5 A;  1VYX A;  2KFT A;  5FB1 A;  2KWN A;  4I7C A;  2CKL A;  2QJ0 A;  2L43 A;  4YC9 A;  2VJF B;  5DKA A;  1U6G B;  2G6Q A;  5G0F A;  3O33 A;  3ZVY A;  3LQI A;  2HYE D;  2PNX A;  4R2Y A;  1X4U A;  4N4F A;  2C2V S;  2KR4 A;  3N9P A;  1WEN A;  2FUI A;  2LXP C;  4B86 C;  5TRB A;  3VK6 A;  2DX8 A;  2MNY A;  1X4I A;  2LXH C;  3C5K A;  4L58 A;  3PUQ A;  2PUY A;  4TKP B;  2K16 A;  2F6J A;  4CCG X;  2CSZ A;  2KWO A;  2H0D B;  5TAB A;  4LKA A;  2KGI A;  4QF2 A;  1WEP A;  2K1J A;  4IC3 A;  4P5O B;  1JM7 B;  4GND A;  1ZBD B;  4GNE A;  3RPG C;  4FK5 A;  4W4U A;  3PHD A;  3ZTG A;  2ECW A;  3U5P A;  4Q6F A;  5EYA F;  4B7Y C;  2KE1 A;  2ECG A;  2YUR A;  2I50 A;  2MNZ A;  3N9N A;  3L1X A;  5TBN A;  2G43 A;  3O35 A;  2VPG A;  3ZVZ B;  3O7A A;  2L5U A;  5LCW B;  2M3H A;  2LGV A;  1WEO A;  4XI1 A;  2KWJ A;  3T6R A;  5D1M B;  1WGM A;  2YQL A;  2EOD A;  3PUR A;  2LGG A;  4A49 A;  3N9L A;  2MA5 A;  3T7L A;  3M99 A;  3HTK C;  3C6W A;  2CKL B;  3O37 A;  3MHH A;  2ECT A;  3LQJ A;  1WE9 A;  4MVT A;  1VD4 A;  1WIL A;  2UZG A;  2KU3 A;  2CSY A;  4WZ3 B;  1JOC A;  2YYR A;  5B77 A;  3EB5 A;  1HYJ A;  1E4U A;  2ECV A;  5C11 A;  3ASL A;  4FIP A;  3ZNI A;  2JMI A;  3V43 A;  4YBM A;  2F6N A;  3GV4 A;  1HYI A;  2BAY A;  5D1K B;  5TDW A;  4YBS A;  2LN0 A;  2XB1 A;  2OXQ C;  2YW8 A;  2QIC A;  2KIZ A;  5J3X A;  2K4D A;  3KQI A;  1X4J A;  1FP0 A;  2VPB A;  5JG6 A;  5B75 A;  4A4B A;  3EB6 A;  5B79 A;  3LRQ A;  1DVP A;  4PTB A;  2KRE A;  4BBQ A;  1BOR A;  5H1U A;  4I7D A;  2KWK A;  3L11 A;  2L0B A;  5FB0 A;  2YQM A;  5B78 A;  2YT5 A;  1VFY A;  5KH7 A;  2KGG A;  2YUC A;  2VJE A;  4WZ0 A;  1F62 A;  4MSX A;  2Y43 A;  3SOU A;  2ZET C;  4ZDT A;  2ECI A;  4N3W A;  2KYU A;  5C13 A;  4LAD B;  4CA1 A;  3N9O A;  4O64 A;  4IC2 A;  4AVX A;  2YHO A;  1WEU A;  2YU4 A;  4LJN A;  1LDK C;  2FUU A;  3IHP A;  3NG2 A;  4LLB A;  5AIT A;  4A0C D;  1MM2 A;  5H1T A;  4FO9 A;  5LKX A;  3ZYQ A;  3L1Z B;  3HCS A;  5KH9 A;  3O70 A;  2LDR A;  4YAT A;  2JMD A;  1T1H A;  2VP7 A;  2C2L A;  5TDR A;  4X3G A;  2YSJ A;  4F52 B;  4GNG A;  5B76 A;  4R8P K;  3MHS A;  5B8D A;  2M85 A;  4I7B A;  1N87 A; 
#chains in the Genus database with same CATH topology
 3SHB A;  5G05 B;  4UP0 A;  2IDA A;  2P57 A;  3FJU B;  5DIN A;  3DDT A;  5FEY A;  1FBV A;  2LGK A;  5H9M A;  2HDP A;  1RMD A;  1WEQ A;  2AN6 A;  2ECJ A;  4PPE A;  2K17 A;  2VJE B;  5D1L B;  3DPL R;  2DSM A;  2Y1M A;  1WEE A;  1WEW A;  3U5M A;  2G45 A;  4YBT A;  2YRE A;  4BHW A;  3KDE C;  1V87 A;  2E6R A;  2YVR A;  3I2D A;  5FER A;  2LRI C;  1WFK A;  3JUE A;  1DCQ A;  4WA6 A;  4QF3 A;  3HCT A;  1Z6U A;  2XP0 A;  2D8U A;  2MD8 C;  3M63 A;  2CT2 A;  4A4C A;  1IYM A;  2L75 A;  2QIZ A;  4YAD A;  3SOX A;  2Y1N A;  4AYC A;  2EGP A;  2RSD A;  3O34 A;  2MUM A;  3SUB A;  3LVQ E;  3SOW A;  4UI9 B;  2FSA A;  3KNV A;  4F1P A;  4LK9 A;  2VNF A;  3MDB C;  3U5O A;  4GNF A;  2LGL A;  5AIU A;  3Q1D A;  3M62 A;  2YHN A;  1Z60 A;  5I3L A;  4V3L C;  2VJF A;  4FJC A;  4WZ2 A;  5LKU A;  1WEV A;  2MKE A;  3KV6 A;  1WIM A;  2E6S A;  5LKT A;  4YAB A;  2XOC A;  2LV9 A;  4YAX A;  5LKZ A;  2MIQ A;  2JUN A;  2DJA A;  1WEM A;  2VPD A;  2YSM A;  3N9Q A;  4V3K C;  4C9Z A;  4NN2 A;  2LQ6 A;  3RPG B;  2NAA A;  2JMJ A;  4OGC A;  4S3O C;  4ZQL A;  5G04 B;  3RTR B;  3N9M A;  5KH3 A;  2EA6 A;  2XEU A;  2B0O E;  3DQV R;  3O36 A;  3FAO A;  2ECN A;  3GL6 A;  2H0D A;  1LDJ B;  2F42 A;  4ZUX U;  2VPE A;  2M1R A;  4L7X A;  4GB0 A;  2L80 A;  1JM7 A;  4OGE A;  1CHC A;  2RR4 A;  1G25 A;  3HCU A;  4S3O B;  5H1V A;  3KV5 A;  3U5N A;  2MT5 A;  1XWH A;  3FL2 A;  3ZPV E;  2RI7 A;  4AYC B;  1K2F A;  1MM3 A;  3ZPV 1;  4AUQ B;  3LQH A;  2CRW A;  3QZV A;  4AP4 A;  1Z2Q A;  2FD4 A;  2M13 A;  1WES A;  4R7E A;  2M6M A;  2XOY A;  4QQ4 A;  2JRJ A;  2MD7 B;  3O47 A;  3H7H A;  2MA6 A;  2D8S A;  4UP5 A;  1VYX A;  2KFT A;  2L7P A;  5FB1 A;  2KWN A;  4I7C A;  2CKL A;  2QJ0 A;  3LJU X;  2L43 A;  4YC9 A;  2VJF B;  5DKA A;  1U6G B;  2G6Q A;  5G0F A;  3O33 A;  3ZVY A;  3LQI A;  2HYE D;  3E2D A;  3LDY A;  4R2Y A;  2PNX A;  1X4U A;  4N4F A;  2C2V S;  2KR4 A;  3N9P A;  1WEN A;  2FUI A;  2LXP C;  4B86 C;  5TRB A;  3VK6 A;  2DX8 A;  2MNY A;  1X4I A;  4Z0O A;  2LXH C;  3C5K A;  4L58 A;  3PUQ A;  2PUY A;  4TKP B;  2K16 A;  2F6J A;  4CCG X;  2CSZ A;  2KWO A;  4O62 A;  2H0D B;  5TAB A;  4LKA A;  2KGI A;  4QF2 A;  1WEP A;  2K1J A;  4IC3 A;  4P5O B;  1JM7 B;  4GND A;  1ZBD B;  4GNE A;  3RPG C;  4FK5 A;  4W4U A;  3PHD A;  3ZTG A;  2ECW A;  3U5P A;  4Q6F A;  3FEH A;  5EYA F;  4B7Y C;  2LAU A;  2KE1 A;  2ECG A;  2YUR A;  2I50 A;  2MNZ A;  3N9N A;  2FFW A;  3L1X A;  5TBN A;  2G43 A;  3O35 A;  2CRR A;  2VPG A;  3ZVZ B;  3O7A A;  2L5U A;  5LCW B;  3PLW A;  2M3H A;  2LGV A;  1WEO A;  4XI1 A;  5SVI A;  2KWJ A;  3T6R A;  5D1M B;  1WGM A;  2YQL A;  2KKY A;  2EOD A;  3PUR A;  2LGG A;  4A49 A;  3N9L A;  2MA5 A;  3T7L A;  3LVR E;  5SVX A;  3M99 A;  3HTK C;  3C6W A;  2CKL B;  3O37 A;  3MHH A;  2ECT A;  3LQJ A;  1WE9 A;  4MVT A;  1VD4 A;  1WIL A;  2UZG A;  2KU3 A;  2CSY A;  4WZ3 B;  1JOC A;  2YYR A;  2XOZ A;  5B77 A;  3EB5 A;  1HYJ A;  1E4U A;  2ECV A;  5C11 A;  3ASL A;  4FIP A;  5K3Q A;  3ZNI A;  2JMI A;  3V43 A;  4YBM A;  2F6N A;  3GV4 A;  1HYI A;  2BAY A;  5D1K B;  2JM3 A;  5TDW A;  4YBS A;  2LN0 A;  2XB1 A;  2OXQ C;  2YW8 A;  2QIC A;  1MBM A;  2KIZ A;  5J3X A;  2K4D A;  3KQI A;  1X4J A;  1FP0 A;  2VPB A;  2KKX A;  5B75 A;  5JG6 A;  4A4B A;  3EB6 A;  5B79 A;  2IQJ A;  3LRQ A;  1DVP A;  4PTB A;  2KRE A;  4BBQ A;  1BOR A;  2EGM A;  5H1U A;  4I7D A;  2KWK A;  3L11 A;  2L0B A;  5FB0 A;  2YQM A;  5B78 A;  2YT5 A;  1VFY A;  5KH7 A;  2KGG A;  2YUC A;  2VJE A;  5SVI B;  4WZ0 A;  1F62 A;  4MSX A;  2Y43 A;  3SOU A;  2ZET C;  2CON A;  4ZDT A;  3FM8 C;  2ECI A;  4N3W A;  2KYU A;  5C13 A;  4LAD B;  4CA1 A;  3N9O A;  4O64 A;  4IC2 A;  4AVX A;  2YHO A;  1WEU A;  2YU4 A;  3M7K A;  4LJN A;  1LDK C;  2FUU A;  3IHP A;  2OWA A;  3NG2 A;  4LLB A;  3T9K A;  5AIT A;  4A0C D;  5SVY A;  1MM2 A;  5H1T A;  4FO9 A;  5LKX A;  3DWD A;  3L1Z B;  3ZYQ A;  3HCS A;  5KH9 A;  3O70 A;  2LDR A;  4YAT A;  2JMD A;  1T1H A;  2VP7 A;  2E61 A;  3FAN A;  2C2L A;  2CSV A;  4Z0R A;  5TDR A;  4X3G A;  2YSJ A;  4F52 B;  2EXU A;  4H9D A;  4GNG A;  5B76 A;  4R8P K;  3MHS A;  5B8D A;  2M85 A;  4I7B A;  1N87 A; 
#chains in the Genus database with same CATH homology
 3SHB A;  5G05 B;  4UP0 A;  2IDA A;  5DIN A;  5FEY A;  1FBV A;  2LGK A;  5H9M A;  2HDP A;  1RMD A;  1WEQ A;  2AN6 A;  2ECJ A;  4PPE A;  2K17 A;  2VJE B;  5D1L B;  3DPL R;  2Y1M A;  1WEE A;  1WEW A;  3U5M A;  2G45 A;  4YBT A;  2YRE A;  4BHW A;  1V87 A;  2E6R A;  3I2D A;  5FER A;  2LRI C;  1WFK A;  4WA6 A;  4QF3 A;  3HCT A;  1Z6U A;  2MD8 C;  3M63 A;  2CT2 A;  4A4C A;  1IYM A;  2L75 A;  2QIZ A;  4YAD A;  3SOX A;  2Y1N A;  4AYC A;  2EGP A;  2RSD A;  3O34 A;  2MUM A;  3SOW A;  4UI9 B;  2FSA A;  3KNV A;  4LK9 A;  2VNF A;  3U5O A;  4GNF A;  2LGL A;  5AIU A;  3M62 A;  2YHN A;  1Z60 A;  5I3L A;  4V3L C;  2VJF A;  4FJC A;  4WZ2 A;  5LKU A;  1WEV A;  3KV6 A;  1WIM A;  2E6S A;  5LKT A;  4YAB A;  2LV9 A;  4YAX A;  5LKZ A;  2MIQ A;  1WEM A;  2VPD A;  2YSM A;  3N9Q A;  4V3K C;  4C9Z A;  4NN2 A;  2LQ6 A;  3RPG B;  2NAA A;  2JMJ A;  4S3O C;  4ZQL A;  5G04 B;  3RTR B;  3N9M A;  5KH3 A;  2EA6 A;  2XEU A;  3DQV R;  3O36 A;  2ECN A;  3GL6 A;  2H0D A;  1LDJ B;  2F42 A;  4ZUX U;  2VPE A;  2M1R A;  4L7X A;  4GB0 A;  2L80 A;  1JM7 A;  1CHC A;  1G25 A;  3HCU A;  4S3O B;  5H1V A;  3KV5 A;  3U5N A;  2MT5 A;  1XWH A;  3FL2 A;  3ZPV E;  2RI7 A;  4AYC B;  1K2F A;  1MM3 A;  3ZPV 1;  4AUQ B;  3LQH A;  3QZV A;  4AP4 A;  1Z2Q A;  1WES A;  4R7E A;  2M6M A;  2JRJ A;  2MD7 B;  2MA6 A;  2D8S A;  4UP5 A;  1VYX A;  2KFT A;  5FB1 A;  2KWN A;  4I7C A;  2CKL A;  2QJ0 A;  2L43 A;  4YC9 A;  2VJF B;  5DKA A;  1U6G B;  2G6Q A;  5G0F A;  3O33 A;  3ZVY A;  3LQI A;  2HYE D;  2PNX A;  4R2Y A;  1X4U A;  4N4F A;  2C2V S;  2KR4 A;  3N9P A;  1WEN A;  2FUI A;  2LXP C;  4B86 C;  5TRB A;  3VK6 A;  2DX8 A;  2MNY A;  1X4I A;  2LXH C;  3C5K A;  4L58 A;  3PUQ A;  2PUY A;  4TKP B;  2K16 A;  2F6J A;  4CCG X;  2CSZ A;  2KWO A;  2H0D B;  5TAB A;  4LKA A;  2KGI A;  4QF2 A;  1WEP A;  2K1J A;  4IC3 A;  4P5O B;  1JM7 B;  4GND A;  1ZBD B;  4GNE A;  3RPG C;  4FK5 A;  4W4U A;  3PHD A;  3ZTG A;  2ECW A;  3U5P A;  4Q6F A;  5EYA F;  4B7Y C;  2KE1 A;  2ECG A;  2YUR A;  2I50 A;  2MNZ A;  3N9N A;  3L1X A;  5TBN A;  2G43 A;  3O35 A;  2VPG A;  3ZVZ B;  3O7A A;  2L5U A;  5LCW B;  2M3H A;  2LGV A;  1WEO A;  4XI1 A;  2KWJ A;  3T6R A;  5D1M B;  1WGM A;  2YQL A;  2EOD A;  3PUR A;  2LGG A;  4A49 A;  3N9L A;  2MA5 A;  3T7L A;  3M99 A;  3HTK C;  3C6W A;  2CKL B;  3O37 A;  3MHH A;  2ECT A;  3LQJ A;  1WE9 A;  4MVT A;  1VD4 A;  1WIL A;  2UZG A;  2KU3 A;  2CSY A;  4WZ3 B;  1JOC A;  2YYR A;  5B77 A;  3EB5 A;  1HYJ A;  1E4U A;  2ECV A;  5C11 A;  3ASL A;  4FIP A;  3ZNI A;  2JMI A;  3V43 A;  4YBM A;  2F6N A;  3GV4 A;  1HYI A;  2BAY A;  5D1K B;  5TDW A;  4YBS A;  2LN0 A;  2XB1 A;  2OXQ C;  2YW8 A;  2QIC A;  2KIZ A;  5J3X A;  2K4D A;  3KQI A;  1X4J A;  1FP0 A;  2VPB A;  5JG6 A;  5B75 A;  4A4B A;  3EB6 A;  5B79 A;  3LRQ A;  1DVP A;  4PTB A;  2KRE A;  4BBQ A;  1BOR A;  5H1U A;  4I7D A;  2KWK A;  3L11 A;  2L0B A;  5FB0 A;  2YQM A;  5B78 A;  2YT5 A;  1VFY A;  5KH7 A;  2KGG A;  2YUC A;  2VJE A;  4WZ0 A;  1F62 A;  4MSX A;  2Y43 A;  3SOU A;  2ZET C;  4ZDT A;  2ECI A;  4N3W A;  2KYU A;  5C13 A;  4LAD B;  4CA1 A;  3N9O A;  4O64 A;  4IC2 A;  4AVX A;  2YHO A;  1WEU A;  2YU4 A;  4LJN A;  1LDK C;  2FUU A;  3IHP A;  3NG2 A;  4LLB A;  5AIT A;  4A0C D;  1MM2 A;  5H1T A;  4FO9 A;  5LKX A;  3ZYQ A;  3L1Z B;  3HCS A;  5KH9 A;  3O70 A;  2LDR A;  4YAT A;  2JMD A;  1T1H A;  2VP7 A;  2C2L A;  5TDR A;  4X3G A;  2YSJ A;  4F52 B;  4GNG A;  5B76 A;  4R8P K;  3MHS A;  5B8D A;  2M85 A;  4I7B A;  1N87 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...