3DDTA

Crystal structure of the b2 box from murf1 in dimeric state
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
48
structure length
48
Chain Sequence
GAMGSHPMCKEHEDEKINIYCLTCEVPTCSMCKVFGIHKACEVAPLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of B-Box 2 from MuRF1: identification of a novel self-association pattern in a RING-like fold
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase TRIM63
total genus 10
structure length 48
sequence length 48
chains with identical sequence B, C
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2008-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00643 zf-B_box B-box zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.200 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 3ddtA00
5K3QA 2EGMA 3DDTA 2D8UA 2YVRA 2CSVA 2DJAA 3Q1DA 2JUNA
chains in the Genus database with same CATH superfamily
4ZDTA 2LGLA 2H0DB 2CKLB 2ZETC 5B8DA 3DWDA 2G45A 1Z6UA 5AIUA 3U5OA 3H7HA 1HYIA 2F6JA 5H1UA 2YURA 1WENA 2VJEB 3KNVA 2MNYA 3SOWA 2ECNA 2HYED 2LV9A 3HCSA 2CRWA 2L43A 4R2YA 2D8SA 2Y1NA 2K17A 2ECGA 2KYUA 2LGGA 2FD4A 1JOCA 2MA6A 2JMJA 4MVTA 5SVYA 5LKUA 1RMDA 1WEQA 4AYCB 4OGCA 4QF3A 2JUNA 3VK6A 5I3LA 2EA6A 2EGMA 1WEWA 3KDEC 4F1PA 2YSJA 4LADB 2MT5A 3NG2A 3JUEA 3RPGC 1K2FA 5KH3A 3U5MA 2VPBA 5LKXA 5DKAA 2ECTA 3U5NA 4LJNA 4CA1A 2K16A 1WEUA 1X4JA 2VJFA 5H1TA 4UI9B 3LVRE 4TKPB 2YHNA 4WZ2A 2KKYA 2IQJA 2BAYA 5FB0A 4WA6A 4BHWA 2E61A 2KE1A 1JM7A 4YADA 2M3HA 3FANA 2UZGA 4A49A 2VJFB 2MNZA 2F42A 2LDRA 5SVIB 3SUBA 3DQVR 2M1RA 3LVQE 2RSDA 2RR4A 5TBNA 2VJEA 1U6GB 2VNFA 2KGIA 2YVRA 2MIQA 5LKTA 3PURA 4XI1A 2QIZA 4S3OC 4GB0A 2YSMA 3O35A 2LN0A 3M62A 3O37A 2OWAA 2PUYA 2LQ6A 4YABA 1T1HA 4GNDA 3SOUA 3ZPVE 1XWHA 4BBQA 2I50A 3M99A 1WEMA 3LQJA 1WILA 2EODA 2JRJA 2IDAA 3PHDA 2NAAA 1VD4A 1Z60A 5D1LB 2YQMA 2G6QA 4WZ3B 3HCUA 2ECJA 2PNXA 4Z0RA 3O33A 2DJAA 4IC2A 4R8PK 4WZ0A 2CONA 3T6RA 1F62A 4I7DA 2ECWA 5D1MB 3M63A 2QJ0A 3HTKC 3SOXA 4YC9A 5H1VA 5C11A 4GNEA 4V3LC 2MD7B 2CRRA 4YBMA 2KWNA 3ZYQA 4A4CA 4YATA 5G05B 2HDPA 3LQIA 4N3WA 2RI7A 4R7EA 2FUIA 1WIMA 2Y43A 2XOZA 1FP0A 5TDWA 3I2DA 2H0DA 3N9OA 5FB1A 2MKEA 3IHPA 1WE9A 3KQIA 4LLBA 3DDTA 5G0FA 3Q1DA 2YT5A 1LDJB 3GL6A 5FERA 1WEEA 4PTBA 3FEHA 5B77A 2JM3A 2YUCA 2QICA 2VP7A 2XOYA 4X3GA 1MM3A 2VPEA 4UP5A 1WEPA 2EXUA 2DX8A 2KFTA 2KWKA 4H9DA 2LAUA 4FJCA 2LXPC 4O64A 1MBMA 4YAXA 2CSYA 4QF2A 2JMIA 5TRBA 3LQHA 2YHOA 2KREA 3PUQA 3N9QA 4IC3A 3C6WA 4S3OB 3N9LA 2XEUA 4AVXA 2CSZA 2KWOA 5B78A 5FEYA 3LJUX 4P5OB 2Y1MA 5B75A 4YBTA 2LXHC 3EB5A 5SVIA 5LKZA 1G25A 2G43A 5LCWB 3L11A 1IYMA 1VYXA 2E6SA 2VPGA 2F6NA 2L0BA 4FK5A 3O36A 2XB1A 3ASLA 1VFYA 2K1JA 5JG6A 2KWJA 2C2VS 3KV5A 2JMDA 2XOCA 5AITA 2YU4A 2FFWA 3N9MA 3T7LA 3FL2A 1BORA 3FM8C 2D8UA 3T9KA 1WEOA 4A0CD 5C13A 3ZNIA 3FJUB 3N9PA 1WESA 4FIPA 2M85A 5H9MA 3O34A 3HCTA 4CCGX 2LGKA 1Z2QA 1HYJA 2DSMA 1WGMA 2KU3A 2YW8A 4C9ZA 3O70A 5SVXA 2KKXA 3QZVA 3U5PA 2KGGA 5G04B 3EB6A 4PPEA 2L75A 2K4DA 1ZBDB 2OXQC 2FSAA 5DINA 4B86C 3O47A 4AUQB 3C5KA 2YQLA 3L1ZB 4AP4A 3ZPV1 4AYCA 2AN6A 2C2LA 4L58A 4FO9A 2B0OE 2VPDA 5TDRA 1WFKA 2L7PA 3LRQA 5J3XA 2ECVA 5B76A 4I7CA 2KIZA 4LKAA 5KH9A 4F52B 1FBVA 3MHSA 2EGPA 3N9NA 3PLWA 4V3KC 5TABA 1DVPA 2YYRA 3RPGB 3ZTGA 4GNGA 4UP0A 4ZQLA 4A4BA 3DPLR 2L80A 4LK9A 4W4UA 3L1XA 2MUMA 1X4IA 3RTRB 4ZUXU 4NN2A 4Q6FA 3FAOA 4N4FA 1MM2A 5D1KB 2XP0A 4L7XA 5KH7A 4Z0OA 3ZVYA 2ECIA 2L5UA 3E2DA 3ZVZB 2LGVA 4I7BA 4QQ4A 2E6RA 4YBSA 2MD8C 1JM7B 1X4UA 4GNFA 1WEVA 4B7YC 2KR4A 2LRIC 3M7KA 2CSVA 1E4UA 1N87A 4O62A 3MHHA 5K3QA 1CHCA 2CKLA 3SHBA 2P57A 3O7AA 2FUUA 3KV6A 4MSXA 3V43A 3LDYA 1V87A 1LDKC 5B79A 2MA5A 2YREA 4OGEA 2M13A 3MDBC 3GV4A 1DCQA 2M6MA 5EYAF 2CT2A
chains in the Genus database with same CATH topology
3FM8C 2E61A 2KKXA 5SVXA 2XOYA 2L7PA 2D8UA 3M7KA 2YVRA 2CSVA 2MKEA 3T9KA 3DWDA 3H7HA 4O62A 2FD4A 5K3QA 2XP0A 3DDTA 2P57A 2XOZA 3Q1DA 5SVYA 4Z0OA 5SVIB 3FJUB 3PLWA 3SUBA 3O47A 3LDYA 3E2DA 4OGCA 2CRRA 4Z0RA 2DJAA 2EXUA 2OWAA 3LVQE 3LVRE 4QQ4A 2JUNA 2YREA 4OGEA 2M13A 2KKYA 2RR4A 2EGMA 2IQJA 2CONA 2XOCA 3FEHA 1DCQA 3LJUX 3MDBC 4F1PA 2CRWA 3KDEC 2FFWA 2LAUA 4H9DA 2JM3A 2B0OE 5SVIA 3JUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K3Q A;  2EGM A;  3DDT A;  2D8U A;  2YVR A;  2CSV A;  2DJA A;  3Q1D A;  2JUN A; 
#chains in the Genus database with same CATH topology
 4ZDT A;  2LGL A;  2H0D B;  2CKL B;  2ZET C;  5B8D A;  3DWD A;  2G45 A;  1Z6U A;  5AIU A;  3U5O A;  3H7H A;  1HYI A;  2F6J A;  5H1U A;  2YUR A;  1WEN A;  2VJE B;  3KNV A;  2MNY A;  3SOW A;  2ECN A;  2HYE D;  2LV9 A;  3HCS A;  2CRW A;  2L43 A;  4R2Y A;  2D8S A;  2Y1N A;  2K17 A;  2ECG A;  2KYU A;  2LGG A;  2FD4 A;  1JOC A;  2MA6 A;  2JMJ A;  4MVT A;  5SVY A;  5LKU A;  1RMD A;  1WEQ A;  4AYC B;  4OGC A;  4QF3 A;  2JUN A;  3VK6 A;  5I3L A;  2EA6 A;  2EGM A;  1WEW A;  3KDE C;  4F1P A;  2YSJ A;  4LAD B;  2MT5 A;  3NG2 A;  3JUE A;  3RPG C;  1K2F A;  5KH3 A;  3U5M A;  2VPB A;  5LKX A;  5DKA A;  2ECT A;  3U5N A;  4LJN A;  4CA1 A;  2K16 A;  1WEU A;  1X4J A;  2VJF A;  5H1T A;  4UI9 B;  3LVR E;  4TKP B;  2YHN A;  4WZ2 A;  2KKY A;  2IQJ A;  2BAY A;  5FB0 A;  4WA6 A;  4BHW A;  2E61 A;  2KE1 A;  1JM7 A;  4YAD A;  2M3H A;  3FAN A;  2UZG A;  4A49 A;  2VJF B;  2MNZ A;  2F42 A;  2LDR A;  5SVI B;  3SUB A;  3DQV R;  2M1R A;  3LVQ E;  2RSD A;  2RR4 A;  5TBN A;  2VJE A;  1U6G B;  2VNF A;  2KGI A;  2YVR A;  2MIQ A;  5LKT A;  3PUR A;  4XI1 A;  2QIZ A;  4S3O C;  4GB0 A;  2YSM A;  3O35 A;  2LN0 A;  3M62 A;  3O37 A;  2OWA A;  2PUY A;  2LQ6 A;  4YAB A;  1T1H A;  4GND A;  3SOU A;  3ZPV E;  1XWH A;  4BBQ A;  2I50 A;  3M99 A;  1WEM A;  3LQJ A;  1WIL A;  2EOD A;  2JRJ A;  2IDA A;  3PHD A;  2NAA A;  1VD4 A;  1Z60 A;  5D1L B;  2YQM A;  2G6Q A;  4WZ3 B;  3HCU A;  2ECJ A;  2PNX A;  4Z0R A;  3O33 A;  2DJA A;  4IC2 A;  4R8P K;  4WZ0 A;  2CON A;  3T6R A;  1F62 A;  4I7D A;  2ECW A;  5D1M B;  3M63 A;  2QJ0 A;  3HTK C;  3SOX A;  4YC9 A;  5H1V A;  5C11 A;  4GNE A;  4V3L C;  2MD7 B;  2CRR A;  4YBM A;  2KWN A;  3ZYQ A;  4A4C A;  4YAT A;  5G05 B;  2HDP A;  3LQI A;  4N3W A;  2RI7 A;  4R7E A;  2FUI A;  1WIM A;  2Y43 A;  2XOZ A;  1FP0 A;  5TDW A;  3I2D A;  2H0D A;  3N9O A;  5FB1 A;  2MKE A;  3IHP A;  1WE9 A;  3KQI A;  4LLB A;  3DDT A;  5G0F A;  3Q1D A;  2YT5 A;  1LDJ B;  3GL6 A;  5FER A;  1WEE A;  4PTB A;  3FEH A;  5B77 A;  2JM3 A;  2YUC A;  2QIC A;  2VP7 A;  2XOY A;  4X3G A;  1MM3 A;  2VPE A;  4UP5 A;  1WEP A;  2EXU A;  2DX8 A;  2KFT A;  2KWK A;  4H9D A;  2LAU A;  4FJC A;  2LXP C;  4O64 A;  1MBM A;  4YAX A;  2CSY A;  4QF2 A;  2JMI A;  5TRB A;  3LQH A;  2YHO A;  2KRE A;  3PUQ A;  3N9Q A;  4IC3 A;  3C6W A;  4S3O B;  3N9L A;  2XEU A;  4AVX A;  2CSZ A;  2KWO A;  5B78 A;  5FEY A;  3LJU X;  4P5O B;  2Y1M A;  5B75 A;  4YBT A;  2LXH C;  3EB5 A;  5SVI A;  5LKZ A;  1G25 A;  2G43 A;  5LCW B;  3L11 A;  1IYM A;  1VYX A;  2E6S A;  2VPG A;  2F6N A;  2L0B A;  4FK5 A;  3O36 A;  2XB1 A;  3ASL A;  1VFY A;  2K1J A;  5JG6 A;  2KWJ A;  2C2V S;  3KV5 A;  2JMD A;  2XOC A;  5AIT A;  2YU4 A;  2FFW A;  3N9M A;  3T7L A;  3FL2 A;  1BOR A;  3FM8 C;  2D8U A;  3T9K A;  1WEO A;  4A0C D;  5C13 A;  3ZNI A;  3FJU B;  3N9P A;  1WES A;  4FIP A;  2M85 A;  5H9M A;  3O34 A;  3HCT A;  4CCG X;  2LGK A;  1Z2Q A;  1HYJ A;  2DSM A;  1WGM A;  2KU3 A;  2YW8 A;  4C9Z A;  3O70 A;  5SVX A;  2KKX A;  3QZV A;  3U5P A;  2KGG A;  5G04 B;  3EB6 A;  4PPE A;  2L75 A;  2K4D A;  1ZBD B;  2OXQ C;  2FSA A;  5DIN A;  4B86 C;  3O47 A;  4AUQ B;  3C5K A;  2YQL A;  3L1Z B;  4AP4 A;  3ZPV 1;  4AYC A;  2AN6 A;  2C2L A;  4L58 A;  4FO9 A;  2B0O E;  2VPD A;  5TDR A;  1WFK A;  2L7P A;  3LRQ A;  5J3X A;  2ECV A;  5B76 A;  4I7C A;  2KIZ A;  4LKA A;  5KH9 A;  4F52 B;  1FBV A;  3MHS A;  2EGP A;  3N9N A;  3PLW A;  4V3K C;  5TAB A;  1DVP A;  2YYR A;  3RPG B;  3ZTG A;  4GNG A;  4UP0 A;  4ZQL A;  4A4B A;  3DPL R;  2L80 A;  4LK9 A;  4W4U A;  3L1X A;  2MUM A;  1X4I A;  3RTR B;  4ZUX U;  4NN2 A;  4Q6F A;  3FAO A;  4N4F A;  1MM2 A;  5D1K B;  2XP0 A;  4L7X A;  5KH7 A;  4Z0O A;  3ZVY A;  2ECI A;  2L5U A;  3E2D A;  3ZVZ B;  2LGV A;  4I7B A;  4QQ4 A;  2E6R A;  4YBS A;  2MD8 C;  1JM7 B;  1X4U A;  4GNF A;  1WEV A;  4B7Y C;  2KR4 A;  2LRI C;  3M7K A;  2CSV A;  1E4U A;  1N87 A;  4O62 A;  3MHH A;  5K3Q A;  1CHC A;  2CKL A;  3SHB A;  2P57 A;  3O7A A;  2FUU A;  3KV6 A;  4MSX A;  3V43 A;  3LDY A;  1V87 A;  1LDK C;  5B79 A;  2MA5 A;  2YRE A;  4OGE A;  2M13 A;  3MDB C;  3GV4 A;  1DCQ A;  2M6M A;  5EYA F;  2CT2 A; 
#chains in the Genus database with same CATH homology
 3FM8 C;  2E61 A;  2KKX A;  5SVX A;  2XOY A;  2L7P A;  2D8U A;  3M7K A;  2YVR A;  2CSV A;  2MKE A;  3T9K A;  3DWD A;  3H7H A;  4O62 A;  2FD4 A;  5K3Q A;  2XP0 A;  3DDT A;  2P57 A;  2XOZ A;  3Q1D A;  5SVY A;  4Z0O A;  5SVI B;  3FJU B;  3PLW A;  3SUB A;  3O47 A;  3LDY A;  3E2D A;  4OGC A;  2CRR A;  4Z0R A;  2DJA A;  2EXU A;  2OWA A;  3LVQ E;  3LVR E;  4QQ4 A;  2JUN A;  2YRE A;  4OGE A;  2M13 A;  2KKY A;  2RR4 A;  2EGM A;  2IQJ A;  2CON A;  2XOC A;  3FEH A;  1DCQ A;  3LJU X;  3MDB C;  4F1P A;  2CRW A;  3KDE C;  2FFW A;  2LAU A;  4H9D A;  2JM3 A;  2B0O E;  5SVI A;  3JUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...