2K4DA

E2-c-cbl recognition is necessary but not sufficient for ubiquitination activity
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
83
structure length
83
Chain Sequence
GSLQDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCRCEIKGTEPIVVDPFDPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title E2-c-Cbl recognition is necessary but not sufficient for ubiquitination activity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase CBL
total genus 9
structure length 83
sequence length 83
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2008-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14447 Prok-RING_4 Prokaryotic RING finger family 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2k4dA01
5J3XA 2PNXA 4YC9A 3RPGC 1CHCA 2H0DA 1WESA 2CT2A 2ECGA 5LKZA 2I50A 5AITA 1JM7B 4AYCB 2FUUA 1WIMA 3VK6A 4ZDTA 2CSYA 2LRIC 5B75A 3L1ZB 2KWNA 2IDAA 3U5NA 1WILA 3KV6A 3T7LA 3GL6A 5B79A 5TDRA 2F6NA 4GNGA 2K17A 1Z6UA 1WGMA 5AIUA 1WEVA 5G04B 4NN2A 4WZ3B 2HYED 4PTBA 3RPGB 2M6MA 2FSAA 4CA1A 5H9MA 3I2DA 3FL2A 3L11A 1X4UA 1VFYA 2YSMA 1WENA 3HCSA 4MVTA 2L43A 1X4IA 3EB5A 2LXHC 3N9PA 4I7DA 4FIPA 1G25A 5B77A 2YUCA 3M63A 2C2VS 2YQLA 5B78A 5B76A 1Z60A 4V3LC 4R8PK 1F62A 2MT5A 5B8DA 4S3OC 2ECWA 2M85A 4B86C 2MA6A 3O70A 5H1TA 2G6QA 2EGPA 4QF2A 4YBSA 3HCUA 1XWHA 3O34A 2LGGA 2ECNA 5EYAF 2EA6A 2YW8A 2KGIA 3U5OA 2ECTA 2LDRA 2DX8A 3KV5A 1VD4A 3C6WA 2KIZA 4CCGX 4YABA 4BBQA 4LADB 5D1LB 2PUYA 1ZBDB 2LQ6A 2LGLA 4IC3A 2VJEA 3PHDA 3HTKC 2YT5A 4S3OB 2RSDA 2YU4A 5H1VA 4QF3A 1WEOA 2ECJA 1MM3A 5KH3A 3U5PA 2M3HA 1RMDA 1DVPA 2G43A 3O7AA 3SOUA 2E6RA 5D1KB 4UP0A 3MHSA 5H1UA 5LCWB 3RTRB 3LQHA 2EODA 1VYXA 2CKLB 2YHNA 2K16A 5G05B 3SOXA 2HDPA 3C5KA 4FO9A 2KE1A 1WEMA 2K1JA 2LGKA 3V43A 1WEPA 3EB6A 3ZPVE 2L5UA 5C11A 3IHPA 4BHWA 2JMJA 2Y43A 3T6RA 5LKXA 4GNEA 2QICA 2E6SA 4FJCA 1WE9A 2G45A 3KNVA 1U6GB 3ZVZB 4WZ2A 1LDJB 2QIZA 2KR4A 4L58A 4P5OB 2UZGA 1LDKC 4XI1A 3N9MA 5JG6A 3LQJA 4YBTA 1K2FA 4GNFA 2CKLA 4I7BA 4V3KC 1HYJA 2KREA 3LQIA 4N3WA 5G0FA 2VJEB 4L7XA 2FUIA 3ZNIA 4I7CA 1BORA 1E4UA 3NG2A 1V87A 5I3LA 3QZVA 2JRJA 1WEWA 1WEEA 4LJNA 5DINA 1IYMA 4C9ZA 5TABA 4Q6FA 3DPLR 2VPDA 2XEUA 2MNZA 2F6JA 4X3GA 2VP7A 5KH7A 3MHHA 4GNDA 3M99A 3U5MA 3ASLA 1X4JA 5FB0A 4MSXA 2OXQC 4A0CD 2VPGA 5D1MB 4GB0A 2L0BA 2VNFA 2F42A 1WFKA 4YBMA 2BAYA 1Z2QA 4R7EA 2MA5A 4TKPB 1FBVA 4YADA 2ZETC 1N87A 3SOWA 2M1RA 2KU3A 3L1XA 4YAXA 3ZTGA 2LGVA 2VJFA 5TDWA 4N4FA 3N9LA 2KGGA 2JMDA 2ECIA 4ZQLA 4LLBA 4LK9A 5FB1A 3ZYQA 4AYCA 5C13A 5LKTA 2KYUA 3PUQA 1WEUA 2XB1A 3ZVYA 1WEQA 3LRQA 2MD8C 3KQIA 4A4CA 4F52B 1JOCA 2YREA 2KWJA 3PURA 2MUMA 5TBNA 4AVXA 5FERA 2YHOA 2ECVA 4B7YC 3GV4A 3O37A 2NAAA 2VPEA 4AUQB 2KWKA 2Y1NA 5FEYA 5KH9A 1FP0A 3N9QA 4YATA 2YSJA 2LXPC 4LKAA 2VJFB 2CSZA 3HCTA 2D8SA 4UP5A 3O33A 1JM7A 2MNYA 4O64A 1MM2A 3O36A 2KFTA 3N9NA 4WZ0A 2MD7B 2YQMA 4W4UA 2LN0A 3ZPV1 3M62A 4FK5A 2AN6A 4PPEA 1HYIA 3SHBA 2K4DA 4A4BA 4UI9B 3O35A 4ZUXU 4R2YA 3DQVR 2L80A 2MIQA 2H0DB 2VPBA 2C2LA 4IC2A 5DKAA 2LV9A 3N9OA 2Y1MA 2KWOA 5TRBA 4AP4A 2YURA 4WA6A 2YYRA 1T1HA 2QJ0A 2JMIA 2L75A 2RI7A 5LKUA 4A49A
chains in the Genus database with same CATH superfamily
3Q1DA 2DSMA 5J3XA 4OGCA 3FJUB 2XOZA 2PNXA 4YC9A 3RPGC 1CHCA 2H0DA 1WESA 2CT2A 2ECGA 5LKZA 2MKEA 2I50A 5AITA 2DJAA 1JM7B 3O47A 4AYCB 2FUUA 1WIMA 3VK6A 4ZDTA 2CSYA 2LRIC 5B75A 3L1ZB 2KWNA 2IDAA 3U5NA 2OWAA 4O62A 2XOYA 1WILA 3KV6A 3T7LA 3LVQE 4QQ4A 3GL6A 5SVIA 5B79A 5TDRA 2F6NA 4GNGA 2K17A 1Z6UA 1WGMA 5AIUA 1WEVA 5G04B 4NN2A 4WZ3B 2HYED 4PTBA 3RPGB 2M6MA 2FSAA 4CA1A 5H9MA 3I2DA 3FL2A 3L11A 1X4UA 1VFYA 2YSMA 1WENA 3HCSA 2B0OE 2KKYA 4H9DA 4MVTA 2FFWA 2L43A 1X4IA 2EXUA 3EB5A 2LXHC 3N9PA 4I7DA 4FIPA 1G25A 5B77A 2YUCA 3M63A 2C2VS 2YQLA 2XP0A 5B78A 5B76A 1Z60A 2EGMA 4V3LC 4R8PK 1F62A 2MT5A 5B8DA 4S3OC 5SVIB 2ECWA 2M85A 3H7HA 4B86C 2MA6A 3O70A 5H1TA 2G6QA 2EGPA 4QF2A 2RR4A 4YBSA 3HCUA 1XWHA 3O34A 2LGGA 2ECNA 5EYAF 2EA6A 4F1PA 2YW8A 2KGIA 3U5OA 2ECTA 2LDRA 2DX8A 3KV5A 3PLWA 3LJUX 1VD4A 3C6WA 2KIZA 4CCGX 4YABA 4BBQA 2KKXA 2D8UA 4LADB 5D1LB 2M13A 2PUYA 1ZBDB 2LQ6A 2LGLA 4IC3A 2VJEA 3PHDA 3HTKC 2YT5A 4S3OB 2RSDA 3LDYA 2YU4A 2IQJA 5H1VA 4QF3A 1WEOA 2ECJA 1MM3A 4OGEA 5KH3A 3U5PA 2M3HA 1RMDA 1DVPA 3FM8C 2G43A 3O7AA 3SOUA 2E6RA 5D1KB 4UP0A 3MHSA 5H1UA 5LCWB 3RTRB 3LQHA 2EODA 3T9KA 1VYXA 2CKLB 2P57A 2YHNA 2K16A 5G05B 3SOXA 2HDPA 3C5KA 4FO9A 2KE1A 1WEMA 2FD4A 2K1JA 2LGKA 3V43A 1WEPA 3EB6A 3ZPVE 2L5UA 5C11A 3IHPA 4BHWA 2JMJA 2Y43A 3T6RA 5LKXA 4GNEA 2QICA 2E6SA 4FJCA 3SUBA 1WE9A 2G45A 3KNVA 2CONA 1U6GB 3ZVZB 4WZ2A 1LDJB 2QIZA 2KR4A 4L58A 4P5OB 2UZGA 1LDKC 4XI1A 3N9MA 5JG6A 3LQJA 4YBTA 1K2FA 4GNFA 2CKLA 4I7BA 4V3KC 1HYJA 2CSVA 2KREA 3LQIA 4N3WA 3E2DA 5G0FA 2VJEB 4L7XA 2FUIA 3ZNIA 4I7CA 1BORA 1E4UA 3NG2A 1V87A 5I3LA 3DDTA 3QZVA 2JRJA 1WEWA 1WEEA 4LJNA 5SVYA 5DINA 1IYMA 4C9ZA 5TABA 4Q6FA 3DPLR 2VPDA 2XEUA 2MNZA 2F6JA 4X3GA 2VP7A 2CRWA 5KH7A 3MHHA 4GNDA 3M99A 3U5MA 3ASLA 3FAOA 1X4JA 5FB0A 4MSXA 2OXQC 4A0CD 2YVRA 2VPGA 5D1MB 4GB0A 2L0BA 2VNFA 2F42A 1WFKA 4YBMA 2BAYA 3KDEC 1Z2QA 4R7EA 2MA5A 4TKPB 1FBVA 4YADA 2ZETC 1N87A 3SOWA 4Z0OA 2M1RA 2KU3A 3L1XA 4YAXA 3ZTGA 2LGVA 2VJFA 5TDWA 4N4FA 3N9LA 2KGGA 2JMDA 2ECIA 4ZQLA 4LLBA 4LK9A 2LAUA 5FB1A 3ZYQA 4AYCA 5C13A 5LKTA 2KYUA 5SVXA 3PUQA 1WEUA 2JM3A 2XB1A 3DWDA 3ZVYA 1WEQA 3LRQA 2MD8C 3KQIA 4A4CA 4F52B 1JOCA 2YREA 2KWJA 3PURA 2MUMA 2L7PA 5TBNA 4AVXA 5FERA 2YHOA 2ECVA 4B7YC 3GV4A 3O37A 2NAAA 2VPEA 4AUQB 2KWKA 2Y1NA 5FEYA 5KH9A 1FP0A 3N9QA 4YATA 2YSJA 2LXPC 4LKAA 2VJFB 2CSZA 3HCTA 2D8SA 4UP5A 3O33A 1JM7A 2MNYA 4O64A 1MM2A 3O36A 2KFTA 1MBMA 5K3QA 3N9NA 4WZ0A 2MD7B 2YQMA 4W4UA 2LN0A 2XOCA 3ZPV1 3M62A 4FK5A 3FANA 3JUEA 2AN6A 4PPEA 1HYIA 3SHBA 3LVRE 2K4DA 4A4BA 3FEHA 4UI9B 2CRRA 3O35A 4ZUXU 1DCQA 4R2YA 3DQVR 4Z0RA 2L80A 3MDBC 2MIQA 2H0DB 2VPBA 2C2LA 4IC2A 5DKAA 2LV9A 3N9OA 2E61A 2Y1MA 2KWOA 5TRBA 4AP4A 2YURA 4WA6A 2YYRA 1T1HA 2QJ0A 3M7KA 2JMIA 2L75A 2RI7A 5LKUA 2JUNA 4A49A
chains in the Genus database with same CATH topology
5J3XA 2PNXA 4YC9A 3RPGC 1CHCA 2H0DA 1WESA 2CT2A 2ECGA 5LKZA 2I50A 5AITA 1JM7B 4AYCB 2FUUA 1WIMA 3VK6A 4ZDTA 2CSYA 2LRIC 5B75A 3L1ZB 2KWNA 2IDAA 3U5NA 1WILA 3KV6A 3T7LA 3GL6A 5B79A 5TDRA 2F6NA 4GNGA 2K17A 1Z6UA 1WGMA 5AIUA 1WEVA 5G04B 4NN2A 4WZ3B 2HYED 4PTBA 3RPGB 2M6MA 2FSAA 4CA1A 5H9MA 3I2DA 3FL2A 3L11A 1X4UA 1VFYA 2YSMA 1WENA 3HCSA 4MVTA 2L43A 1X4IA 3EB5A 2LXHC 3N9PA 4I7DA 4FIPA 1G25A 5B77A 2YUCA 3M63A 2C2VS 2YQLA 5B78A 5B76A 1Z60A 4V3LC 4R8PK 1F62A 2MT5A 5B8DA 4S3OC 2ECWA 2M85A 4B86C 2MA6A 3O70A 5H1TA 2G6QA 2EGPA 4QF2A 4YBSA 3HCUA 1XWHA 3O34A 2LGGA 2ECNA 5EYAF 2EA6A 2YW8A 2KGIA 3U5OA 2ECTA 2LDRA 2DX8A 3KV5A 1VD4A 3C6WA 2KIZA 4CCGX 4YABA 4BBQA 4LADB 5D1LB 2PUYA 1ZBDB 2LQ6A 2LGLA 4IC3A 2VJEA 3PHDA 3HTKC 2YT5A 4S3OB 2RSDA 2YU4A 5H1VA 4QF3A 1WEOA 2ECJA 1MM3A 5KH3A 3U5PA 2M3HA 1RMDA 1DVPA 2G43A 3O7AA 3SOUA 2E6RA 5D1KB 4UP0A 3MHSA 5H1UA 5LCWB 3RTRB 3LQHA 2EODA 1VYXA 2CKLB 2YHNA 2K16A 5G05B 3SOXA 2HDPA 3C5KA 4FO9A 2KE1A 1WEMA 2K1JA 2LGKA 3V43A 1WEPA 3EB6A 3ZPVE 2L5UA 5C11A 3IHPA 4BHWA 2JMJA 2Y43A 3T6RA 5LKXA 4GNEA 2QICA 2E6SA 4FJCA 1WE9A 2G45A 3KNVA 1U6GB 3ZVZB 4WZ2A 1LDJB 2QIZA 2KR4A 4L58A 4P5OB 2UZGA 1LDKC 4XI1A 3N9MA 5JG6A 3LQJA 4YBTA 1K2FA 4GNFA 2CKLA 4I7BA 4V3KC 1HYJA 2KREA 3LQIA 4N3WA 5G0FA 2VJEB 4L7XA 2FUIA 3ZNIA 4I7CA 1BORA 1E4UA 3NG2A 1V87A 5I3LA 3QZVA 2JRJA 1WEWA 1WEEA 4LJNA 5DINA 1IYMA 4C9ZA 5TABA 4Q6FA 3DPLR 2VPDA 2XEUA 2MNZA 2F6JA 4X3GA 2VP7A 5KH7A 3MHHA 4GNDA 3M99A 3U5MA 3ASLA 1X4JA 5FB0A 4MSXA 2OXQC 4A0CD 2VPGA 5D1MB 4GB0A 2L0BA 2VNFA 2F42A 1WFKA 4YBMA 2BAYA 1Z2QA 4R7EA 2MA5A 4TKPB 1FBVA 4YADA 2ZETC 1N87A 3SOWA 2M1RA 2KU3A 3L1XA 4YAXA 3ZTGA 2LGVA 2VJFA 5TDWA 4N4FA 3N9LA 2KGGA 2JMDA 2ECIA 4ZQLA 4LLBA 4LK9A 5FB1A 3ZYQA 4AYCA 5C13A 5LKTA 2KYUA 3PUQA 1WEUA 2XB1A 3ZVYA 1WEQA 3LRQA 2MD8C 3KQIA 4A4CA 4F52B 1JOCA 2YREA 2KWJA 3PURA 2MUMA 5TBNA 4AVXA 5FERA 2YHOA 2ECVA 4B7YC 3GV4A 3O37A 2NAAA 2VPEA 4AUQB 2KWKA 2Y1NA 5FEYA 5KH9A 1FP0A 3N9QA 4YATA 2YSJA 2LXPC 4LKAA 2VJFB 2CSZA 3HCTA 2D8SA 4UP5A 3O33A 1JM7A 2MNYA 4O64A 1MM2A 3O36A 2KFTA 3N9NA 4WZ0A 2MD7B 2YQMA 4W4UA 2LN0A 3ZPV1 3M62A 4FK5A 2AN6A 4PPEA 1HYIA 3SHBA 2K4DA 4A4BA 4UI9B 3O35A 4ZUXU 4R2YA 3DQVR 2L80A 2MIQA 2H0DB 2VPBA 2C2LA 4IC2A 5DKAA 2LV9A 3N9OA 2Y1MA 2KWOA 5TRBA 4AP4A 2YURA 4WA6A 2YYRA 1T1HA 2QJ0A 2JMIA 2L75A 2RI7A 5LKUA 4A49A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J3X A;  2PNX A;  4YC9 A;  3RPG C;  1CHC A;  2H0D A;  1WES A;  2CT2 A;  2ECG A;  5LKZ A;  2I50 A;  5AIT A;  1JM7 B;  4AYC B;  2FUU A;  1WIM A;  3VK6 A;  4ZDT A;  2CSY A;  2LRI C;  5B75 A;  3L1Z B;  2KWN A;  2IDA A;  3U5N A;  1WIL A;  3KV6 A;  3T7L A;  3GL6 A;  5B79 A;  5TDR A;  2F6N A;  4GNG A;  2K17 A;  1Z6U A;  1WGM A;  5AIU A;  1WEV A;  5G04 B;  4NN2 A;  4WZ3 B;  2HYE D;  4PTB A;  3RPG B;  2M6M A;  2FSA A;  4CA1 A;  5H9M A;  3I2D A;  3FL2 A;  3L11 A;  1X4U A;  1VFY A;  2YSM A;  1WEN A;  3HCS A;  4MVT A;  2L43 A;  1X4I A;  3EB5 A;  2LXH C;  3N9P A;  4I7D A;  4FIP A;  1G25 A;  5B77 A;  2YUC A;  3M63 A;  2C2V S;  2YQL A;  5B78 A;  5B76 A;  1Z60 A;  4V3L C;  4R8P K;  1F62 A;  2MT5 A;  5B8D A;  4S3O C;  2ECW A;  2M85 A;  4B86 C;  2MA6 A;  3O70 A;  5H1T A;  2G6Q A;  2EGP A;  4QF2 A;  4YBS A;  3HCU A;  1XWH A;  3O34 A;  2LGG A;  2ECN A;  5EYA F;  2EA6 A;  2YW8 A;  2KGI A;  3U5O A;  2ECT A;  2LDR A;  2DX8 A;  3KV5 A;  1VD4 A;  3C6W A;  2KIZ A;  4CCG X;  4YAB A;  4BBQ A;  4LAD B;  5D1L B;  2PUY A;  1ZBD B;  2LQ6 A;  2LGL A;  4IC3 A;  2VJE A;  3PHD A;  3HTK C;  2YT5 A;  4S3O B;  2RSD A;  2YU4 A;  5H1V A;  4QF3 A;  1WEO A;  2ECJ A;  1MM3 A;  5KH3 A;  3U5P A;  2M3H A;  1RMD A;  1DVP A;  2G43 A;  3O7A A;  3SOU A;  2E6R A;  5D1K B;  4UP0 A;  3MHS A;  5H1U A;  5LCW B;  3RTR B;  3LQH A;  2EOD A;  1VYX A;  2CKL B;  2YHN A;  2K16 A;  5G05 B;  3SOX A;  2HDP A;  3C5K A;  4FO9 A;  2KE1 A;  1WEM A;  2K1J A;  2LGK A;  3V43 A;  1WEP A;  3EB6 A;  3ZPV E;  2L5U A;  5C11 A;  3IHP A;  4BHW A;  2JMJ A;  2Y43 A;  3T6R A;  5LKX A;  4GNE A;  2QIC A;  2E6S A;  4FJC A;  1WE9 A;  2G45 A;  3KNV A;  1U6G B;  3ZVZ B;  4WZ2 A;  1LDJ B;  2QIZ A;  2KR4 A;  4L58 A;  4P5O B;  2UZG A;  1LDK C;  4XI1 A;  3N9M A;  5JG6 A;  3LQJ A;  4YBT A;  1K2F A;  4GNF A;  2CKL A;  4I7B A;  4V3K C;  1HYJ A;  2KRE A;  3LQI A;  4N3W A;  5G0F A;  2VJE B;  4L7X A;  2FUI A;  3ZNI A;  4I7C A;  1BOR A;  1E4U A;  3NG2 A;  1V87 A;  5I3L A;  3QZV A;  2JRJ A;  1WEW A;  1WEE A;  4LJN A;  5DIN A;  1IYM A;  4C9Z A;  5TAB A;  4Q6F A;  3DPL R;  2VPD A;  2XEU A;  2MNZ A;  2F6J A;  4X3G A;  2VP7 A;  5KH7 A;  3MHH A;  4GND A;  3M99 A;  3U5M A;  3ASL A;  1X4J A;  5FB0 A;  4MSX A;  2OXQ C;  4A0C D;  2VPG A;  5D1M B;  4GB0 A;  2L0B A;  2VNF A;  2F42 A;  1WFK A;  4YBM A;  2BAY A;  1Z2Q A;  4R7E A;  2MA5 A;  4TKP B;  1FBV A;  4YAD A;  2ZET C;  1N87 A;  3SOW A;  2M1R A;  2KU3 A;  3L1X A;  4YAX A;  3ZTG A;  2LGV A;  2VJF A;  5TDW A;  4N4F A;  3N9L A;  2KGG A;  2JMD A;  2ECI A;  4ZQL A;  4LLB A;  4LK9 A;  5FB1 A;  3ZYQ A;  4AYC A;  5C13 A;  5LKT A;  2KYU A;  3PUQ A;  1WEU A;  2XB1 A;  3ZVY A;  1WEQ A;  3LRQ A;  2MD8 C;  3KQI A;  4A4C A;  4F52 B;  1JOC A;  2YRE A;  2KWJ A;  3PUR A;  2MUM A;  5TBN A;  4AVX A;  5FER A;  2YHO A;  2ECV A;  4B7Y C;  3GV4 A;  3O37 A;  2NAA A;  2VPE A;  4AUQ B;  2KWK A;  2Y1N A;  5FEY A;  5KH9 A;  1FP0 A;  3N9Q A;  4YAT A;  2YSJ A;  2LXP C;  4LKA A;  2VJF B;  2CSZ A;  3HCT A;  2D8S A;  4UP5 A;  3O33 A;  1JM7 A;  2MNY A;  4O64 A;  1MM2 A;  3O36 A;  2KFT A;  3N9N A;  4WZ0 A;  2MD7 B;  2YQM A;  4W4U A;  2LN0 A;  3ZPV 1;  3M62 A;  4FK5 A;  2AN6 A;  4PPE A;  1HYI A;  3SHB A;  2K4D A;  4A4B A;  4UI9 B;  3O35 A;  4ZUX U;  4R2Y A;  3DQV R;  2L80 A;  2MIQ A;  2H0D B;  2VPB A;  2C2L A;  4IC2 A;  5DKA A;  2LV9 A;  3N9O A;  2Y1M A;  2KWO A;  5TRB A;  4AP4 A;  2YUR A;  4WA6 A;  2YYR A;  1T1H A;  2QJ0 A;  2JMI A;  2L75 A;  2RI7 A;  5LKU A;  4A49 A; 
#chains in the Genus database with same CATH topology
 3Q1D A;  2DSM A;  5J3X A;  4OGC A;  3FJU B;  2XOZ A;  2PNX A;  4YC9 A;  3RPG C;  1CHC A;  2H0D A;  1WES A;  2CT2 A;  2ECG A;  5LKZ A;  2MKE A;  2I50 A;  5AIT A;  2DJA A;  1JM7 B;  3O47 A;  4AYC B;  2FUU A;  1WIM A;  3VK6 A;  4ZDT A;  2CSY A;  2LRI C;  5B75 A;  3L1Z B;  2KWN A;  2IDA A;  3U5N A;  2OWA A;  4O62 A;  2XOY A;  1WIL A;  3KV6 A;  3T7L A;  3LVQ E;  4QQ4 A;  3GL6 A;  5SVI A;  5B79 A;  5TDR A;  2F6N A;  4GNG A;  2K17 A;  1Z6U A;  1WGM A;  5AIU A;  1WEV A;  5G04 B;  4NN2 A;  4WZ3 B;  2HYE D;  4PTB A;  3RPG B;  2M6M A;  2FSA A;  4CA1 A;  5H9M A;  3I2D A;  3FL2 A;  3L11 A;  1X4U A;  1VFY A;  2YSM A;  1WEN A;  3HCS A;  2B0O E;  2KKY A;  4H9D A;  4MVT A;  2FFW A;  2L43 A;  1X4I A;  2EXU A;  3EB5 A;  2LXH C;  3N9P A;  4I7D A;  4FIP A;  1G25 A;  5B77 A;  2YUC A;  3M63 A;  2C2V S;  2YQL A;  2XP0 A;  5B78 A;  5B76 A;  1Z60 A;  2EGM A;  4V3L C;  4R8P K;  1F62 A;  2MT5 A;  5B8D A;  4S3O C;  5SVI B;  2ECW A;  2M85 A;  3H7H A;  4B86 C;  2MA6 A;  3O70 A;  5H1T A;  2G6Q A;  2EGP A;  4QF2 A;  2RR4 A;  4YBS A;  3HCU A;  1XWH A;  3O34 A;  2LGG A;  2ECN A;  5EYA F;  2EA6 A;  4F1P A;  2YW8 A;  2KGI A;  3U5O A;  2ECT A;  2LDR A;  2DX8 A;  3KV5 A;  3PLW A;  3LJU X;  1VD4 A;  3C6W A;  2KIZ A;  4CCG X;  4YAB A;  4BBQ A;  2KKX A;  2D8U A;  4LAD B;  5D1L B;  2M13 A;  2PUY A;  1ZBD B;  2LQ6 A;  2LGL A;  4IC3 A;  2VJE A;  3PHD A;  3HTK C;  2YT5 A;  4S3O B;  2RSD A;  3LDY A;  2YU4 A;  2IQJ A;  5H1V A;  4QF3 A;  1WEO A;  2ECJ A;  1MM3 A;  4OGE A;  5KH3 A;  3U5P A;  2M3H A;  1RMD A;  1DVP A;  3FM8 C;  2G43 A;  3O7A A;  3SOU A;  2E6R A;  5D1K B;  4UP0 A;  3MHS A;  5H1U A;  5LCW B;  3RTR B;  3LQH A;  2EOD A;  3T9K A;  1VYX A;  2CKL B;  2P57 A;  2YHN A;  2K16 A;  5G05 B;  3SOX A;  2HDP A;  3C5K A;  4FO9 A;  2KE1 A;  1WEM A;  2FD4 A;  2K1J A;  2LGK A;  3V43 A;  1WEP A;  3EB6 A;  3ZPV E;  2L5U A;  5C11 A;  3IHP A;  4BHW A;  2JMJ A;  2Y43 A;  3T6R A;  5LKX A;  4GNE A;  2QIC A;  2E6S A;  4FJC A;  3SUB A;  1WE9 A;  2G45 A;  3KNV A;  2CON A;  1U6G B;  3ZVZ B;  4WZ2 A;  1LDJ B;  2QIZ A;  2KR4 A;  4L58 A;  4P5O B;  2UZG A;  1LDK C;  4XI1 A;  3N9M A;  5JG6 A;  3LQJ A;  4YBT A;  1K2F A;  4GNF A;  2CKL A;  4I7B A;  4V3K C;  1HYJ A;  2CSV A;  2KRE A;  3LQI A;  4N3W A;  3E2D A;  5G0F A;  2VJE B;  4L7X A;  2FUI A;  3ZNI A;  4I7C A;  1BOR A;  1E4U A;  3NG2 A;  1V87 A;  5I3L A;  3DDT A;  3QZV A;  2JRJ A;  1WEW A;  1WEE A;  4LJN A;  5SVY A;  5DIN A;  1IYM A;  4C9Z A;  5TAB A;  4Q6F A;  3DPL R;  2VPD A;  2XEU A;  2MNZ A;  2F6J A;  4X3G A;  2VP7 A;  2CRW A;  5KH7 A;  3MHH A;  4GND A;  3M99 A;  3U5M A;  3ASL A;  3FAO A;  1X4J A;  5FB0 A;  4MSX A;  2OXQ C;  4A0C D;  2YVR A;  2VPG A;  5D1M B;  4GB0 A;  2L0B A;  2VNF A;  2F42 A;  1WFK A;  4YBM A;  2BAY A;  3KDE C;  1Z2Q A;  4R7E A;  2MA5 A;  4TKP B;  1FBV A;  4YAD A;  2ZET C;  1N87 A;  3SOW A;  4Z0O A;  2M1R A;  2KU3 A;  3L1X A;  4YAX A;  3ZTG A;  2LGV A;  2VJF A;  5TDW A;  4N4F A;  3N9L A;  2KGG A;  2JMD A;  2ECI A;  4ZQL A;  4LLB A;  4LK9 A;  2LAU A;  5FB1 A;  3ZYQ A;  4AYC A;  5C13 A;  5LKT A;  2KYU A;  5SVX A;  3PUQ A;  1WEU A;  2JM3 A;  2XB1 A;  3DWD A;  3ZVY A;  1WEQ A;  3LRQ A;  2MD8 C;  3KQI A;  4A4C A;  4F52 B;  1JOC A;  2YRE A;  2KWJ A;  3PUR A;  2MUM A;  2L7P A;  5TBN A;  4AVX A;  5FER A;  2YHO A;  2ECV A;  4B7Y C;  3GV4 A;  3O37 A;  2NAA A;  2VPE A;  4AUQ B;  2KWK A;  2Y1N A;  5FEY A;  5KH9 A;  1FP0 A;  3N9Q A;  4YAT A;  2YSJ A;  2LXP C;  4LKA A;  2VJF B;  2CSZ A;  3HCT A;  2D8S A;  4UP5 A;  3O33 A;  1JM7 A;  2MNY A;  4O64 A;  1MM2 A;  3O36 A;  2KFT A;  1MBM A;  5K3Q A;  3N9N A;  4WZ0 A;  2MD7 B;  2YQM A;  4W4U A;  2LN0 A;  2XOC A;  3ZPV 1;  3M62 A;  4FK5 A;  3FAN A;  3JUE A;  2AN6 A;  4PPE A;  1HYI A;  3SHB A;  3LVR E;  2K4D A;  4A4B A;  3FEH A;  4UI9 B;  2CRR A;  3O35 A;  4ZUX U;  1DCQ A;  4R2Y A;  3DQV R;  4Z0R A;  2L80 A;  3MDB C;  2MIQ A;  2H0D B;  2VPB A;  2C2L A;  4IC2 A;  5DKA A;  2LV9 A;  3N9O A;  2E61 A;  2Y1M A;  2KWO A;  5TRB A;  4AP4 A;  2YUR A;  4WA6 A;  2YYR A;  1T1H A;  2QJ0 A;  3M7K A;  2JMI A;  2L75 A;  2RI7 A;  5LKU A;  2JUN A;  4A49 A; 
#chains in the Genus database with same CATH homology
 5J3X A;  2PNX A;  4YC9 A;  3RPG C;  1CHC A;  2H0D A;  1WES A;  2CT2 A;  2ECG A;  5LKZ A;  2I50 A;  5AIT A;  1JM7 B;  4AYC B;  2FUU A;  1WIM A;  3VK6 A;  4ZDT A;  2CSY A;  2LRI C;  5B75 A;  3L1Z B;  2KWN A;  2IDA A;  3U5N A;  1WIL A;  3KV6 A;  3T7L A;  3GL6 A;  5B79 A;  5TDR A;  2F6N A;  4GNG A;  2K17 A;  1Z6U A;  1WGM A;  5AIU A;  1WEV A;  5G04 B;  4NN2 A;  4WZ3 B;  2HYE D;  4PTB A;  3RPG B;  2M6M A;  2FSA A;  4CA1 A;  5H9M A;  3I2D A;  3FL2 A;  3L11 A;  1X4U A;  1VFY A;  2YSM A;  1WEN A;  3HCS A;  4MVT A;  2L43 A;  1X4I A;  3EB5 A;  2LXH C;  3N9P A;  4I7D A;  4FIP A;  1G25 A;  5B77 A;  2YUC A;  3M63 A;  2C2V S;  2YQL A;  5B78 A;  5B76 A;  1Z60 A;  4V3L C;  4R8P K;  1F62 A;  2MT5 A;  5B8D A;  4S3O C;  2ECW A;  2M85 A;  4B86 C;  2MA6 A;  3O70 A;  5H1T A;  2G6Q A;  2EGP A;  4QF2 A;  4YBS A;  3HCU A;  1XWH A;  3O34 A;  2LGG A;  2ECN A;  5EYA F;  2EA6 A;  2YW8 A;  2KGI A;  3U5O A;  2ECT A;  2LDR A;  2DX8 A;  3KV5 A;  1VD4 A;  3C6W A;  2KIZ A;  4CCG X;  4YAB A;  4BBQ A;  4LAD B;  5D1L B;  2PUY A;  1ZBD B;  2LQ6 A;  2LGL A;  4IC3 A;  2VJE A;  3PHD A;  3HTK C;  2YT5 A;  4S3O B;  2RSD A;  2YU4 A;  5H1V A;  4QF3 A;  1WEO A;  2ECJ A;  1MM3 A;  5KH3 A;  3U5P A;  2M3H A;  1RMD A;  1DVP A;  2G43 A;  3O7A A;  3SOU A;  2E6R A;  5D1K B;  4UP0 A;  3MHS A;  5H1U A;  5LCW B;  3RTR B;  3LQH A;  2EOD A;  1VYX A;  2CKL B;  2YHN A;  2K16 A;  5G05 B;  3SOX A;  2HDP A;  3C5K A;  4FO9 A;  2KE1 A;  1WEM A;  2K1J A;  2LGK A;  3V43 A;  1WEP A;  3EB6 A;  3ZPV E;  2L5U A;  5C11 A;  3IHP A;  4BHW A;  2JMJ A;  2Y43 A;  3T6R A;  5LKX A;  4GNE A;  2QIC A;  2E6S A;  4FJC A;  1WE9 A;  2G45 A;  3KNV A;  1U6G B;  3ZVZ B;  4WZ2 A;  1LDJ B;  2QIZ A;  2KR4 A;  4L58 A;  4P5O B;  2UZG A;  1LDK C;  4XI1 A;  3N9M A;  5JG6 A;  3LQJ A;  4YBT A;  1K2F A;  4GNF A;  2CKL A;  4I7B A;  4V3K C;  1HYJ A;  2KRE A;  3LQI A;  4N3W A;  5G0F A;  2VJE B;  4L7X A;  2FUI A;  3ZNI A;  4I7C A;  1BOR A;  1E4U A;  3NG2 A;  1V87 A;  5I3L A;  3QZV A;  2JRJ A;  1WEW A;  1WEE A;  4LJN A;  5DIN A;  1IYM A;  4C9Z A;  5TAB A;  4Q6F A;  3DPL R;  2VPD A;  2XEU A;  2MNZ A;  2F6J A;  4X3G A;  2VP7 A;  5KH7 A;  3MHH A;  4GND A;  3M99 A;  3U5M A;  3ASL A;  1X4J A;  5FB0 A;  4MSX A;  2OXQ C;  4A0C D;  2VPG A;  5D1M B;  4GB0 A;  2L0B A;  2VNF A;  2F42 A;  1WFK A;  4YBM A;  2BAY A;  1Z2Q A;  4R7E A;  2MA5 A;  4TKP B;  1FBV A;  4YAD A;  2ZET C;  1N87 A;  3SOW A;  2M1R A;  2KU3 A;  3L1X A;  4YAX A;  3ZTG A;  2LGV A;  2VJF A;  5TDW A;  4N4F A;  3N9L A;  2KGG A;  2JMD A;  2ECI A;  4ZQL A;  4LLB A;  4LK9 A;  5FB1 A;  3ZYQ A;  4AYC A;  5C13 A;  5LKT A;  2KYU A;  3PUQ A;  1WEU A;  2XB1 A;  3ZVY A;  1WEQ A;  3LRQ A;  2MD8 C;  3KQI A;  4A4C A;  4F52 B;  1JOC A;  2YRE A;  2KWJ A;  3PUR A;  2MUM A;  5TBN A;  4AVX A;  5FER A;  2YHO A;  2ECV A;  4B7Y C;  3GV4 A;  3O37 A;  2NAA A;  2VPE A;  4AUQ B;  2KWK A;  2Y1N A;  5FEY A;  5KH9 A;  1FP0 A;  3N9Q A;  4YAT A;  2YSJ A;  2LXP C;  4LKA A;  2VJF B;  2CSZ A;  3HCT A;  2D8S A;  4UP5 A;  3O33 A;  1JM7 A;  2MNY A;  4O64 A;  1MM2 A;  3O36 A;  2KFT A;  3N9N A;  4WZ0 A;  2MD7 B;  2YQM A;  4W4U A;  2LN0 A;  3ZPV 1;  3M62 A;  4FK5 A;  2AN6 A;  4PPE A;  1HYI A;  3SHB A;  2K4D A;  4A4B A;  4UI9 B;  3O35 A;  4ZUX U;  4R2Y A;  3DQV R;  2L80 A;  2MIQ A;  2H0D B;  2VPB A;  2C2L A;  4IC2 A;  5DKA A;  2LV9 A;  3N9O A;  2Y1M A;  2KWO A;  5TRB A;  4AP4 A;  2YUR A;  4WA6 A;  2YYR A;  1T1H A;  2QJ0 A;  2JMI A;  2L75 A;  2RI7 A;  5LKU A;  4A49 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...