3DDTA

Crystal structure of the b2 box from murf1 in dimeric state
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
48
structure length
48
Chain Sequence
GAMGSHPMCKEHEDEKINIYCLTCEVPTCSMCKVFGIHKACEVAPLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase TRIM63
publication title Structural analysis of B-Box 2 from MuRF1: identification of a novel self-association pattern in a RING-like fold
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 10
structure length 48
sequence length 48
chains with identical sequence B, C
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2008-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00643 zf-B_box B-box zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.200 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 3ddtA00
2YVRA 2EGMA 2CSVA 3DDTA 2D8UA 5K3QA 2DJAA 2JUNA 3Q1DA
chains in the Genus database with same CATH superfamily
4B86C 1WEEA 3HCUA 3MHSA 4LK9A 1WGMA 2CSYA 3QZVA 4Z0OA 2LQ6A 3O34A 2G6QA 3V43A 3LVRE 2FUIA 3ZVYA 2KGIA 2UZGA 3PHDA 4CCGX 2G45A 4PTBA 1MM2A 3LDYA 1FBVA 2KWOA 3VK6A 3C6WA 2XOYA 1IYMA 2YT5A 2LV9A 2AN6A 2H0DB 4UP5A 2YHOA 4F1PA 2DJAA 3KQIA 4FIPA 2YSJA 5SVIA 5D1LB 3U5NA 2JUNA 2E61A 1X4IA 4TKPB 2EXUA 2LGVA 3T7LA 5K3QA 1VYXA 1WFKA 1WESA 3E2DA 2KE1A 4MSXA 3LQIA 5FEYA 3O36A 5B77A 3LVQE 2KWJA 5EYAF 4IC2A 2YURA 2VJFA 2L75A 2MNYA 2LXHC 3KDEC 3DQVR 2KR4A 2XB1A 5C13A 2B0OE 1WIMA 4OGEA 3L1ZB 3N9NA 1X4UA 4C9ZA 4MVTA 4OGCA 2LGGA 4ZQLA 4A4CA 1CHCA 4R7EA 1WEUA 2ECTA 3N9OA 2LRIC 5H9MA 1U6GB 2KGGA 1WEOA 4ZDTA 2XEUA 3T6RA 5LKTA 4O64A 3RPGC 4QF3A 5FB1A 4S3OB 2MIQA 2KWNA 4V3KC 2RSDA 2KYUA 1T1HA 3U5MA 1VD4A 3LJUX 4CA1A 4NN2A 5B75A 3FL2A 4IC3A 4L7XA 4P5OB 5SVIB 2VPEA 3O35A 4AUQB 2HDPA 5I3LA 2DSMA 1FP0A 1Z2QA 2CRRA 4W4UA 2VJFB 3M62A 2HYED 5LKXA 4L58A 1WEQA 3FM8C 5JG6A 3U5OA 2M3HA 4I7BA 4YABA 3ZPVE 2YSMA 2ECGA 5G05B 2VPBA 3L11A 5DINA 3GV4A 4UI9B 4PPEA 3GL6A 2VJEA 4GB0A 1MBMA 3N9LA 3IHPA 5TBNA 1F62A 3O37A 2M85A 2G43A 2M6MA 4YAXA 3ZYQA 3FEHA 5SVXA 5KH7A 2BAYA 4BHWA 2EA6A 2FFWA 2D8SA 1WE9A 5LCWB 2XP0A 3U5PA 5B79A 2L0BA 3MDBC 2LXPC 5B8DA 5AIUA 1ZBDB 2K4DA 4B7YC 2EGPA 5G0FA 3LRQA 5AITA 2JMJA 3LQJA 2DX8A 2ECVA 2Y1MA 4FK5A 2LGLA 3PLWA 5H1UA 2L80A 3LQHA 4LADB 3N9QA 1VFYA 2MT5A 3NG2A 2VNFA 3M7KA 1HYIA 4A4BA 2K1JA 5H1TA 2M1RA 2IQJA 3EB6A 3ZNIA 2CSVA 2D8UA 3H7HA 1JM7A 3T9KA 5TDWA 2KIZA 2KREA 1BORA 2C2LA 2JMIA 4AP4A 1WEPA 5LKUA 4YADA 5D1MB 2VJEB 2P57A 2F6JA 5TRBA 3RPGB 2XOZA 3N9PA 2OXQC 2L43A 4ZUXU 4N4FA 3PURA 2CRWA 3DDTA 4X3GA 3JUEA 3ZPV1 1DCQA 4UP0A 2PNXA 2IDAA 5D1KB 3KV5A 3KV6A 4YATA 3PUQA 2CSZA 2LN0A 4QF2A 5SVYA 4AYCA 1WILA 2KKXA 4YBSA 4GNFA 1XWHA 2JRJA 4WZ0A 2L7PA 1JOCA 4H9DA 4S3OC 2LDRA 1N87A 3SHBA 2JM3A 1JM7B 5FERA 3DPLR 2I50A 2VPGA 4I7DA 2K16A 3L1XA 3FANA 3SOWA 5FB0A 2K17A 2VPDA 3SOUA 1MM3A 1Z60A 2FSAA 2MKEA 4R2YA 5G04B 4FJCA 5H1VA 1WEWA 2C2VS 5KH9A 3SUBA 3O47A 2VP7A 1WEVA 2QICA 1LDKC 2RR4A 2EODA 4QQ4A 2YHNA 2F42A 2F6NA 2MNZA 2E6SA 1HYJA 2LGKA 4AYCB 3ZTGA 1X4JA 3Q1DA 4YBTA 3ZVZB 3M99A 2M13A 2Y1NA 2OWAA 2KU3A 1WEMA 3HCSA 5KH3A 3ASLA 4WZ3B 2ECNA 2YQLA 2KFTA 2FD4A 4GNDA 3FAOA 1Z6UA 2CKLA 3HTKC 1G25A 3O70A 2ZETC 1RMDA 3N9MA 4YC9A 2YQMA 4BBQA 2QIZA 3EB5A 5J3XA 4R8PK 4O62A 3M63A 2EGMA 2KKYA 1E4UA 3O7AA 5TDRA 2L5UA 2YUCA 4LKAA 2NAAA 2YU4A 3FJUB 2RI7A 4AVXA 5DKAA 1K2FA 2E6RA 5B78A 1V87A 4FO9A 4YBMA 2YVRA 5TABA 3KNVA 2FUUA 4A0CD 3I2DA 3SOXA 4Q6FA 4LLBA 2YW8A 4WA6A 4GNEA 2MD8C 2ECIA 3C5KA 2KWKA 2YYRA 2H0DA 2YREA 2XOCA 5C11A 3RTRB 2JMDA 2MA6A 2MA5A 2CKLB 1WENA 4N3WA 4I7CA 3O33A 4XI1A 2LAUA 2MD7B 2QJ0A 4LJNA 4F52B 2ECWA 5LKZA 4GNGA 3DWDA 4WZ2A 2CONA 2MUMA 2PUYA 1LDJB 5B76A 2ECJA 3MHHA 4Z0RA 2Y43A 2CT2A 4A49A 3HCTA 1DVPA 4V3LC
chains in the Genus database with same CATH topology
2YVRA 2KKXA 3M7KA 2XP0A 2LAUA 4O62A 4QQ4A 2DJAA 4F1PA 2XOZA 3MDBC 2FD4A 3KDEC 2CRRA 2IQJA 2B0OE 2EGMA 4OGEA 4Z0OA 2KKYA 2CRWA 2CSVA 2D8UA 3DDTA 3DWDA 3H7HA 2L7PA 3JUEA 5SVIA 3T9KA 1DCQA 2JUNA 2CONA 2E61A 3LVRE 3Q1DA 2EXUA 4OGCA 4H9DA 3FM8C 2MKEA 4Z0RA 3LJUX 3FJUB 5K3QA 3FEHA 5SVXA 3LDYA 3E2DA 2YREA 2JM3A 2P57A 5SVYA 2XOCA 3PLWA 2M13A 2XOYA 5SVIB 3SUBA 3O47A 3LVQE 2OWAA 2FFWA 2RR4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YVR A;  2EGM A;  2CSV A;  3DDT A;  2D8U A;  5K3Q A;  2DJA A;  2JUN A;  3Q1D A; 
#chains in the Genus database with same CATH topology
 4B86 C;  1WEE A;  3HCU A;  3MHS A;  4LK9 A;  1WGM A;  2CSY A;  3QZV A;  4Z0O A;  2LQ6 A;  3O34 A;  2G6Q A;  3V43 A;  3LVR E;  2FUI A;  3ZVY A;  2KGI A;  2UZG A;  3PHD A;  4CCG X;  2G45 A;  4PTB A;  1MM2 A;  3LDY A;  1FBV A;  2KWO A;  3VK6 A;  3C6W A;  2XOY A;  1IYM A;  2YT5 A;  2LV9 A;  2AN6 A;  2H0D B;  4UP5 A;  2YHO A;  4F1P A;  2DJA A;  3KQI A;  4FIP A;  2YSJ A;  5SVI A;  5D1L B;  3U5N A;  2JUN A;  2E61 A;  1X4I A;  4TKP B;  2EXU A;  2LGV A;  3T7L A;  5K3Q A;  1VYX A;  1WFK A;  1WES A;  3E2D A;  2KE1 A;  4MSX A;  3LQI A;  5FEY A;  3O36 A;  5B77 A;  3LVQ E;  2KWJ A;  5EYA F;  4IC2 A;  2YUR A;  2VJF A;  2L75 A;  2MNY A;  2LXH C;  3KDE C;  3DQV R;  2KR4 A;  2XB1 A;  5C13 A;  2B0O E;  1WIM A;  4OGE A;  3L1Z B;  3N9N A;  1X4U A;  4C9Z A;  4MVT A;  4OGC A;  2LGG A;  4ZQL A;  4A4C A;  1CHC A;  4R7E A;  1WEU A;  2ECT A;  3N9O A;  2LRI C;  5H9M A;  1U6G B;  2KGG A;  1WEO A;  4ZDT A;  2XEU A;  3T6R A;  5LKT A;  4O64 A;  3RPG C;  4QF3 A;  5FB1 A;  4S3O B;  2MIQ A;  2KWN A;  4V3K C;  2RSD A;  2KYU A;  1T1H A;  3U5M A;  1VD4 A;  3LJU X;  4CA1 A;  4NN2 A;  5B75 A;  3FL2 A;  4IC3 A;  4L7X A;  4P5O B;  5SVI B;  2VPE A;  3O35 A;  4AUQ B;  2HDP A;  5I3L A;  2DSM A;  1FP0 A;  1Z2Q A;  2CRR A;  4W4U A;  2VJF B;  3M62 A;  2HYE D;  5LKX A;  4L58 A;  1WEQ A;  3FM8 C;  5JG6 A;  3U5O A;  2M3H A;  4I7B A;  4YAB A;  3ZPV E;  2YSM A;  2ECG A;  5G05 B;  2VPB A;  3L11 A;  5DIN A;  3GV4 A;  4UI9 B;  4PPE A;  3GL6 A;  2VJE A;  4GB0 A;  1MBM A;  3N9L A;  3IHP A;  5TBN A;  1F62 A;  3O37 A;  2M85 A;  2G43 A;  2M6M A;  4YAX A;  3ZYQ A;  3FEH A;  5SVX A;  5KH7 A;  2BAY A;  4BHW A;  2EA6 A;  2FFW A;  2D8S A;  1WE9 A;  5LCW B;  2XP0 A;  3U5P A;  5B79 A;  2L0B A;  3MDB C;  2LXP C;  5B8D A;  5AIU A;  1ZBD B;  2K4D A;  4B7Y C;  2EGP A;  5G0F A;  3LRQ A;  5AIT A;  2JMJ A;  3LQJ A;  2DX8 A;  2ECV A;  2Y1M A;  4FK5 A;  2LGL A;  3PLW A;  5H1U A;  2L80 A;  3LQH A;  4LAD B;  3N9Q A;  1VFY A;  2MT5 A;  3NG2 A;  2VNF A;  3M7K A;  1HYI A;  4A4B A;  2K1J A;  5H1T A;  2M1R A;  2IQJ A;  3EB6 A;  3ZNI A;  2CSV A;  2D8U A;  3H7H A;  1JM7 A;  3T9K A;  5TDW A;  2KIZ A;  2KRE A;  1BOR A;  2C2L A;  2JMI A;  4AP4 A;  1WEP A;  5LKU A;  4YAD A;  5D1M B;  2VJE B;  2P57 A;  2F6J A;  5TRB A;  3RPG B;  2XOZ A;  3N9P A;  2OXQ C;  2L43 A;  4ZUX U;  4N4F A;  3PUR A;  2CRW A;  3DDT A;  4X3G A;  3JUE A;  3ZPV 1;  1DCQ A;  4UP0 A;  2PNX A;  2IDA A;  5D1K B;  3KV5 A;  3KV6 A;  4YAT A;  3PUQ A;  2CSZ A;  2LN0 A;  4QF2 A;  5SVY A;  4AYC A;  1WIL A;  2KKX A;  4YBS A;  4GNF A;  1XWH A;  2JRJ A;  4WZ0 A;  2L7P A;  1JOC A;  4H9D A;  4S3O C;  2LDR A;  1N87 A;  3SHB A;  2JM3 A;  1JM7 B;  5FER A;  3DPL R;  2I50 A;  2VPG A;  4I7D A;  2K16 A;  3L1X A;  3FAN A;  3SOW A;  5FB0 A;  2K17 A;  2VPD A;  3SOU A;  1MM3 A;  1Z60 A;  2FSA A;  2MKE A;  4R2Y A;  5G04 B;  4FJC A;  5H1V A;  1WEW A;  2C2V S;  5KH9 A;  3SUB A;  3O47 A;  2VP7 A;  1WEV A;  2QIC A;  1LDK C;  2RR4 A;  2EOD A;  4QQ4 A;  2YHN A;  2F42 A;  2F6N A;  2MNZ A;  2E6S A;  1HYJ A;  2LGK A;  4AYC B;  3ZTG A;  1X4J A;  3Q1D A;  4YBT A;  3ZVZ B;  3M99 A;  2M13 A;  2Y1N A;  2OWA A;  2KU3 A;  1WEM A;  3HCS A;  5KH3 A;  3ASL A;  4WZ3 B;  2ECN A;  2YQL A;  2KFT A;  2FD4 A;  4GND A;  3FAO A;  1Z6U A;  2CKL A;  3HTK C;  1G25 A;  3O70 A;  2ZET C;  1RMD A;  3N9M A;  4YC9 A;  2YQM A;  4BBQ A;  2QIZ A;  3EB5 A;  5J3X A;  4R8P K;  4O62 A;  3M63 A;  2EGM A;  2KKY A;  1E4U A;  3O7A A;  5TDR A;  2L5U A;  2YUC A;  4LKA A;  2NAA A;  2YU4 A;  3FJU B;  2RI7 A;  4AVX A;  5DKA A;  1K2F A;  2E6R A;  5B78 A;  1V87 A;  4FO9 A;  4YBM A;  2YVR A;  5TAB A;  3KNV A;  2FUU A;  4A0C D;  3I2D A;  3SOX A;  4Q6F A;  4LLB A;  2YW8 A;  4WA6 A;  4GNE A;  2MD8 C;  2ECI A;  3C5K A;  2KWK A;  2YYR A;  2H0D A;  2YRE A;  2XOC A;  5C11 A;  3RTR B;  2JMD A;  2MA6 A;  2MA5 A;  2CKL B;  1WEN A;  4N3W A;  4I7C A;  3O33 A;  4XI1 A;  2LAU A;  2MD7 B;  2QJ0 A;  4LJN A;  4F52 B;  2ECW A;  5LKZ A;  4GNG A;  3DWD A;  4WZ2 A;  2CON A;  2MUM A;  2PUY A;  1LDJ B;  5B76 A;  2ECJ A;  3MHH A;  4Z0R A;  2Y43 A;  2CT2 A;  4A49 A;  3HCT A;  1DVP A;  4V3L C; 
#chains in the Genus database with same CATH homology
 2YVR A;  2KKX A;  3M7K A;  2XP0 A;  2LAU A;  4O62 A;  4QQ4 A;  2DJA A;  4F1P A;  2XOZ A;  3MDB C;  2FD4 A;  3KDE C;  2CRR A;  2IQJ A;  2B0O E;  2EGM A;  4OGE A;  4Z0O A;  2KKY A;  2CRW A;  2CSV A;  2D8U A;  3DDT A;  3DWD A;  3H7H A;  2L7P A;  3JUE A;  5SVI A;  3T9K A;  1DCQ A;  2JUN A;  2CON A;  2E61 A;  3LVR E;  3Q1D A;  2EXU A;  4OGC A;  4H9D A;  3FM8 C;  2MKE A;  4Z0R A;  3LJU X;  3FJU B;  5K3Q A;  3FEH A;  5SVX A;  3LDY A;  3E2D A;  2YRE A;  2JM3 A;  2P57 A;  5SVY A;  2XOC A;  3PLW A;  2M13 A;  2XOY A;  5SVI B;  3SUB A;  3O47 A;  3LVQ E;  2OWA A;  2FFW A;  2RR4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...