2K4DA

E2-c-cbl recognition is necessary but not sufficient for ubiquitination activity
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
83
structure length
83
Chain Sequence
GSLQDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCRCEIKGTEPIVVDPFDPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase CBL
publication title E2-c-Cbl recognition is necessary but not sufficient for ubiquitination activity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 9
structure length 83
sequence length 83
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2008-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14447 Prok-RING_4 Prokaryotic RING finger family 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2k4dA01
2G6QA 3V43A 2YHOA 3ZNIA 3PURA 5H1VA 5B79A 2ECNA 2MT5A 3DQVR 3PHDA 3O33A 4AYCB 2H0DA 2ECJA 5TBNA 4TKPB 4FK5A 4ZDTA 5B78A 2RI7A 3KQIA 2F6JA 3N9NA 1X4IA 5TDWA 3L1ZB 3EB6A 4F52B 2CSYA 2KGGA 4AP4A 2C2VS 3ASLA 4GNGA 5TDRA 3T7LA 3HCTA 5TABA 4AYCA 2E6RA 2KFTA 2VNFA 2CT2A 4YATA 3U5NA 3ZPV1 5DINA 2M1RA 3N9OA 2JRJA 2LGKA 1WESA 2KYUA 1X4UA 5D1LB 5DKAA 3RPGC 3ZYQA 5FEYA 4X3GA 2LDRA 1VFYA 3KV5A 3LRQA 4GB0A 2VPDA 2G45A 4AUQB 3MHSA 5H1UA 2EODA 2QIZA 2MNYA 1WEPA 4YABA 4BHWA 4YC9A 3C5KA 3M63A 5G0FA 1MM3A 3N9QA 2KWOA 2KWJA 3ZPVE 4PTBA 4LKAA 1WGMA 3T6RA 1VYXA 4W4UA 1G25A 4IC3A 2LRIC 3IHPA 3SHBA 4XI1A 4UP5A 3KV6A 1JM7A 5KH9A 3N9LA 2H0DB 4I7CA 2K4DA 4I7BA 4QF3A 4FO9A 1FP0A 4QF2A 2XB1A 5B75A 4FIPA 4YAXA 2L0BA 5C13A 2LGVA 2ECGA 2QJ0A 2ECTA 2HDPA 2I50A 2KIZA 2ECWA 2VPEA 4C9ZA 4IC2A 3O70A 5KH7A 3KNVA 2C2LA 5LKTA 2F6NA 2L80A 5AITA 5D1MB 4B86C 3LQIA 4R8PK 4LLBA 2LGGA 3FL2A 4L7XA 3EB5A 4WZ3B 2YQMA 5B8DA 5G04B 2Y1MA 3L11A 2OXQC 1T1HA 2VPBA 3O7AA 2LXPC 2KWKA 2LGLA 2KR4A 1K2FA 1WE9A 4R7EA 2JMIA 4UI9B 2ECVA 4ZQLA 2YT5A 1WEQA 1WILA 2EA6A 1WEVA 1JOCA 2FSAA 2M3HA 3SOUA 5LKXA 3PUQA 2Y1NA 2LV9A 4LADB 3DPLR 5KH3A 3U5OA 4Q6FA 3O35A 3L1XA 2AN6A 2LQ6A 1WEOA 4UP0A 1JM7B 2MA6A 5FERA 1Z60A 4NN2A 1WEWA 3GL6A 2VJEA 2K17A 3QZVA 1MM2A 4PPEA 1IYMA 1VD4A 2G43A 2NAAA 1WEMA 1WENA 4R2YA 3HCUA 2KE1A 1E4UA 2MIQA 5LCWB 4N3WA 5AIUA 2VJFA 3ZTGA 4WZ0A 3GV4A 3O36A 3VK6A 2KU3A 2L5UA 3M99A 1XWHA 2UZGA 4LK9A 1CHCA 3HTKC 4S3OC 4BBQA 5LKZA 1WEUA 1LDJB 2EGPA 2D8SA 2M6MA 3ZVZB 5J3XA 4WZ2A 2E6SA 4V3LC 4YADA 2LXHC 2YHNA 4B7YC 3NG2A 2HYED 2K16A 4MVTA 4LJNA 3N9MA 2MD8C 1FBVA 2JMJA 4O64A 5FB0A 4GNEA 3HCSA 2PNXA 1F62A 3SOWA 2MA5A 2LN0A 5B77A 1BORA 5B76A 4ZUXU 3MHHA 3RTRB 4WA6A 4YBTA 1N87A 4V3KC 2YQLA 2F42A 2YW8A 1LDKC 1V87A 1X4JA 4N4FA 2MUMA 2K1JA 3SOXA 5EYAF 5LKUA 4A4CA 3I2DA 1WFKA 2KGIA 2JMDA 2VJEB 3ZVYA 4MSXA 2MD7B 1Z6UA 4GNFA 3RPGB 1WIMA 2YREA 2FUUA 5C11A 2DX8A 2Y43A 1WEEA 2L43A 2VJFB 2BAYA 1HYIA 5D1KB 5I3LA 4GNDA 2XEUA 1Z2QA 2CKLB 2KREA 3U5MA 4L58A 5JG6A 3C6WA 1U6GB 2KWNA 3LQHA 3LQJA 2VPGA 4A49A 3O37A 2CSZA 2L75A 3O34A 4A4BA 1ZBDB 2YUCA 5G05B 2YYRA 1RMDA 2QICA 1DVPA 5TRBA 2CKLA 4S3OB 4P5OB 2VP7A 2M85A 2YSMA 2YSJA 4I7DA 2YU4A 5H9MA 4YBSA 3U5PA 5FB1A 4YBMA 5H1TA 2RSDA 4AVXA 2YURA 2PUYA 2ZETC 2ECIA 4FJCA 3N9PA 4CCGX 2MNZA 1HYJA 3M62A 4CA1A 4A0CD 2FUIA 2IDAA
chains in the Genus database with same CATH superfamily
2G6QA 3V43A 2YHOA 3E2DA 3ZNIA 3PURA 5H1VA 2EGMA 5B79A 2ECNA 2MT5A 3DQVR 3PHDA 3O33A 4AYCB 2H0DA 2KKXA 1MBMA 4OGCA 2ECJA 5TBNA 4TKPB 3H7HA 4FK5A 4ZDTA 5B78A 2RI7A 3KQIA 2F6JA 3N9NA 1X4IA 5TDWA 3L1ZB 3EB6A 4F52B 2CSYA 2KGGA 4AP4A 2C2VS 3ASLA 3Q1DA 4GNGA 5TDRA 2XOYA 3T7LA 3HCTA 5TABA 4AYCA 2E6RA 1DCQA 2KFTA 2VNFA 2CT2A 4YATA 3JUEA 3U5NA 3ZPV1 5DINA 2M1RA 3N9OA 2JRJA 2D8UA 4QQ4A 2LGKA 2M13A 1WESA 2KYUA 1X4UA 5D1LB 3FJUB 5DKAA 3RPGC 3ZYQA 5FEYA 4X3GA 2LDRA 3DWDA 1VFYA 2OWAA 3KV5A 3LRQA 4GB0A 5SVYA 2VPDA 2G45A 4AUQB 3MHSA 5H1UA 2LAUA 2EODA 2QIZA 2MNYA 3FAOA 2IQJA 1WEPA 4YABA 4BHWA 4YC9A 3C5KA 3M63A 5G0FA 1MM3A 3N9QA 2KWOA 2KWJA 3PLWA 3ZPVE 4PTBA 4LKAA 1WGMA 3T6RA 1VYXA 4W4UA 1G25A 4IC3A 2LRIC 3IHPA 3SHBA 4XI1A 4UP5A 3KV6A 1JM7A 5KH9A 3N9LA 2H0DB 4I7CA 2K4DA 4I7BA 4QF3A 4FO9A 1FP0A 4QF2A 2XB1A 5B75A 4FIPA 4YAXA 2L0BA 5C13A 2LGVA 2ECGA 2QJ0A 2ECTA 2HDPA 2I50A 2P57A 3FM8C 2KIZA 2ECWA 2VPEA 4C9ZA 2CSVA 4IC2A 3O70A 5KH7A 3KNVA 2C2LA 5LKTA 2F6NA 2L80A 3LJUX 5AITA 5D1MB 4B86C 3LQIA 4R8PK 4LLBA 4Z0RA 2LGGA 2B0OE 3FL2A 4L7XA 3LVQE 3EB5A 4WZ3B 2YQMA 5B8DA 2Y1MA 3L11A 2OXQC 5G04B 1T1HA 2VPBA 3O7AA 2LXPC 4OGEA 2KWKA 2LGLA 2KR4A 1K2FA 1WE9A 4R7EA 3SUBA 2JMIA 4UI9B 2XP0A 2ECVA 4ZQLA 2YT5A 1WEQA 1WILA 2EA6A 1WEVA 1JOCA 2CONA 3LDYA 2FSAA 2M3HA 3SOUA 5LKXA 2E61A 3PUQA 2Y1NA 2LV9A 4LADB 3DPLR 5KH3A 3LVRE 3MDBC 3U5OA 4Q6FA 3O35A 3L1XA 2FFWA 2AN6A 2LQ6A 4F1PA 1WEOA 4UP0A 2KKYA 1JM7B 2XOCA 2MA6A 2EXUA 5FERA 1Z60A 4NN2A 1WEWA 3GL6A 2VJEA 2K17A 3QZVA 1MM2A 4PPEA 1IYMA 4O62A 1VD4A 4H9DA 2G43A 2NAAA 1WEMA 1WENA 4R2YA 3HCUA 2KE1A 1E4UA 2MIQA 5LCWB 4N3WA 5AIUA 2VJFA 3ZTGA 4WZ0A 3GV4A 3O36A 3VK6A 2KU3A 2L5UA 3M99A 1XWHA 2UZGA 4LK9A 2L7PA 2DJAA 1CHCA 3HTKC 4S3OC 4BBQA 5LKZA 1WEUA 1LDJB 2EGPA 2D8SA 2M6MA 3ZVZB 5J3XA 4WZ2A 2E6SA 4V3LC 4YADA 2LXHC 2YHNA 5SVIB 4B7YC 3NG2A 2HYED 2K16A 4MVTA 4LJNA 3N9MA 2MD8C 1FBVA 2JMJA 4O64A 5FB0A 4GNEA 3HCSA 2PNXA 1F62A 3SOWA 2MA5A 2LN0A 5B77A 1BORA 5B76A 4ZUXU 3MHHA 3RTRB 4WA6A 4YBTA 1N87A 4V3KC 5SVIA 2YQLA 2FD4A 2F42A 2YW8A 1LDKC 1V87A 2XOZA 1X4JA 5K3QA 4N4FA 2JUNA 2MUMA 2K1JA 3SOXA 5EYAF 5LKUA 4A4CA 2CRRA 3I2DA 1WFKA 2KGIA 2JMDA 2YVRA 2VJEB 3ZVYA 3KDEC 5SVXA 4MSXA 2MD7B 1Z6UA 4GNFA 3RPGB 1WIMA 2YREA 2FUUA 5C11A 2DSMA 2DX8A 2Y43A 2RR4A 1WEEA 2L43A 2VJFB 2BAYA 3T9KA 1HYIA 4Z0OA 5D1KB 5I3LA 4GNDA 2XEUA 3DDTA 1Z2QA 2CKLB 2CRWA 2KREA 3U5MA 4L58A 5JG6A 3C6WA 1U6GB 2KWNA 3LQHA 3LQJA 2VPGA 4A49A 3O37A 2CSZA 2L75A 3O34A 4A4BA 1ZBDB 3M7KA 2YUCA 5G05B 2YYRA 1RMDA 2QICA 1DVPA 5TRBA 2JM3A 2CKLA 4S3OB 4P5OB 2VP7A 2M85A 2YSMA 2YSJA 4I7DA 2YU4A 5H9MA 2MKEA 3FANA 4YBSA 3U5PA 5FB1A 4YBMA 5H1TA 2RSDA 4AVXA 2YURA 2PUYA 2ZETC 2ECIA 3O47A 4FJCA 3N9PA 4CCGX 3FEHA 2MNZA 1HYJA 3M62A 4CA1A 4A0CD 2FUIA 2IDAA
chains in the Genus database with same CATH topology
2G6QA 3V43A 2YHOA 3ZNIA 3PURA 5H1VA 5B79A 2ECNA 2MT5A 3DQVR 3PHDA 3O33A 4AYCB 2H0DA 2ECJA 5TBNA 4TKPB 4FK5A 4ZDTA 5B78A 2RI7A 3KQIA 2F6JA 3N9NA 1X4IA 5TDWA 3L1ZB 3EB6A 4F52B 2CSYA 2KGGA 4AP4A 2C2VS 3ASLA 4GNGA 5TDRA 3T7LA 3HCTA 5TABA 4AYCA 2E6RA 2KFTA 2VNFA 2CT2A 4YATA 3U5NA 3ZPV1 5DINA 2M1RA 3N9OA 2JRJA 2LGKA 1WESA 2KYUA 1X4UA 5D1LB 5DKAA 3RPGC 3ZYQA 5FEYA 4X3GA 2LDRA 1VFYA 3KV5A 3LRQA 4GB0A 2VPDA 2G45A 4AUQB 3MHSA 5H1UA 2EODA 2QIZA 2MNYA 1WEPA 4YABA 4BHWA 4YC9A 3C5KA 3M63A 5G0FA 1MM3A 3N9QA 2KWOA 2KWJA 3ZPVE 4PTBA 4LKAA 1WGMA 3T6RA 1VYXA 4W4UA 1G25A 4IC3A 2LRIC 3IHPA 3SHBA 4XI1A 4UP5A 3KV6A 1JM7A 5KH9A 3N9LA 2H0DB 4I7CA 2K4DA 4I7BA 4QF3A 4FO9A 1FP0A 4QF2A 2XB1A 5B75A 4FIPA 4YAXA 2L0BA 5C13A 2LGVA 2ECGA 2QJ0A 2ECTA 2HDPA 2I50A 2KIZA 2ECWA 2VPEA 4C9ZA 4IC2A 3O70A 5KH7A 3KNVA 2C2LA 5LKTA 2F6NA 2L80A 5AITA 5D1MB 4B86C 3LQIA 4R8PK 4LLBA 2LGGA 3FL2A 4L7XA 3EB5A 4WZ3B 2YQMA 5B8DA 5G04B 2Y1MA 3L11A 2OXQC 1T1HA 2VPBA 3O7AA 2LXPC 2KWKA 2LGLA 2KR4A 1K2FA 1WE9A 4R7EA 2JMIA 4UI9B 2ECVA 4ZQLA 2YT5A 1WEQA 1WILA 2EA6A 1WEVA 1JOCA 2FSAA 2M3HA 3SOUA 5LKXA 3PUQA 2Y1NA 2LV9A 4LADB 3DPLR 5KH3A 3U5OA 4Q6FA 3O35A 3L1XA 2AN6A 2LQ6A 1WEOA 4UP0A 1JM7B 2MA6A 5FERA 1Z60A 4NN2A 1WEWA 3GL6A 2VJEA 2K17A 3QZVA 1MM2A 4PPEA 1IYMA 1VD4A 2G43A 2NAAA 1WEMA 1WENA 4R2YA 3HCUA 2KE1A 1E4UA 2MIQA 5LCWB 4N3WA 5AIUA 2VJFA 3ZTGA 4WZ0A 3GV4A 3O36A 3VK6A 2KU3A 2L5UA 3M99A 1XWHA 2UZGA 4LK9A 1CHCA 3HTKC 4S3OC 4BBQA 5LKZA 1WEUA 1LDJB 2EGPA 2D8SA 2M6MA 3ZVZB 5J3XA 4WZ2A 2E6SA 4V3LC 4YADA 2LXHC 2YHNA 4B7YC 3NG2A 2HYED 2K16A 4MVTA 4LJNA 3N9MA 2MD8C 1FBVA 2JMJA 4O64A 5FB0A 4GNEA 3HCSA 2PNXA 1F62A 3SOWA 2MA5A 2LN0A 5B77A 1BORA 5B76A 4ZUXU 3MHHA 3RTRB 4WA6A 4YBTA 1N87A 4V3KC 2YQLA 2F42A 2YW8A 1LDKC 1V87A 1X4JA 4N4FA 2MUMA 2K1JA 3SOXA 5EYAF 5LKUA 4A4CA 3I2DA 1WFKA 2KGIA 2JMDA 2VJEB 3ZVYA 4MSXA 2MD7B 1Z6UA 4GNFA 3RPGB 1WIMA 2YREA 2FUUA 5C11A 2DX8A 2Y43A 1WEEA 2L43A 2VJFB 2BAYA 1HYIA 5D1KB 5I3LA 4GNDA 2XEUA 1Z2QA 2CKLB 2KREA 3U5MA 4L58A 5JG6A 3C6WA 1U6GB 2KWNA 3LQHA 3LQJA 2VPGA 4A49A 3O37A 2CSZA 2L75A 3O34A 4A4BA 1ZBDB 2YUCA 5G05B 2YYRA 1RMDA 2QICA 1DVPA 5TRBA 2CKLA 4S3OB 4P5OB 2VP7A 2M85A 2YSMA 2YSJA 4I7DA 2YU4A 5H9MA 4YBSA 3U5PA 5FB1A 4YBMA 5H1TA 2RSDA 4AVXA 2YURA 2PUYA 2ZETC 2ECIA 4FJCA 3N9PA 4CCGX 2MNZA 1HYJA 3M62A 4CA1A 4A0CD 2FUIA 2IDAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G6Q A;  3V43 A;  2YHO A;  3ZNI A;  3PUR A;  5H1V A;  5B79 A;  2ECN A;  2MT5 A;  3DQV R;  3PHD A;  3O33 A;  4AYC B;  2H0D A;  2ECJ A;  5TBN A;  4TKP B;  4FK5 A;  4ZDT A;  5B78 A;  2RI7 A;  3KQI A;  2F6J A;  3N9N A;  1X4I A;  5TDW A;  3L1Z B;  3EB6 A;  4F52 B;  2CSY A;  2KGG A;  4AP4 A;  2C2V S;  3ASL A;  4GNG A;  5TDR A;  3T7L A;  3HCT A;  5TAB A;  4AYC A;  2E6R A;  2KFT A;  2VNF A;  2CT2 A;  4YAT A;  3U5N A;  3ZPV 1;  5DIN A;  2M1R A;  3N9O A;  2JRJ A;  2LGK A;  1WES A;  2KYU A;  1X4U A;  5D1L B;  5DKA A;  3RPG C;  3ZYQ A;  5FEY A;  4X3G A;  2LDR A;  1VFY A;  3KV5 A;  3LRQ A;  4GB0 A;  2VPD A;  2G45 A;  4AUQ B;  3MHS A;  5H1U A;  2EOD A;  2QIZ A;  2MNY A;  1WEP A;  4YAB A;  4BHW A;  4YC9 A;  3C5K A;  3M63 A;  5G0F A;  1MM3 A;  3N9Q A;  2KWO A;  2KWJ A;  3ZPV E;  4PTB A;  4LKA A;  1WGM A;  3T6R A;  1VYX A;  4W4U A;  1G25 A;  4IC3 A;  2LRI C;  3IHP A;  3SHB A;  4XI1 A;  4UP5 A;  3KV6 A;  1JM7 A;  5KH9 A;  3N9L A;  2H0D B;  4I7C A;  2K4D A;  4I7B A;  4QF3 A;  4FO9 A;  1FP0 A;  4QF2 A;  2XB1 A;  5B75 A;  4FIP A;  4YAX A;  2L0B A;  5C13 A;  2LGV A;  2ECG A;  2QJ0 A;  2ECT A;  2HDP A;  2I50 A;  2KIZ A;  2ECW A;  2VPE A;  4C9Z A;  4IC2 A;  3O70 A;  5KH7 A;  3KNV A;  2C2L A;  5LKT A;  2F6N A;  2L80 A;  5AIT A;  5D1M B;  4B86 C;  3LQI A;  4R8P K;  4LLB A;  2LGG A;  3FL2 A;  4L7X A;  3EB5 A;  4WZ3 B;  2YQM A;  5B8D A;  5G04 B;  2Y1M A;  3L11 A;  2OXQ C;  1T1H A;  2VPB A;  3O7A A;  2LXP C;  2KWK A;  2LGL A;  2KR4 A;  1K2F A;  1WE9 A;  4R7E A;  2JMI A;  4UI9 B;  2ECV A;  4ZQL A;  2YT5 A;  1WEQ A;  1WIL A;  2EA6 A;  1WEV A;  1JOC A;  2FSA A;  2M3H A;  3SOU A;  5LKX A;  3PUQ A;  2Y1N A;  2LV9 A;  4LAD B;  3DPL R;  5KH3 A;  3U5O A;  4Q6F A;  3O35 A;  3L1X A;  2AN6 A;  2LQ6 A;  1WEO A;  4UP0 A;  1JM7 B;  2MA6 A;  5FER A;  1Z60 A;  4NN2 A;  1WEW A;  3GL6 A;  2VJE A;  2K17 A;  3QZV A;  1MM2 A;  4PPE A;  1IYM A;  1VD4 A;  2G43 A;  2NAA A;  1WEM A;  1WEN A;  4R2Y A;  3HCU A;  2KE1 A;  1E4U A;  2MIQ A;  5LCW B;  4N3W A;  5AIU A;  2VJF A;  3ZTG A;  4WZ0 A;  3GV4 A;  3O36 A;  3VK6 A;  2KU3 A;  2L5U A;  3M99 A;  1XWH A;  2UZG A;  4LK9 A;  1CHC A;  3HTK C;  4S3O C;  4BBQ A;  5LKZ A;  1WEU A;  1LDJ B;  2EGP A;  2D8S A;  2M6M A;  3ZVZ B;  5J3X A;  4WZ2 A;  2E6S A;  4V3L C;  4YAD A;  2LXH C;  2YHN A;  4B7Y C;  3NG2 A;  2HYE D;  2K16 A;  4MVT A;  4LJN A;  3N9M A;  2MD8 C;  1FBV A;  2JMJ A;  4O64 A;  5FB0 A;  4GNE A;  3HCS A;  2PNX A;  1F62 A;  3SOW A;  2MA5 A;  2LN0 A;  5B77 A;  1BOR A;  5B76 A;  4ZUX U;  3MHH A;  3RTR B;  4WA6 A;  4YBT A;  1N87 A;  4V3K C;  2YQL A;  2F42 A;  2YW8 A;  1LDK C;  1V87 A;  1X4J A;  4N4F A;  2MUM A;  2K1J A;  3SOX A;  5EYA F;  5LKU A;  4A4C A;  3I2D A;  1WFK A;  2KGI A;  2JMD A;  2VJE B;  3ZVY A;  4MSX A;  2MD7 B;  1Z6U A;  4GNF A;  3RPG B;  1WIM A;  2YRE A;  2FUU A;  5C11 A;  2DX8 A;  2Y43 A;  1WEE A;  2L43 A;  2VJF B;  2BAY A;  1HYI A;  5D1K B;  5I3L A;  4GND A;  2XEU A;  1Z2Q A;  2CKL B;  2KRE A;  3U5M A;  4L58 A;  5JG6 A;  3C6W A;  1U6G B;  2KWN A;  3LQH A;  3LQJ A;  2VPG A;  4A49 A;  3O37 A;  2CSZ A;  2L75 A;  3O34 A;  4A4B A;  1ZBD B;  2YUC A;  5G05 B;  2YYR A;  1RMD A;  2QIC A;  1DVP A;  5TRB A;  2CKL A;  4S3O B;  4P5O B;  2VP7 A;  2M85 A;  2YSM A;  2YSJ A;  4I7D A;  2YU4 A;  5H9M A;  4YBS A;  3U5P A;  5FB1 A;  4YBM A;  5H1T A;  2RSD A;  4AVX A;  2YUR A;  2PUY A;  2ZET C;  2ECI A;  4FJC A;  3N9P A;  4CCG X;  2MNZ A;  1HYJ A;  3M62 A;  4CA1 A;  4A0C D;  2FUI A;  2IDA A; 
#chains in the Genus database with same CATH topology
 2G6Q A;  3V43 A;  2YHO A;  3E2D A;  3ZNI A;  3PUR A;  5H1V A;  2EGM A;  5B79 A;  2ECN A;  2MT5 A;  3DQV R;  3PHD A;  3O33 A;  4AYC B;  2H0D A;  2KKX A;  1MBM A;  4OGC A;  2ECJ A;  5TBN A;  4TKP B;  3H7H A;  4FK5 A;  4ZDT A;  5B78 A;  2RI7 A;  3KQI A;  2F6J A;  3N9N A;  1X4I A;  5TDW A;  3L1Z B;  3EB6 A;  4F52 B;  2CSY A;  2KGG A;  4AP4 A;  2C2V S;  3ASL A;  3Q1D A;  4GNG A;  5TDR A;  2XOY A;  3T7L A;  3HCT A;  5TAB A;  4AYC A;  2E6R A;  1DCQ A;  2KFT A;  2VNF A;  2CT2 A;  4YAT A;  3JUE A;  3U5N A;  3ZPV 1;  5DIN A;  2M1R A;  3N9O A;  2JRJ A;  2D8U A;  4QQ4 A;  2LGK A;  2M13 A;  1WES A;  2KYU A;  1X4U A;  5D1L B;  3FJU B;  5DKA A;  3RPG C;  3ZYQ A;  5FEY A;  4X3G A;  2LDR A;  3DWD A;  1VFY A;  2OWA A;  3KV5 A;  3LRQ A;  4GB0 A;  5SVY A;  2VPD A;  2G45 A;  4AUQ B;  3MHS A;  5H1U A;  2LAU A;  2EOD A;  2QIZ A;  2MNY A;  3FAO A;  2IQJ A;  1WEP A;  4YAB A;  4BHW A;  4YC9 A;  3C5K A;  3M63 A;  5G0F A;  1MM3 A;  3N9Q A;  2KWO A;  2KWJ A;  3PLW A;  3ZPV E;  4PTB A;  4LKA A;  1WGM A;  3T6R A;  1VYX A;  4W4U A;  1G25 A;  4IC3 A;  2LRI C;  3IHP A;  3SHB A;  4XI1 A;  4UP5 A;  3KV6 A;  1JM7 A;  5KH9 A;  3N9L A;  2H0D B;  4I7C A;  2K4D A;  4I7B A;  4QF3 A;  4FO9 A;  1FP0 A;  4QF2 A;  2XB1 A;  5B75 A;  4FIP A;  4YAX A;  2L0B A;  5C13 A;  2LGV A;  2ECG A;  2QJ0 A;  2ECT A;  2HDP A;  2I50 A;  2P57 A;  3FM8 C;  2KIZ A;  2ECW A;  2VPE A;  4C9Z A;  2CSV A;  4IC2 A;  3O70 A;  5KH7 A;  3KNV A;  2C2L A;  5LKT A;  2F6N A;  2L80 A;  3LJU X;  5AIT A;  5D1M B;  4B86 C;  3LQI A;  4R8P K;  4LLB A;  4Z0R A;  2LGG A;  2B0O E;  3FL2 A;  4L7X A;  3LVQ E;  3EB5 A;  4WZ3 B;  2YQM A;  5B8D A;  2Y1M A;  3L11 A;  2OXQ C;  5G04 B;  1T1H A;  2VPB A;  3O7A A;  2LXP C;  4OGE A;  2KWK A;  2LGL A;  2KR4 A;  1K2F A;  1WE9 A;  4R7E A;  3SUB A;  2JMI A;  4UI9 B;  2XP0 A;  2ECV A;  4ZQL A;  2YT5 A;  1WEQ A;  1WIL A;  2EA6 A;  1WEV A;  1JOC A;  2CON A;  3LDY A;  2FSA A;  2M3H A;  3SOU A;  5LKX A;  2E61 A;  3PUQ A;  2Y1N A;  2LV9 A;  4LAD B;  3DPL R;  5KH3 A;  3LVR E;  3MDB C;  3U5O A;  4Q6F A;  3O35 A;  3L1X A;  2FFW A;  2AN6 A;  2LQ6 A;  4F1P A;  1WEO A;  4UP0 A;  2KKY A;  1JM7 B;  2XOC A;  2MA6 A;  2EXU A;  5FER A;  1Z60 A;  4NN2 A;  1WEW A;  3GL6 A;  2VJE A;  2K17 A;  3QZV A;  1MM2 A;  4PPE A;  1IYM A;  4O62 A;  1VD4 A;  4H9D A;  2G43 A;  2NAA A;  1WEM A;  1WEN A;  4R2Y A;  3HCU A;  2KE1 A;  1E4U A;  2MIQ A;  5LCW B;  4N3W A;  5AIU A;  2VJF A;  3ZTG A;  4WZ0 A;  3GV4 A;  3O36 A;  3VK6 A;  2KU3 A;  2L5U A;  3M99 A;  1XWH A;  2UZG A;  4LK9 A;  2L7P A;  2DJA A;  1CHC A;  3HTK C;  4S3O C;  4BBQ A;  5LKZ A;  1WEU A;  1LDJ B;  2EGP A;  2D8S A;  2M6M A;  3ZVZ B;  5J3X A;  4WZ2 A;  2E6S A;  4V3L C;  4YAD A;  2LXH C;  2YHN A;  5SVI B;  4B7Y C;  3NG2 A;  2HYE D;  2K16 A;  4MVT A;  4LJN A;  3N9M A;  2MD8 C;  1FBV A;  2JMJ A;  4O64 A;  5FB0 A;  4GNE A;  3HCS A;  2PNX A;  1F62 A;  3SOW A;  2MA5 A;  2LN0 A;  5B77 A;  1BOR A;  5B76 A;  4ZUX U;  3MHH A;  3RTR B;  4WA6 A;  4YBT A;  1N87 A;  4V3K C;  5SVI A;  2YQL A;  2FD4 A;  2F42 A;  2YW8 A;  1LDK C;  1V87 A;  2XOZ A;  1X4J A;  5K3Q A;  4N4F A;  2JUN A;  2MUM A;  2K1J A;  3SOX A;  5EYA F;  5LKU A;  4A4C A;  2CRR A;  3I2D A;  1WFK A;  2KGI A;  2JMD A;  2YVR A;  2VJE B;  3ZVY A;  3KDE C;  5SVX A;  4MSX A;  2MD7 B;  1Z6U A;  4GNF A;  3RPG B;  1WIM A;  2YRE A;  2FUU A;  5C11 A;  2DSM A;  2DX8 A;  2Y43 A;  2RR4 A;  1WEE A;  2L43 A;  2VJF B;  2BAY A;  3T9K A;  1HYI A;  4Z0O A;  5D1K B;  5I3L A;  4GND A;  2XEU A;  3DDT A;  1Z2Q A;  2CKL B;  2CRW A;  2KRE A;  3U5M A;  4L58 A;  5JG6 A;  3C6W A;  1U6G B;  2KWN A;  3LQH A;  3LQJ A;  2VPG A;  4A49 A;  3O37 A;  2CSZ A;  2L75 A;  3O34 A;  4A4B A;  1ZBD B;  3M7K A;  2YUC A;  5G05 B;  2YYR A;  1RMD A;  2QIC A;  1DVP A;  5TRB A;  2JM3 A;  2CKL A;  4S3O B;  4P5O B;  2VP7 A;  2M85 A;  2YSM A;  2YSJ A;  4I7D A;  2YU4 A;  5H9M A;  2MKE A;  3FAN A;  4YBS A;  3U5P A;  5FB1 A;  4YBM A;  5H1T A;  2RSD A;  4AVX A;  2YUR A;  2PUY A;  2ZET C;  2ECI A;  3O47 A;  4FJC A;  3N9P A;  4CCG X;  3FEH A;  2MNZ A;  1HYJ A;  3M62 A;  4CA1 A;  4A0C D;  2FUI A;  2IDA A; 
#chains in the Genus database with same CATH homology
 2G6Q A;  3V43 A;  2YHO A;  3ZNI A;  3PUR A;  5H1V A;  5B79 A;  2ECN A;  2MT5 A;  3DQV R;  3PHD A;  3O33 A;  4AYC B;  2H0D A;  2ECJ A;  5TBN A;  4TKP B;  4FK5 A;  4ZDT A;  5B78 A;  2RI7 A;  3KQI A;  2F6J A;  3N9N A;  1X4I A;  5TDW A;  3L1Z B;  3EB6 A;  4F52 B;  2CSY A;  2KGG A;  4AP4 A;  2C2V S;  3ASL A;  4GNG A;  5TDR A;  3T7L A;  3HCT A;  5TAB A;  4AYC A;  2E6R A;  2KFT A;  2VNF A;  2CT2 A;  4YAT A;  3U5N A;  3ZPV 1;  5DIN A;  2M1R A;  3N9O A;  2JRJ A;  2LGK A;  1WES A;  2KYU A;  1X4U A;  5D1L B;  5DKA A;  3RPG C;  3ZYQ A;  5FEY A;  4X3G A;  2LDR A;  1VFY A;  3KV5 A;  3LRQ A;  4GB0 A;  2VPD A;  2G45 A;  4AUQ B;  3MHS A;  5H1U A;  2EOD A;  2QIZ A;  2MNY A;  1WEP A;  4YAB A;  4BHW A;  4YC9 A;  3C5K A;  3M63 A;  5G0F A;  1MM3 A;  3N9Q A;  2KWO A;  2KWJ A;  3ZPV E;  4PTB A;  4LKA A;  1WGM A;  3T6R A;  1VYX A;  4W4U A;  1G25 A;  4IC3 A;  2LRI C;  3IHP A;  3SHB A;  4XI1 A;  4UP5 A;  3KV6 A;  1JM7 A;  5KH9 A;  3N9L A;  2H0D B;  4I7C A;  2K4D A;  4I7B A;  4QF3 A;  4FO9 A;  1FP0 A;  4QF2 A;  2XB1 A;  5B75 A;  4FIP A;  4YAX A;  2L0B A;  5C13 A;  2LGV A;  2ECG A;  2QJ0 A;  2ECT A;  2HDP A;  2I50 A;  2KIZ A;  2ECW A;  2VPE A;  4C9Z A;  4IC2 A;  3O70 A;  5KH7 A;  3KNV A;  2C2L A;  5LKT A;  2F6N A;  2L80 A;  5AIT A;  5D1M B;  4B86 C;  3LQI A;  4R8P K;  4LLB A;  2LGG A;  3FL2 A;  4L7X A;  3EB5 A;  4WZ3 B;  2YQM A;  5B8D A;  5G04 B;  2Y1M A;  3L11 A;  2OXQ C;  1T1H A;  2VPB A;  3O7A A;  2LXP C;  2KWK A;  2LGL A;  2KR4 A;  1K2F A;  1WE9 A;  4R7E A;  2JMI A;  4UI9 B;  2ECV A;  4ZQL A;  2YT5 A;  1WEQ A;  1WIL A;  2EA6 A;  1WEV A;  1JOC A;  2FSA A;  2M3H A;  3SOU A;  5LKX A;  3PUQ A;  2Y1N A;  2LV9 A;  4LAD B;  3DPL R;  5KH3 A;  3U5O A;  4Q6F A;  3O35 A;  3L1X A;  2AN6 A;  2LQ6 A;  1WEO A;  4UP0 A;  1JM7 B;  2MA6 A;  5FER A;  1Z60 A;  4NN2 A;  1WEW A;  3GL6 A;  2VJE A;  2K17 A;  3QZV A;  1MM2 A;  4PPE A;  1IYM A;  1VD4 A;  2G43 A;  2NAA A;  1WEM A;  1WEN A;  4R2Y A;  3HCU A;  2KE1 A;  1E4U A;  2MIQ A;  5LCW B;  4N3W A;  5AIU A;  2VJF A;  3ZTG A;  4WZ0 A;  3GV4 A;  3O36 A;  3VK6 A;  2KU3 A;  2L5U A;  3M99 A;  1XWH A;  2UZG A;  4LK9 A;  1CHC A;  3HTK C;  4S3O C;  4BBQ A;  5LKZ A;  1WEU A;  1LDJ B;  2EGP A;  2D8S A;  2M6M A;  3ZVZ B;  5J3X A;  4WZ2 A;  2E6S A;  4V3L C;  4YAD A;  2LXH C;  2YHN A;  4B7Y C;  3NG2 A;  2HYE D;  2K16 A;  4MVT A;  4LJN A;  3N9M A;  2MD8 C;  1FBV A;  2JMJ A;  4O64 A;  5FB0 A;  4GNE A;  3HCS A;  2PNX A;  1F62 A;  3SOW A;  2MA5 A;  2LN0 A;  5B77 A;  1BOR A;  5B76 A;  4ZUX U;  3MHH A;  3RTR B;  4WA6 A;  4YBT A;  1N87 A;  4V3K C;  2YQL A;  2F42 A;  2YW8 A;  1LDK C;  1V87 A;  1X4J A;  4N4F A;  2MUM A;  2K1J A;  3SOX A;  5EYA F;  5LKU A;  4A4C A;  3I2D A;  1WFK A;  2KGI A;  2JMD A;  2VJE B;  3ZVY A;  4MSX A;  2MD7 B;  1Z6U A;  4GNF A;  3RPG B;  1WIM A;  2YRE A;  2FUU A;  5C11 A;  2DX8 A;  2Y43 A;  1WEE A;  2L43 A;  2VJF B;  2BAY A;  1HYI A;  5D1K B;  5I3L A;  4GND A;  2XEU A;  1Z2Q A;  2CKL B;  2KRE A;  3U5M A;  4L58 A;  5JG6 A;  3C6W A;  1U6G B;  2KWN A;  3LQH A;  3LQJ A;  2VPG A;  4A49 A;  3O37 A;  2CSZ A;  2L75 A;  3O34 A;  4A4B A;  1ZBD B;  2YUC A;  5G05 B;  2YYR A;  1RMD A;  2QIC A;  1DVP A;  5TRB A;  2CKL A;  4S3O B;  4P5O B;  2VP7 A;  2M85 A;  2YSM A;  2YSJ A;  4I7D A;  2YU4 A;  5H9M A;  4YBS A;  3U5P A;  5FB1 A;  4YBM A;  5H1T A;  2RSD A;  4AVX A;  2YUR A;  2PUY A;  2ZET C;  2ECI A;  4FJC A;  3N9P A;  4CCG X;  2MNZ A;  1HYJ A;  3M62 A;  4CA1 A;  4A0C D;  2FUI A;  2IDA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...