3DDTA

Crystal structure of the b2 box from murf1 in dimeric state
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
48
structure length
48
Chain Sequence
GAMGSHPMCKEHEDEKINIYCLTCEVPTCSMCKVFGIHKACEVAPLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of B-Box 2 from MuRF1: identification of a novel self-association pattern in a RING-like fold
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase TRIM63
total genus 10
structure length 48
sequence length 48
chains with identical sequence B, C
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2008-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00643 zf-B_box B-box zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.200 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 3ddtA00
3DDTA 2CSVA 2JUNA 5K3QA 3Q1DA 2DJAA 2EGMA 2D8UA 2YVRA
chains in the Genus database with same CATH superfamily
3O36A 4ZDTA 3QZVA 2M85A 3IHPA 4YABA 3FM8C 5D1KB 3O35A 2VJEB 4P5OB 5B79A 5LKXA 3ZVZB 2HDPA 5AITA 1V87A 4W4UA 3M62A 4YADA 4V3LC 2LGVA 2JMJA 2KYUA 2PNXA 4LADB 1WEVA 2YHNA 2XOYA 1LDKC 2ZETC 4I7CA 3V43A 3LVQE 3N9QA 2FD4A 3HCTA 3M7KA 2F6JA 3KQIA 2VJEA 2CRRA 4GNGA 5FB1A 2KKXA 4QQ4A 2M13A 2EA6A 3E2DA 3KDEC 2LGKA 2Y43A 2RSDA 1DCQA 2IDAA 2E6SA 2YHOA 5TDRA 2YURA 2BAYA 2E6RA 2G43A 2JMDA 3DDTA 4AVXA 1IYMA 2K17A 2M1RA 3L1XA 3C6WA 2CRWA 5H1TA 4UI9B 3DQVR 1WENA 2DX8A 2L7PA 5B77A 2KWKA 5TDWA 2LV9A 2VP7A 3GL6A 3KV6A 3MHSA 4B7YC 1XWHA 4YBMA 2FUIA 2MKEA 2YQLA 3I2DA 2UZGA 5B76A 2KU3A 1X4JA 2L80A 4XI1A 2AN6A 1WEEA 5D1LB 2H0DB 2YT5A 3O34A 2JMIA 4LK9A 5I3LA 2E61A 4OGCA 2JUNA 2YU4A 1U6GB 3DWDA 3SHBA 2QIZA 4O62A 1WIMA 2ECTA 3ZPVE 2K16A 4V3KC 2VJFA 5TBNA 3JUEA 5G0FA 5H9MA 2RR4A 2MUMA 4LLBA 4IC3A 5C11A 2IQJA 1E4UA 3LDYA 1WEOA 2FFWA 3SOXA 3N9MA 2MNZA 3FANA 3RTRB 2XP0A 4R8PK 4F1PA 2ECJA 2EGMA 2K1JA 2CONA 4C9ZA 1CHCA 1N87A 3EB5A 2CSZA 2KR4A 4NN2A 2MD8C 1LDJB 2VPEA 4BHWA 2VJFB 4A49A 5G05B 4ZUXU 1WEUA 3PURA 5FEYA 3FJUB 3H7HA 2M6MA 3T6RA 4YAXA 1DVPA 2LQ6A 2H0DA 4GNEA 2C2LA 3M99A 1MM3A 3ASLA 4Q6FA 2VPBA 3HTKC 1JOCA 2YREA 5K3QA 3O33A 5TRBA 1WEMA 5SVYA 3U5MA 1VYXA 5AIUA 4YBSA 3C5KA 2LXPC 4OGEA 1F62A 1HYJA 5DKAA 5FERA 2ECWA 4PPEA 4FO9A 3U5OA 2LXHC 5J3XA 4O64A 3HCSA 4AP4A 1BORA 2P57A 2JM3A 4MSXA 4N4FA 5TABA 2KWNA 2LRIC 3U5PA 3T9KA 1MM2A 2YUCA 2XEUA 2L0BA 4UP0A 3N9PA 5LKZA 3O37A 1Z6UA 3N9LA 2G45A 5SVIA 2D8SA 4GB0A 2EODA 3NG2A 5FB0A 4F52B 2VPGA 1FP0A 2LGGA 3O70A 2MNYA 3VK6A 4TKPB 4AYCA 2JRJA 2YQMA 5D1MB 2Y1NA 2MT5A 3MHHA 4WA6A 1HYIA 5B78A 4LJNA 2I50A 2FUUA 5JG6A 2CT2A 5H1VA 2KE1A 3M63A 5LKUA 1FBVA 2KREA 4A0CD 4L58A 4Z0OA 3SUBA 2KGGA 5KH7A 1WE9A 3O47A 4A4BA 2MA5A 2ECIA 1WILA 2NAAA 3N9NA 2QJ0A 2XOZA 2YVRA 5H1UA 3MDBC 4N3WA 3EB6A 2CSVA 4QF2A 4YBTA 3DPLR 3Q1DA 5SVXA 4UP5A 2LGLA 4IC2A 3KV5A 2XB1A 3KNVA 4I7BA 2LN0A 1WGMA 3PHDA 4CA1A 2L43A 2MIQA 4CCGX 2YSJA 2DSMA 2L75A 1T1HA 2C2VS 3HCUA 2VNFA 2QICA 3N9OA 4ZQLA 4X3GA 2YSMA 4YATA 3O7AA 2KFTA 3T7LA 5LKTA 2CKLA 5G04B 2ECNA 1WEWA 3LQHA 2F42A 3LRQA 3FAOA 3SOWA 2ECVA 2M3HA 3L11A 4S3OC 3FEHA 3ZNIA 3FL2A 2K4DA 4WZ2A 2VPDA 4WZ0A 4FJCA 2MD7B 1MBMA 1VFYA 3RPGB 2KIZA 3L1ZB 4PTBA 3LVRE 4Z0RA 2LDRA 2MA6A 1JM7A 1WEPA 2DJAA 2RI7A 3ZVYA 3LQJA 5EYAF 3ZTGA 3ZPV1 4BBQA 1VD4A 1G25A 4MVTA 4A4CA 5LCWB 1Z2QA 4WZ3B 4R2YA 2HYED 1X4IA 2KWOA 3PLWA 2PUYA 3PUQA 4H9DA 5B8DA 2OXQC 4GNDA 4I7DA 1WESA 4R7EA 2KKYA 3U5NA 3SOUA 2L5UA 1WFKA 4GNFA 2YW8A 1ZBDB 1K2FA 4FIPA 4FK5A 3LQIA 2CKLB 2FSAA 4LKAA 5B75A 3RPGC 5C13A 3ZYQA 1Z60A 2EGPA 2KWJA 4S3OB 3GV4A 2YYRA 5SVIB 3LJUX 4L7XA 4AYCB 1JM7B 2CSYA 2ECGA 1X4UA 4AUQB 2Y1MA 2KGIA 5KH3A 2LAUA 4QF3A 4YC9A 2D8UA 2EXUA 2OWAA 5KH9A 5DINA 1RMDA 2XOCA 2F6NA 4B86C 2B0OE 1WEQA 2G6QA
chains in the Genus database with same CATH topology
2E61A 3E2DA 4OGCA 2JUNA 3FJUB 3H7HA 2XOYA 3FM8C 3KDEC 2XP0A 3DWDA 1DCQA 4O62A 3LVQE 2LAUA 3LVRE 4F1PA 2EGMA 2MKEA 2P57A 2JM3A 2CONA 2FD4A 4Z0OA 4Z0RA 3SUBA 3O47A 3JUEA 3M7KA 3DDTA 2RR4A 3PLWA 2YREA 5K3QA 3T9KA 2DJAA 2IQJA 2D8UA 2EXUA 2OWAA 4H9DA 5SVYA 2CRRA 2XOZA 2YVRA 3MDBC 2CRWA 2KKXA 2XOCA 3LDYA 2CSVA 3FEHA 4QQ4A 4OGEA 2B0OE 5SVIB 2M13A 3LJUX 5SVIA 3Q1DA 2KKYA 5SVXA 2L7PA 2FFWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DDT A;  2CSV A;  2JUN A;  5K3Q A;  3Q1D A;  2DJA A;  2EGM A;  2D8U A;  2YVR A; 
#chains in the Genus database with same CATH topology
 3O36 A;  4ZDT A;  3QZV A;  2M85 A;  3IHP A;  4YAB A;  3FM8 C;  5D1K B;  3O35 A;  2VJE B;  4P5O B;  5B79 A;  5LKX A;  3ZVZ B;  2HDP A;  5AIT A;  1V87 A;  4W4U A;  3M62 A;  4YAD A;  4V3L C;  2LGV A;  2JMJ A;  2KYU A;  2PNX A;  4LAD B;  1WEV A;  2YHN A;  2XOY A;  1LDK C;  2ZET C;  4I7C A;  3V43 A;  3LVQ E;  3N9Q A;  2FD4 A;  3HCT A;  3M7K A;  2F6J A;  3KQI A;  2VJE A;  2CRR A;  4GNG A;  5FB1 A;  2KKX A;  4QQ4 A;  2M13 A;  2EA6 A;  3E2D A;  3KDE C;  2LGK A;  2Y43 A;  2RSD A;  1DCQ A;  2IDA A;  2E6S A;  2YHO A;  5TDR A;  2YUR A;  2BAY A;  2E6R A;  2G43 A;  2JMD A;  3DDT A;  4AVX A;  1IYM A;  2K17 A;  2M1R A;  3L1X A;  3C6W A;  2CRW A;  5H1T A;  4UI9 B;  3DQV R;  1WEN A;  2DX8 A;  2L7P A;  5B77 A;  2KWK A;  5TDW A;  2LV9 A;  2VP7 A;  3GL6 A;  3KV6 A;  3MHS A;  4B7Y C;  1XWH A;  4YBM A;  2FUI A;  2MKE A;  2YQL A;  3I2D A;  2UZG A;  5B76 A;  2KU3 A;  1X4J A;  2L80 A;  4XI1 A;  2AN6 A;  1WEE A;  5D1L B;  2H0D B;  2YT5 A;  3O34 A;  2JMI A;  4LK9 A;  5I3L A;  2E61 A;  4OGC A;  2JUN A;  2YU4 A;  1U6G B;  3DWD A;  3SHB A;  2QIZ A;  4O62 A;  1WIM A;  2ECT A;  3ZPV E;  2K16 A;  4V3K C;  2VJF A;  5TBN A;  3JUE A;  5G0F A;  5H9M A;  2RR4 A;  2MUM A;  4LLB A;  4IC3 A;  5C11 A;  2IQJ A;  1E4U A;  3LDY A;  1WEO A;  2FFW A;  3SOX A;  3N9M A;  2MNZ A;  3FAN A;  3RTR B;  2XP0 A;  4R8P K;  4F1P A;  2ECJ A;  2EGM A;  2K1J A;  2CON A;  4C9Z A;  1CHC A;  1N87 A;  3EB5 A;  2CSZ A;  2KR4 A;  4NN2 A;  2MD8 C;  1LDJ B;  2VPE A;  4BHW A;  2VJF B;  4A49 A;  5G05 B;  4ZUX U;  1WEU A;  3PUR A;  5FEY A;  3FJU B;  3H7H A;  2M6M A;  3T6R A;  4YAX A;  1DVP A;  2LQ6 A;  2H0D A;  4GNE A;  2C2L A;  3M99 A;  1MM3 A;  3ASL A;  4Q6F A;  2VPB A;  3HTK C;  1JOC A;  2YRE A;  5K3Q A;  3O33 A;  5TRB A;  1WEM A;  5SVY A;  3U5M A;  1VYX A;  5AIU A;  4YBS A;  3C5K A;  2LXP C;  4OGE A;  1F62 A;  1HYJ A;  5DKA A;  5FER A;  2ECW A;  4PPE A;  4FO9 A;  3U5O A;  2LXH C;  5J3X A;  4O64 A;  3HCS A;  4AP4 A;  1BOR A;  2P57 A;  2JM3 A;  4MSX A;  4N4F A;  5TAB A;  2KWN A;  2LRI C;  3U5P A;  3T9K A;  1MM2 A;  2YUC A;  2XEU A;  2L0B A;  4UP0 A;  3N9P A;  5LKZ A;  3O37 A;  1Z6U A;  3N9L A;  2G45 A;  5SVI A;  2D8S A;  4GB0 A;  2EOD A;  3NG2 A;  5FB0 A;  4F52 B;  2VPG A;  1FP0 A;  2LGG A;  3O70 A;  2MNY A;  3VK6 A;  4TKP B;  4AYC A;  2JRJ A;  2YQM A;  5D1M B;  2Y1N A;  2MT5 A;  3MHH A;  4WA6 A;  1HYI A;  5B78 A;  4LJN A;  2I50 A;  2FUU A;  5JG6 A;  2CT2 A;  5H1V A;  2KE1 A;  3M63 A;  5LKU A;  1FBV A;  2KRE A;  4A0C D;  4L58 A;  4Z0O A;  3SUB A;  2KGG A;  5KH7 A;  1WE9 A;  3O47 A;  4A4B A;  2MA5 A;  2ECI A;  1WIL A;  2NAA A;  3N9N A;  2QJ0 A;  2XOZ A;  2YVR A;  5H1U A;  3MDB C;  4N3W A;  3EB6 A;  2CSV A;  4QF2 A;  4YBT A;  3DPL R;  3Q1D A;  5SVX A;  4UP5 A;  2LGL A;  4IC2 A;  3KV5 A;  2XB1 A;  3KNV A;  4I7B A;  2LN0 A;  1WGM A;  3PHD A;  4CA1 A;  2L43 A;  2MIQ A;  4CCG X;  2YSJ A;  2DSM A;  2L75 A;  1T1H A;  2C2V S;  3HCU A;  2VNF A;  2QIC A;  3N9O A;  4ZQL A;  4X3G A;  2YSM A;  4YAT A;  3O7A A;  2KFT A;  3T7L A;  5LKT A;  2CKL A;  5G04 B;  2ECN A;  1WEW A;  3LQH A;  2F42 A;  3LRQ A;  3FAO A;  3SOW A;  2ECV A;  2M3H A;  3L11 A;  4S3O C;  3FEH A;  3ZNI A;  3FL2 A;  2K4D A;  4WZ2 A;  2VPD A;  4WZ0 A;  4FJC A;  2MD7 B;  1MBM A;  1VFY A;  3RPG B;  2KIZ A;  3L1Z B;  4PTB A;  3LVR E;  4Z0R A;  2LDR A;  2MA6 A;  1JM7 A;  1WEP A;  2DJA A;  2RI7 A;  3ZVY A;  3LQJ A;  5EYA F;  3ZTG A;  3ZPV 1;  4BBQ A;  1VD4 A;  1G25 A;  4MVT A;  4A4C A;  5LCW B;  1Z2Q A;  4WZ3 B;  4R2Y A;  2HYE D;  1X4I A;  2KWO A;  3PLW A;  2PUY A;  3PUQ A;  4H9D A;  5B8D A;  2OXQ C;  4GND A;  4I7D A;  1WES A;  4R7E A;  2KKY A;  3U5N A;  3SOU A;  2L5U A;  1WFK A;  4GNF A;  2YW8 A;  1ZBD B;  1K2F A;  4FIP A;  4FK5 A;  3LQI A;  2CKL B;  2FSA A;  4LKA A;  5B75 A;  3RPG C;  5C13 A;  3ZYQ A;  1Z60 A;  2EGP A;  2KWJ A;  4S3O B;  3GV4 A;  2YYR A;  5SVI B;  3LJU X;  4L7X A;  4AYC B;  1JM7 B;  2CSY A;  2ECG A;  1X4U A;  4AUQ B;  2Y1M A;  2KGI A;  5KH3 A;  2LAU A;  4QF3 A;  4YC9 A;  2D8U A;  2EXU A;  2OWA A;  5KH9 A;  5DIN A;  1RMD A;  2XOC A;  2F6N A;  4B86 C;  2B0O E;  1WEQ A;  2G6Q A; 
#chains in the Genus database with same CATH homology
 2E61 A;  3E2D A;  4OGC A;  2JUN A;  3FJU B;  3H7H A;  2XOY A;  3FM8 C;  3KDE C;  2XP0 A;  3DWD A;  1DCQ A;  4O62 A;  3LVQ E;  2LAU A;  3LVR E;  4F1P A;  2EGM A;  2MKE A;  2P57 A;  2JM3 A;  2CON A;  2FD4 A;  4Z0O A;  4Z0R A;  3SUB A;  3O47 A;  3JUE A;  3M7K A;  3DDT A;  2RR4 A;  3PLW A;  2YRE A;  5K3Q A;  3T9K A;  2DJA A;  2IQJ A;  2D8U A;  2EXU A;  2OWA A;  4H9D A;  5SVY A;  2CRR A;  2XOZ A;  2YVR A;  3MDB C;  2CRW A;  2KKX A;  2XOC A;  3LDY A;  2CSV A;  3FEH A;  4QQ4 A;  4OGE A;  2B0O E;  5SVI B;  2M13 A;  3LJU X;  5SVI A;  3Q1D A;  2KKY A;  5SVX A;  2L7P A;  2FFW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...