3DDTA

Crystal structure of the b2 box from murf1 in dimeric state
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
48
structure length
48
Chain Sequence
GAMGSHPMCKEHEDEKINIYCLTCEVPTCSMCKVFGIHKACEVAPLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase TRIM63
publication title Structural analysis of B-Box 2 from MuRF1: identification of a novel self-association pattern in a RING-like fold
pubmed doi rcsb
source organism Homo sapiens
total genus 10
structure length 48
sequence length 48
chains with identical sequence B, C
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2008-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00643 zf-B_box B-box zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.200 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 3ddtA00
3Q1DA 2D8UA 2CSVA 2YVRA 3DDTA 2JUNA 2DJAA 2EGMA 5K3QA
chains in the Genus database with same CATH superfamily
2FSAA 3GL6A 2YSMA 3LQHA 1E4UA 3HCUA 1FBVA 3DWDA 5FB0A 2H0DA 2MA5A 2YUCA 2YQMA 3NG2A 2CSVA 4A4CA 2YHNA 3O34A 2F6JA 2ECGA 4QF2A 3M7KA 4A0CD 1IYMA 1WEMA 2KFTA 2VJEB 3N9QA 5LCWB 4S3OB 2YW8A 2HDPA 1Z60A 3VK6A 5SVXA 5H1UA 1VYXA 2VJFB 4YADA 2KKXA 2KKYA 2PNXA 2LQ6A 4YBSA 4YATA 2C2LA 2DSMA 5G04B 2L80A 3DPLR 4LJNA 3ZVZB 1XWHA 4Z0OA 3T9KA 5KH7A 3SOXA 5G0FA 4AP4A 3MHHA 2MD7B 5C11A 1WEOA 2MD8C 3EB6A 3O37A 2ECIA 2K17A 2VNFA 1WEEA 2EODA 4YABA 5SVYA 2M3HA 1F62A 4I7BA 3M63A 1V87A 2E6SA 2LDRA 3KDEC 1JM7A 3U5PA 3N9OA 4LLBA 2K4DA 1MM2A 3C5KA 4MVTA 3ZNIA 2M13A 2ZETC 4C9ZA 2XEUA 2KGIA 3LDYA 3QZVA 3I2DA 2KGGA 2KYUA 1WE9A 1HYIA 3HTKC 2RR4A 4AYCA 4L7XA 3LJUX 2MNZA 3PHDA 5B77A 4WZ2A 3ZTGA 3HCTA 4YC9A 2EGPA 5K3QA 2KIZA 3KV6A 3FANA 2F42A 3EB5A 3L11A 5B79A 2BAYA 5D1LB 5H9MA 1RMDA 3N9NA 2HYED 2OXQC 4LK9A 3PUQA 4YBTA 4GNDA 2RI7A 4R8PK 2Y1MA 2M85A 4WZ0A 4R7EA 2FUUA 1WEWA 3U5MA 2KWNA 5B75A 1G25A 5DKAA 2KWOA 2IQJA 3O7AA 2IDAA 2M1RA 4LADB 4OGEA 3M99A 5TDRA 3V43A 3FEHA 5TRBA 3ASLA 4GNEA 5AITA 2VPEA 4ZUXU 2UZGA 2JM3A 3ZYQA 4B7YC 2DJAA 2YT5A 2LGKA 2MA6A 4BBQA 3N9PA 2D8SA 3LQJA 4I7CA 2K16A 3O70A 3ZVYA 4NN2A 4Z0RA 4Q6FA 2LXPC 2LV9A 3HCSA 2PUYA 4UP0A 4V3LC 2KWKA 2MKEA 2XOZA 1N87A 2XOYA 5DINA 2P57A 4PTBA 1X4UA 3RPGC 2XOCA 2JMIA 2CSYA 3T6RA 1U6GB 2FUIA 4LKAA 4X3GA 1MBMA 5SVIB 5JG6A 2VPGA 2JMDA 2LRIC 1VD4A 2VJEA 4A4BA 1VFYA 3U5NA 5TDWA 5H1VA 2I50A 4H9DA 2FD4A 3FAOA 4WZ3B 5LKXA 2CSZA 3N9LA 3KNVA 3N9MA 2CT2A 4OGCA 2VJFA 1CHCA 2OWAA 4FO9A 2G6QA 2Y1NA 3PURA 5FB1A 3Q1DA 2YVRA 4CA1A 3H7HA 4CCGX 2H0DB 2QJ0A 3MDBC 5B78A 3LQIA 2MIQA 3SHBA 4GB0A 5D1KB 4YBMA 1HYJA 2ECVA 3U5OA 2VP7A 1Z2QA 1WEVA 3MHSA 2KU3A 5LKUA 2XB1A 3T7LA 5J3XA 2YQLA 4GNGA 4GNFA 5EYAF 3ZPV1 2XP0A 3PLWA 4R2YA 2B0OE 2CRRA 2QICA 3E2DA 1Z6UA 1WEPA 2DX8A 2K1JA 2KWJA 2RSDA 5AIUA 3FJUB 4IC2A 1BORA 4WA6A 2EGMA 2E6RA 4O62A 2YYRA 5FERA 1JOCA 1LDJB 2L5UA 5D1MB 3LRQA 4I7DA 4S3OC 2FFWA 3FL2A 2L7PA 1T1HA 4YAXA 4FIPA 3SOUA 5TBNA 4V3KC 4N4FA 4AUQB 1WIMA 2ECTA 4F52B 3SOWA 4ZQLA 2VPDA 2MNYA 3L1ZB 5I3LA 1JM7B 2JMJA 2L75A 2KR4A 3O33A 4UP5A 4FJCA 4P5OB 1FP0A 3L1XA 3RTRB 2AN6A 3ZPVE 2QIZA 1MM3A 2CRWA 2CKLB 4QF3A 3O36A 5TABA 3LVQE 2D8UA 5B8DA 4W4UA 4TKPB 5C13A 3DDTA 3KV5A 4AYCB 2EXUA 5H1TA 3RPGB 3JUEA 2KREA 4XI1A 4ZDTA 2YREA 2ECJA 1X4JA 1WILA 4BHWA 2MT5A 2NAAA 1WGMA 5KH3A 2E61A 3DQVR 4PPEA 2LGVA 2YURA 4MSXA 5LKZA 3IHPA 2L0BA 3C6WA 2CONA 4UI9B 5KH9A 1DVPA 2JRJA 3GV4A 1WEQA 3LVRE 2VPBA 2LN0A 1DCQA 2M6MA 2L43A 2KE1A 2EA6A 3O35A 2LAUA 3M62A 2C2VS 2MUMA 1X4IA 2ECWA 4IC3A 1ZBDB 3KQIA 2CKLA 2YHOA 2Y43A 2G45A 4B86C 2F6NA 3O47A 2LGLA 1WFKA 1LDKC 2JUNA 4FK5A 5SVIA 2YU4A 1WESA 5G05B 4F1PA 2G43A 2LXHC 3FM8C 3SUBA 4O64A 4QQ4A 1WENA 2YSJA 4N3WA 2LGGA 4AVXA 4L58A 5B76A 2ECNA 1K2FA 4A49A 5LKTA 1WEUA 5FEYA
chains in the Genus database with same CATH topology
1DCQA 3FEHA 2RR4A 3JUEA 2MKEA 3LJUX 5SVXA 2XOZA 4H9DA 2FD4A 3MDBC 2XOYA 4F1PA 2YREA 2P57A 3DWDA 2FFWA 2LAUA 2JM3A 2M13A 2L7PA 3FM8C 3T9KA 2XOCA 2XP0A 2KKXA 2KKYA 3PLWA 2DJAA 4OGCA 2CRRA 2B0OE 3E2DA 5K3QA 3SUBA 4QQ4A 2CSVA 2CRWA 2IQJA 2E61A 3LVQE 2OWAA 3LDYA 3FJUB 2D8UA 5SVYA 2EGMA 4O62A 3M7KA 4OGEA 3O47A 3Q1DA 4Z0RA 2YVRA 4Z0OA 2CONA 3DDTA 5SVIB 2JUNA 2EXUA 3KDEC 3LVRE 5SVIA 3H7HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q1D A;  2D8U A;  2CSV A;  2YVR A;  3DDT A;  2JUN A;  2DJA A;  2EGM A;  5K3Q A; 
#chains in the Genus database with same CATH topology
 2FSA A;  3GL6 A;  2YSM A;  3LQH A;  1E4U A;  3HCU A;  1FBV A;  3DWD A;  5FB0 A;  2H0D A;  2MA5 A;  2YUC A;  2YQM A;  3NG2 A;  2CSV A;  4A4C A;  2YHN A;  3O34 A;  2F6J A;  2ECG A;  4QF2 A;  3M7K A;  4A0C D;  1IYM A;  1WEM A;  2KFT A;  2VJE B;  3N9Q A;  5LCW B;  4S3O B;  2YW8 A;  2HDP A;  1Z60 A;  3VK6 A;  5SVX A;  5H1U A;  1VYX A;  2VJF B;  4YAD A;  2KKX A;  2KKY A;  2PNX A;  2LQ6 A;  4YBS A;  4YAT A;  2C2L A;  2DSM A;  5G04 B;  2L80 A;  3DPL R;  4LJN A;  3ZVZ B;  1XWH A;  4Z0O A;  3T9K A;  5KH7 A;  3SOX A;  5G0F A;  4AP4 A;  3MHH A;  2MD7 B;  5C11 A;  1WEO A;  2MD8 C;  3EB6 A;  3O37 A;  2ECI A;  2K17 A;  2VNF A;  1WEE A;  2EOD A;  4YAB A;  5SVY A;  2M3H A;  1F62 A;  4I7B A;  3M63 A;  1V87 A;  2E6S A;  2LDR A;  3KDE C;  1JM7 A;  3U5P A;  3N9O A;  4LLB A;  2K4D A;  1MM2 A;  3C5K A;  4MVT A;  3ZNI A;  2M13 A;  2ZET C;  4C9Z A;  2XEU A;  2KGI A;  3LDY A;  3QZV A;  3I2D A;  2KGG A;  2KYU A;  1WE9 A;  1HYI A;  3HTK C;  2RR4 A;  4AYC A;  4L7X A;  3LJU X;  2MNZ A;  3PHD A;  5B77 A;  4WZ2 A;  3ZTG A;  3HCT A;  4YC9 A;  2EGP A;  5K3Q A;  2KIZ A;  3KV6 A;  3FAN A;  2F42 A;  3EB5 A;  3L11 A;  5B79 A;  2BAY A;  5D1L B;  5H9M A;  1RMD A;  3N9N A;  2HYE D;  2OXQ C;  4LK9 A;  3PUQ A;  4YBT A;  4GND A;  2RI7 A;  4R8P K;  2Y1M A;  2M85 A;  4WZ0 A;  4R7E A;  2FUU A;  1WEW A;  3U5M A;  2KWN A;  5B75 A;  1G25 A;  5DKA A;  2KWO A;  2IQJ A;  3O7A A;  2IDA A;  2M1R A;  4LAD B;  4OGE A;  3M99 A;  5TDR A;  3V43 A;  3FEH A;  5TRB A;  3ASL A;  4GNE A;  5AIT A;  2VPE A;  4ZUX U;  2UZG A;  2JM3 A;  3ZYQ A;  4B7Y C;  2DJA A;  2YT5 A;  2LGK A;  2MA6 A;  4BBQ A;  3N9P A;  2D8S A;  3LQJ A;  4I7C A;  2K16 A;  3O70 A;  3ZVY A;  4NN2 A;  4Z0R A;  4Q6F A;  2LXP C;  2LV9 A;  3HCS A;  2PUY A;  4UP0 A;  4V3L C;  2KWK A;  2MKE A;  2XOZ A;  1N87 A;  2XOY A;  5DIN A;  2P57 A;  4PTB A;  1X4U A;  3RPG C;  2XOC A;  2JMI A;  2CSY A;  3T6R A;  1U6G B;  2FUI A;  4LKA A;  4X3G A;  1MBM A;  5SVI B;  5JG6 A;  2VPG A;  2JMD A;  2LRI C;  1VD4 A;  2VJE A;  4A4B A;  1VFY A;  3U5N A;  5TDW A;  5H1V A;  2I50 A;  4H9D A;  2FD4 A;  3FAO A;  4WZ3 B;  5LKX A;  2CSZ A;  3N9L A;  3KNV A;  3N9M A;  2CT2 A;  4OGC A;  2VJF A;  1CHC A;  2OWA A;  4FO9 A;  2G6Q A;  2Y1N A;  3PUR A;  5FB1 A;  3Q1D A;  2YVR A;  4CA1 A;  3H7H A;  4CCG X;  2H0D B;  2QJ0 A;  3MDB C;  5B78 A;  3LQI A;  2MIQ A;  3SHB A;  4GB0 A;  5D1K B;  4YBM A;  1HYJ A;  2ECV A;  3U5O A;  2VP7 A;  1Z2Q A;  1WEV A;  3MHS A;  2KU3 A;  5LKU A;  2XB1 A;  3T7L A;  5J3X A;  2YQL A;  4GNG A;  4GNF A;  5EYA F;  3ZPV 1;  2XP0 A;  3PLW A;  4R2Y A;  2B0O E;  2CRR A;  2QIC A;  3E2D A;  1Z6U A;  1WEP A;  2DX8 A;  2K1J A;  2KWJ A;  2RSD A;  5AIU A;  3FJU B;  4IC2 A;  1BOR A;  4WA6 A;  2EGM A;  2E6R A;  4O62 A;  2YYR A;  5FER A;  1JOC A;  1LDJ B;  2L5U A;  5D1M B;  3LRQ A;  4I7D A;  4S3O C;  2FFW A;  3FL2 A;  2L7P A;  1T1H A;  4YAX A;  4FIP A;  3SOU A;  5TBN A;  4V3K C;  4N4F A;  4AUQ B;  1WIM A;  2ECT A;  4F52 B;  3SOW A;  4ZQL A;  2VPD A;  2MNY A;  3L1Z B;  5I3L A;  1JM7 B;  2JMJ A;  2L75 A;  2KR4 A;  3O33 A;  4UP5 A;  4FJC A;  4P5O B;  1FP0 A;  3L1X A;  3RTR B;  2AN6 A;  3ZPV E;  2QIZ A;  1MM3 A;  2CRW A;  2CKL B;  4QF3 A;  3O36 A;  5TAB A;  3LVQ E;  2D8U A;  5B8D A;  4W4U A;  4TKP B;  5C13 A;  3DDT A;  3KV5 A;  4AYC B;  2EXU A;  5H1T A;  3RPG B;  3JUE A;  2KRE A;  4XI1 A;  4ZDT A;  2YRE A;  2ECJ A;  1X4J A;  1WIL A;  4BHW A;  2MT5 A;  2NAA A;  1WGM A;  5KH3 A;  2E61 A;  3DQV R;  4PPE A;  2LGV A;  2YUR A;  4MSX A;  5LKZ A;  3IHP A;  2L0B A;  3C6W A;  2CON A;  4UI9 B;  5KH9 A;  1DVP A;  2JRJ A;  3GV4 A;  1WEQ A;  3LVR E;  2VPB A;  2LN0 A;  1DCQ A;  2M6M A;  2L43 A;  2KE1 A;  2EA6 A;  3O35 A;  2LAU A;  3M62 A;  2C2V S;  2MUM A;  1X4I A;  2ECW A;  4IC3 A;  1ZBD B;  3KQI A;  2CKL A;  2YHO A;  2Y43 A;  2G45 A;  4B86 C;  2F6N A;  3O47 A;  2LGL A;  1WFK A;  1LDK C;  2JUN A;  4FK5 A;  5SVI A;  2YU4 A;  1WES A;  5G05 B;  4F1P A;  2G43 A;  2LXH C;  3FM8 C;  3SUB A;  4O64 A;  4QQ4 A;  1WEN A;  2YSJ A;  4N3W A;  2LGG A;  4AVX A;  4L58 A;  5B76 A;  2ECN A;  1K2F A;  4A49 A;  5LKT A;  1WEU A;  5FEY A; 
#chains in the Genus database with same CATH homology
 1DCQ A;  3FEH A;  2RR4 A;  3JUE A;  2MKE A;  3LJU X;  5SVX A;  2XOZ A;  4H9D A;  2FD4 A;  3MDB C;  2XOY A;  4F1P A;  2YRE A;  2P57 A;  3DWD A;  2FFW A;  2LAU A;  2JM3 A;  2M13 A;  2L7P A;  3FM8 C;  3T9K A;  2XOC A;  2XP0 A;  2KKX A;  2KKY A;  3PLW A;  2DJA A;  4OGC A;  2CRR A;  2B0O E;  3E2D A;  5K3Q A;  3SUB A;  4QQ4 A;  2CSV A;  2CRW A;  2IQJ A;  2E61 A;  3LVQ E;  2OWA A;  3LDY A;  3FJU B;  2D8U A;  5SVY A;  2EGM A;  4O62 A;  3M7K A;  4OGE A;  3O47 A;  3Q1D A;  4Z0R A;  2YVR A;  4Z0O A;  2CON A;  3DDT A;  5SVI B;  2JUN A;  2EXU A;  3KDE C;  3LVR E;  5SVI A;  3H7H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...