2K4DA

E2-c-cbl recognition is necessary but not sufficient for ubiquitination activity
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
83
structure length
83
Chain Sequence
GSLQDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCRCEIKGTEPIVVDPFDPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase CBL
publication title E2-c-Cbl recognition is necessary but not sufficient for ubiquitination activity
pubmed doi rcsb
source organism Homo sapiens
total genus 9
structure length 83
sequence length 83
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2008-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14447 Prok-RING_4 Prokaryotic RING finger family 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2k4dA01
1VFYA 3RPGB 2G43A 3ZYQA 5D1LB 1WEQA 4YBMA 3MHHA 4BHWA 4CCGX 4A4CA 2YQMA 5LKUA 2EGPA 3C5KA 5FB1A 2KU3A 1G25A 1VD4A 2ECJA 3EB5A 2MIQA 4AYCB 4ZUXU 2ECVA 2JRJA 4Q6FA 4FK5A 3L11A 2K16A 4YBSA 4YATA 1FBVA 1WENA 3SOWA 1LDKC 2JMJA 4YAXA 1JM7A 2ECIA 2YU4A 5JG6A 4YABA 5LKZA 2VJEB 5B77A 2K1JA 3SOXA 1XWHA 5KH9A 2YYRA 4P5OB 5FEYA 3HCUA 4AVXA 4W4UA 4UP5A 3DPLR 3RTRB 3U5OA 1VYXA 4C9ZA 2HDPA 4LKAA 1LDJB 4GNEA 1X4JA 3KNVA 2Y1MA 2C2VS 5B78A 1FP0A 4YC9A 2VP7A 3N9LA 2LDRA 4I7CA 2OXQC 4IC2A 5LCWB 2FUUA 2G6QA 2VPGA 5H1UA 1WEUA 2YHNA 2VJFB 2ECWA 2YSMA 5G0FA 2KR4A 5C11A 1Z60A 2NAAA 2M1RA 3L1XA 2JMDA 2KWKA 3ZVYA 2LV9A 2YHOA 5KH3A 4N4FA 4WZ2A 2CT2A 1U6GB 2H0DB 1DVPA 4GNGA 3NG2A 2PNXA 3ZPVE 3KQIA 3ZVZB 4MSXA 2AN6A 3HTKC 4AYCA 3DQVR 4PTBA 2RSDA 2LRIC 4AP4A 3LRQA 4FO9A 4N3WA 4S3OB 1JOCA 4NN2A 2RI7A 5B76A 3T6RA 3GV4A 2ECGA 2CKLB 4F52B 2UZGA 3LQJA 2QJ0A 2ECNA 4BBQA 2IDAA 3N9PA 5H1TA 5AIUA 2MD8C 2MNYA 5TDWA 5B8DA 1X4IA 3SHBA 4A4BA 5C13A 2YW8A 5H9MA 4LADB 4B7YC 4CA1A 2KWOA 4FJCA 2KFTA 2L80A 5FB0A 3PUQA 2L75A 2L5UA 2BAYA 2K4DA 1WILA 2F42A 5G05B 1MM2A 1WESA 3FL2A 3MHSA 4WA6A 3U5NA 1WFKA 5DINA 2VJFA 2EA6A 5TABA 3HCSA 1ZBDB 2XEUA 1WIMA 5DKAA 5TDRA 5D1KB 2L0BA 2MNZA 4R8PK 4QF2A 2KWNA 2YSJA 4IC3A 2LXHC 5TRBA 3LQHA 1WEEA 2HYED 5G04B 2I50A 4LJNA 3O37A 4WZ0A 2FSAA 5KH7A 4X3GA 3M62A 3N9NA 4LK9A 2CKLA 1WEWA 4TKPB 5D1MB 5LKTA 4WZ3B 3GL6A 4A49A 2VPEA 2C2LA 2CSYA 2F6NA 1WEMA 4A0CD 2LN0A 2Y43A 2KYUA 4V3KC 4ZDTA 2PUYA 1F62A 2XB1A 2KIZA 2Y1NA 4R7EA 5J3XA 2LGKA 4GNFA 3ZTGA 2YQLA 3PHDA 2VJEA 2MA5A 4GB0A 4L7XA 3VK6A 3C6WA 5FERA 3O34A 4GNDA 4YADA 4UP0A 2FUIA 2ZETC 3U5MA 1CHCA 5EYAF 5B75A 4R2YA 3EB6A 2LGLA 4O64A 4MVTA 4V3LC 3U5PA 3LQIA 3M99A 2YUCA 4B86C 3KV6A 2F6JA 1WEPA 1WGMA 2DX8A 1Z2QA 4AUQB 2KE1A 3IHPA 3I2DA 2QICA 2VPBA 3N9MA 2G45A 3O35A 2YREA 4UI9B 1WEOA 1HYIA 2LGGA 2KREA 4PPEA 1HYJA 2M85A 3ZPV1 3HCTA 2M3HA 2JMIA 2H0DA 2ECTA 3QZVA 1JM7B 3ASLA 1WE9A 3O33A 1BORA 3N9OA 2MT5A 2E6RA 3O7AA 4YBTA 3PURA 2KWJA 2QIZA 1IYMA 2E6SA 2LXPC 4I7BA 4L58A 2K17A 2LGVA 2YURA 3O70A 1WEVA 2MA6A 2CSZA 3KV5A 2D8SA 1X4UA 2MUMA 5I3LA 1T1HA 3O36A 3ZNIA 2M6MA 1MM3A 3M63A 4XI1A 2KGGA 5AITA 4ZQLA 5LKXA 1Z6UA 1RMDA 1E4UA 4I7DA 5TBNA 3N9QA 4FIPA 2L43A 3SOUA 2VNFA 3L1ZB 3T7LA 2EODA 4S3OC 5H1VA 2MD7B 2VPDA 3RPGC 2YT5A 2KGIA 1K2FA 1V87A 4QF3A 5B79A 1N87A 4LLBA 3V43A 2LQ6A
chains in the Genus database with same CATH superfamily
1VFYA 3RPGB 2G43A 3ZYQA 2CONA 5D1LB 1WEQA 4YBMA 3MHHA 4BHWA 4CCGX 4OGCA 4A4CA 2YQMA 5LKUA 2EGPA 3C5KA 5FB1A 2KU3A 1G25A 2CSVA 1VD4A 5SVIB 2ECJA 3EB5A 3M7KA 2MIQA 4AYCB 4ZUXU 2ECVA 2JRJA 4Q6FA 4FK5A 3L11A 2K16A 3O47A 4YBSA 4YATA 1FBVA 1WENA 3SOWA 1LDKC 2JMJA 4YAXA 1JM7A 2ECIA 2YU4A 5JG6A 4YABA 3FJUB 5LKZA 2VJEB 5B77A 2K1JA 2MKEA 3SOXA 1XWHA 5KH9A 2YYRA 4P5OB 5FEYA 3HCUA 4AVXA 4W4UA 4UP5A 3DPLR 3RTRB 2XOYA 3U5OA 1VYXA 4C9ZA 2HDPA 4LKAA 1LDJB 4GNEA 1X4JA 3KNVA 2Y1MA 2C2VS 2RR4A 5B78A 1FP0A 2E61A 3MDBC 4YC9A 2VP7A 3N9LA 2LDRA 4I7CA 2OXQC 4IC2A 5LCWB 2FUUA 2G6QA 2VPGA 5H1UA 2JM3A 3DDTA 1WEUA 2YHNA 2VJFB 3SUBA 2ECWA 2YSMA 5G0FA 2KR4A 5C11A 1Z60A 2LAUA 3LJUX 2DSMA 2NAAA 2M1RA 3L1XA 2JMDA 2KWKA 3ZVYA 2LV9A 3KDEC 2YHOA 5KH3A 4N4FA 4WZ2A 2CT2A 1U6GB 2H0DB 1DVPA 4GNGA 3NG2A 2PNXA 3ZPVE 3KQIA 3ZVZB 4MSXA 2AN6A 3HTKC 2CRRA 5SVIA 4AYCA 3DQVR 4O62A 4PTBA 2RSDA 2LRIC 4AP4A 3LRQA 4FO9A 4N3WA 4S3OB 2KKYA 1JOCA 4NN2A 2RI7A 5B76A 3T6RA 3GV4A 2ECGA 2CKLB 4F52B 2UZGA 3LQJA 2XOCA 2QJ0A 2ECNA 4BBQA 2IDAA 3N9PA 5H1TA 5AIUA 2MD8C 2MNYA 2CRWA 5TDWA 5B8DA 1X4IA 3SHBA 4A4BA 5C13A 2L7PA 1DCQA 3FEHA 2YW8A 5H9MA 4LADB 4B7YC 4CA1A 2KWOA 4FJCA 2KFTA 2L80A 5FB0A 3PUQA 2L75A 2L5UA 2BAYA 2K4DA 1WILA 2F42A 4QQ4A 2IQJA 3LVQE 5G05B 1MM2A 1WESA 3FL2A 3MHSA 4WA6A 3U5NA 1WFKA 5DINA 2VJFA 2EA6A 5TABA 2DJAA 3HCSA 1ZBDB 2XEUA 2EGMA 1WIMA 5DKAA 5TDRA 4H9DA 2L0BA 5D1KB 2MNZA 3JUEA 4R8PK 4QF2A 2KWNA 5SVYA 2YSJA 4IC3A 2LXHC 5TRBA 3LQHA 1WEEA 2HYED 4Z0RA 5G04B 2I50A 2YVRA 4LJNA 3O37A 4WZ0A 2FSAA 5KH7A 4X3GA 3M62A 3N9NA 4LK9A 2CKLA 1WEWA 1MBMA 4TKPB 2KKXA 5D1MB 5LKTA 4WZ3B 3GL6A 4A49A 2VPEA 2C2LA 2CSYA 2F6NA 3LDYA 3LVRE 2OWAA 1WEMA 4A0CD 2LN0A 2Y43A 2KYUA 4V3KC 3Q1DA 4ZDTA 2PUYA 2FFWA 1F62A 2XB1A 2KIZA 2Y1NA 3PLWA 4R7EA 5J3XA 3H7HA 2LGKA 2XOZA 4GNFA 3FANA 3T9KA 3FM8C 3ZTGA 2YQLA 3PHDA 2VJEA 2MA5A 4GB0A 4L7XA 3VK6A 3C6WA 3E2DA 5FERA 3O34A 4GNDA 4YADA 2JUNA 4UP0A 2D8UA 2FUIA 2ZETC 3U5MA 1CHCA 5EYAF 5B75A 4R2YA 2XP0A 3EB6A 2LGLA 5SVXA 4O64A 4MVTA 4V3LC 3U5PA 3LQIA 3M99A 2YUCA 4B86C 3KV6A 2F6JA 1WEPA 1WGMA 2DX8A 1Z2QA 2B0OE 4AUQB 2KE1A 3IHPA 3I2DA 2QICA 2VPBA 3N9MA 2G45A 3O35A 2YREA 4UI9B 1WEOA 1HYIA 2LGGA 2KREA 5K3QA 4PPEA 4F1PA 1HYJA 2M85A 3ZPV1 3DWDA 2EXUA 3HCTA 2M3HA 2JMIA 2H0DA 2ECTA 3QZVA 1JM7B 3ASLA 1WE9A 3O33A 1BORA 3N9OA 2MT5A 2E6RA 3O7AA 4YBTA 3PURA 2KWJA 2QIZA 1IYMA 2E6SA 2LXPC 4I7BA 4L58A 4Z0OA 2K17A 2M13A 2LGVA 2YURA 3O70A 1WEVA 3FAOA 2MA6A 2P57A 2CSZA 3KV5A 2D8SA 4OGEA 1X4UA 2MUMA 5I3LA 1T1HA 3O36A 3ZNIA 2M6MA 1MM3A 3M63A 4XI1A 2KGGA 5AITA 4ZQLA 5LKXA 1Z6UA 1RMDA 1E4UA 4I7DA 5TBNA 2FD4A 3N9QA 4FIPA 2L43A 3SOUA 2VNFA 3L1ZB 3T7LA 2EODA 4S3OC 5H1VA 2MD7B 2VPDA 3RPGC 2YT5A 2KGIA 1K2FA 1V87A 4QF3A 5B79A 1N87A 4LLBA 3V43A 2LQ6A
chains in the Genus database with same CATH topology
1VFYA 3RPGB 2G43A 3ZYQA 5D1LB 1WEQA 4YBMA 3MHHA 4BHWA 4CCGX 4A4CA 2YQMA 5LKUA 2EGPA 3C5KA 5FB1A 2KU3A 1G25A 1VD4A 2ECJA 3EB5A 2MIQA 4AYCB 4ZUXU 2ECVA 2JRJA 4Q6FA 4FK5A 3L11A 2K16A 4YBSA 4YATA 1FBVA 1WENA 3SOWA 1LDKC 2JMJA 4YAXA 1JM7A 2ECIA 2YU4A 5JG6A 4YABA 5LKZA 2VJEB 5B77A 2K1JA 3SOXA 1XWHA 5KH9A 2YYRA 4P5OB 5FEYA 3HCUA 4AVXA 4W4UA 4UP5A 3DPLR 3RTRB 3U5OA 1VYXA 4C9ZA 2HDPA 4LKAA 1LDJB 4GNEA 1X4JA 3KNVA 2Y1MA 2C2VS 5B78A 1FP0A 4YC9A 2VP7A 3N9LA 2LDRA 4I7CA 2OXQC 4IC2A 5LCWB 2FUUA 2G6QA 2VPGA 5H1UA 1WEUA 2YHNA 2VJFB 2ECWA 2YSMA 5G0FA 2KR4A 5C11A 1Z60A 2NAAA 2M1RA 3L1XA 2JMDA 2KWKA 3ZVYA 2LV9A 2YHOA 5KH3A 4N4FA 4WZ2A 2CT2A 1U6GB 2H0DB 1DVPA 4GNGA 3NG2A 2PNXA 3ZPVE 3KQIA 3ZVZB 4MSXA 2AN6A 3HTKC 4AYCA 3DQVR 4PTBA 2RSDA 2LRIC 4AP4A 3LRQA 4FO9A 4N3WA 4S3OB 1JOCA 4NN2A 2RI7A 5B76A 3T6RA 3GV4A 2ECGA 2CKLB 4F52B 2UZGA 3LQJA 2QJ0A 2ECNA 4BBQA 2IDAA 3N9PA 5H1TA 5AIUA 2MD8C 2MNYA 5TDWA 5B8DA 1X4IA 3SHBA 4A4BA 5C13A 2YW8A 5H9MA 4LADB 4B7YC 4CA1A 2KWOA 4FJCA 2KFTA 2L80A 5FB0A 3PUQA 2L75A 2L5UA 2BAYA 2K4DA 1WILA 2F42A 5G05B 1MM2A 1WESA 3FL2A 3MHSA 4WA6A 3U5NA 1WFKA 5DINA 2VJFA 2EA6A 5TABA 3HCSA 1ZBDB 2XEUA 1WIMA 5DKAA 5TDRA 5D1KB 2L0BA 2MNZA 4R8PK 4QF2A 2KWNA 2YSJA 4IC3A 2LXHC 5TRBA 3LQHA 1WEEA 2HYED 5G04B 2I50A 4LJNA 3O37A 4WZ0A 2FSAA 5KH7A 4X3GA 3M62A 3N9NA 4LK9A 2CKLA 1WEWA 4TKPB 5D1MB 5LKTA 4WZ3B 3GL6A 4A49A 2VPEA 2C2LA 2CSYA 2F6NA 1WEMA 4A0CD 2LN0A 2Y43A 2KYUA 4V3KC 4ZDTA 2PUYA 1F62A 2XB1A 2KIZA 2Y1NA 4R7EA 5J3XA 2LGKA 4GNFA 3ZTGA 2YQLA 3PHDA 2VJEA 2MA5A 4GB0A 4L7XA 3VK6A 3C6WA 5FERA 3O34A 4GNDA 4YADA 4UP0A 2FUIA 2ZETC 3U5MA 1CHCA 5EYAF 5B75A 4R2YA 3EB6A 2LGLA 4O64A 4MVTA 4V3LC 3U5PA 3LQIA 3M99A 2YUCA 4B86C 3KV6A 2F6JA 1WEPA 1WGMA 2DX8A 1Z2QA 4AUQB 2KE1A 3IHPA 3I2DA 2QICA 2VPBA 3N9MA 2G45A 3O35A 2YREA 4UI9B 1WEOA 1HYIA 2LGGA 2KREA 4PPEA 1HYJA 2M85A 3ZPV1 3HCTA 2M3HA 2JMIA 2H0DA 2ECTA 3QZVA 1JM7B 3ASLA 1WE9A 3O33A 1BORA 3N9OA 2MT5A 2E6RA 3O7AA 4YBTA 3PURA 2KWJA 2QIZA 1IYMA 2E6SA 2LXPC 4I7BA 4L58A 2K17A 2LGVA 2YURA 3O70A 1WEVA 2MA6A 2CSZA 3KV5A 2D8SA 1X4UA 2MUMA 5I3LA 1T1HA 3O36A 3ZNIA 2M6MA 1MM3A 3M63A 4XI1A 2KGGA 5AITA 4ZQLA 5LKXA 1Z6UA 1RMDA 1E4UA 4I7DA 5TBNA 3N9QA 4FIPA 2L43A 3SOUA 2VNFA 3L1ZB 3T7LA 2EODA 4S3OC 5H1VA 2MD7B 2VPDA 3RPGC 2YT5A 2KGIA 1K2FA 1V87A 4QF3A 5B79A 1N87A 4LLBA 3V43A 2LQ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VFY A;  3RPG B;  2G43 A;  3ZYQ A;  5D1L B;  1WEQ A;  4YBM A;  3MHH A;  4BHW A;  4CCG X;  4A4C A;  2YQM A;  5LKU A;  2EGP A;  3C5K A;  5FB1 A;  2KU3 A;  1G25 A;  1VD4 A;  2ECJ A;  3EB5 A;  2MIQ A;  4AYC B;  4ZUX U;  2ECV A;  2JRJ A;  4Q6F A;  4FK5 A;  3L11 A;  2K16 A;  4YBS A;  4YAT A;  1FBV A;  1WEN A;  3SOW A;  1LDK C;  2JMJ A;  4YAX A;  1JM7 A;  2ECI A;  2YU4 A;  5JG6 A;  4YAB A;  5LKZ A;  2VJE B;  5B77 A;  2K1J A;  3SOX A;  1XWH A;  5KH9 A;  2YYR A;  4P5O B;  5FEY A;  3HCU A;  4AVX A;  4W4U A;  4UP5 A;  3DPL R;  3RTR B;  3U5O A;  1VYX A;  4C9Z A;  2HDP A;  4LKA A;  1LDJ B;  4GNE A;  1X4J A;  3KNV A;  2Y1M A;  2C2V S;  5B78 A;  1FP0 A;  4YC9 A;  2VP7 A;  3N9L A;  2LDR A;  4I7C A;  2OXQ C;  4IC2 A;  5LCW B;  2FUU A;  2G6Q A;  2VPG A;  5H1U A;  1WEU A;  2YHN A;  2VJF B;  2ECW A;  2YSM A;  5G0F A;  2KR4 A;  5C11 A;  1Z60 A;  2NAA A;  2M1R A;  3L1X A;  2JMD A;  2KWK A;  3ZVY A;  2LV9 A;  2YHO A;  5KH3 A;  4N4F A;  4WZ2 A;  2CT2 A;  1U6G B;  2H0D B;  1DVP A;  4GNG A;  3NG2 A;  2PNX A;  3ZPV E;  3KQI A;  3ZVZ B;  4MSX A;  2AN6 A;  3HTK C;  4AYC A;  3DQV R;  4PTB A;  2RSD A;  2LRI C;  4AP4 A;  3LRQ A;  4FO9 A;  4N3W A;  4S3O B;  1JOC A;  4NN2 A;  2RI7 A;  5B76 A;  3T6R A;  3GV4 A;  2ECG A;  2CKL B;  4F52 B;  2UZG A;  3LQJ A;  2QJ0 A;  2ECN A;  4BBQ A;  2IDA A;  3N9P A;  5H1T A;  5AIU A;  2MD8 C;  2MNY A;  5TDW A;  5B8D A;  1X4I A;  3SHB A;  4A4B A;  5C13 A;  2YW8 A;  5H9M A;  4LAD B;  4B7Y C;  4CA1 A;  2KWO A;  4FJC A;  2KFT A;  2L80 A;  5FB0 A;  3PUQ A;  2L75 A;  2L5U A;  2BAY A;  2K4D A;  1WIL A;  2F42 A;  5G05 B;  1MM2 A;  1WES A;  3FL2 A;  3MHS A;  4WA6 A;  3U5N A;  1WFK A;  5DIN A;  2VJF A;  2EA6 A;  5TAB A;  3HCS A;  1ZBD B;  2XEU A;  1WIM A;  5DKA A;  5TDR A;  5D1K B;  2L0B A;  2MNZ A;  4R8P K;  4QF2 A;  2KWN A;  2YSJ A;  4IC3 A;  2LXH C;  5TRB A;  3LQH A;  1WEE A;  2HYE D;  5G04 B;  2I50 A;  4LJN A;  3O37 A;  4WZ0 A;  2FSA A;  5KH7 A;  4X3G A;  3M62 A;  3N9N A;  4LK9 A;  2CKL A;  1WEW A;  4TKP B;  5D1M B;  5LKT A;  4WZ3 B;  3GL6 A;  4A49 A;  2VPE A;  2C2L A;  2CSY A;  2F6N A;  1WEM A;  4A0C D;  2LN0 A;  2Y43 A;  2KYU A;  4V3K C;  4ZDT A;  2PUY A;  1F62 A;  2XB1 A;  2KIZ A;  2Y1N A;  4R7E A;  5J3X A;  2LGK A;  4GNF A;  3ZTG A;  2YQL A;  3PHD A;  2VJE A;  2MA5 A;  4GB0 A;  4L7X A;  3VK6 A;  3C6W A;  5FER A;  3O34 A;  4GND A;  4YAD A;  4UP0 A;  2FUI A;  2ZET C;  3U5M A;  1CHC A;  5EYA F;  5B75 A;  4R2Y A;  3EB6 A;  2LGL A;  4O64 A;  4MVT A;  4V3L C;  3U5P A;  3LQI A;  3M99 A;  2YUC A;  4B86 C;  3KV6 A;  2F6J A;  1WEP A;  1WGM A;  2DX8 A;  1Z2Q A;  4AUQ B;  2KE1 A;  3IHP A;  3I2D A;  2QIC A;  2VPB A;  3N9M A;  2G45 A;  3O35 A;  2YRE A;  4UI9 B;  1WEO A;  1HYI A;  2LGG A;  2KRE A;  4PPE A;  1HYJ A;  2M85 A;  3ZPV 1;  3HCT A;  2M3H A;  2JMI A;  2H0D A;  2ECT A;  3QZV A;  1JM7 B;  3ASL A;  1WE9 A;  3O33 A;  1BOR A;  3N9O A;  2MT5 A;  2E6R A;  3O7A A;  4YBT A;  3PUR A;  2KWJ A;  2QIZ A;  1IYM A;  2E6S A;  2LXP C;  4I7B A;  4L58 A;  2K17 A;  2LGV A;  2YUR A;  3O70 A;  1WEV A;  2MA6 A;  2CSZ A;  3KV5 A;  2D8S A;  1X4U A;  2MUM A;  5I3L A;  1T1H A;  3O36 A;  3ZNI A;  2M6M A;  1MM3 A;  3M63 A;  4XI1 A;  2KGG A;  5AIT A;  4ZQL A;  5LKX A;  1Z6U A;  1RMD A;  1E4U A;  4I7D A;  5TBN A;  3N9Q A;  4FIP A;  2L43 A;  3SOU A;  2VNF A;  3L1Z B;  3T7L A;  2EOD A;  4S3O C;  5H1V A;  2MD7 B;  2VPD A;  3RPG C;  2YT5 A;  2KGI A;  1K2F A;  1V87 A;  4QF3 A;  5B79 A;  1N87 A;  4LLB A;  3V43 A;  2LQ6 A; 
#chains in the Genus database with same CATH topology
 1VFY A;  3RPG B;  2G43 A;  3ZYQ A;  2CON A;  5D1L B;  1WEQ A;  4YBM A;  3MHH A;  4BHW A;  4CCG X;  4OGC A;  4A4C A;  2YQM A;  5LKU A;  2EGP A;  3C5K A;  5FB1 A;  2KU3 A;  1G25 A;  2CSV A;  1VD4 A;  5SVI B;  2ECJ A;  3EB5 A;  3M7K A;  2MIQ A;  4AYC B;  4ZUX U;  2ECV A;  2JRJ A;  4Q6F A;  4FK5 A;  3L11 A;  2K16 A;  3O47 A;  4YBS A;  4YAT A;  1FBV A;  1WEN A;  3SOW A;  1LDK C;  2JMJ A;  4YAX A;  1JM7 A;  2ECI A;  2YU4 A;  5JG6 A;  4YAB A;  3FJU B;  5LKZ A;  2VJE B;  5B77 A;  2K1J A;  2MKE A;  3SOX A;  1XWH A;  5KH9 A;  2YYR A;  4P5O B;  5FEY A;  3HCU A;  4AVX A;  4W4U A;  4UP5 A;  3DPL R;  3RTR B;  2XOY A;  3U5O A;  1VYX A;  4C9Z A;  2HDP A;  4LKA A;  1LDJ B;  4GNE A;  1X4J A;  3KNV A;  2Y1M A;  2C2V S;  2RR4 A;  5B78 A;  1FP0 A;  2E61 A;  3MDB C;  4YC9 A;  2VP7 A;  3N9L A;  2LDR A;  4I7C A;  2OXQ C;  4IC2 A;  5LCW B;  2FUU A;  2G6Q A;  2VPG A;  5H1U A;  2JM3 A;  3DDT A;  1WEU A;  2YHN A;  2VJF B;  3SUB A;  2ECW A;  2YSM A;  5G0F A;  2KR4 A;  5C11 A;  1Z60 A;  2LAU A;  3LJU X;  2DSM A;  2NAA A;  2M1R A;  3L1X A;  2JMD A;  2KWK A;  3ZVY A;  2LV9 A;  3KDE C;  2YHO A;  5KH3 A;  4N4F A;  4WZ2 A;  2CT2 A;  1U6G B;  2H0D B;  1DVP A;  4GNG A;  3NG2 A;  2PNX A;  3ZPV E;  3KQI A;  3ZVZ B;  4MSX A;  2AN6 A;  3HTK C;  2CRR A;  5SVI A;  4AYC A;  3DQV R;  4O62 A;  4PTB A;  2RSD A;  2LRI C;  4AP4 A;  3LRQ A;  4FO9 A;  4N3W A;  4S3O B;  2KKY A;  1JOC A;  4NN2 A;  2RI7 A;  5B76 A;  3T6R A;  3GV4 A;  2ECG A;  2CKL B;  4F52 B;  2UZG A;  3LQJ A;  2XOC A;  2QJ0 A;  2ECN A;  4BBQ A;  2IDA A;  3N9P A;  5H1T A;  5AIU A;  2MD8 C;  2MNY A;  2CRW A;  5TDW A;  5B8D A;  1X4I A;  3SHB A;  4A4B A;  5C13 A;  2L7P A;  1DCQ A;  3FEH A;  2YW8 A;  5H9M A;  4LAD B;  4B7Y C;  4CA1 A;  2KWO A;  4FJC A;  2KFT A;  2L80 A;  5FB0 A;  3PUQ A;  2L75 A;  2L5U A;  2BAY A;  2K4D A;  1WIL A;  2F42 A;  4QQ4 A;  2IQJ A;  3LVQ E;  5G05 B;  1MM2 A;  1WES A;  3FL2 A;  3MHS A;  4WA6 A;  3U5N A;  1WFK A;  5DIN A;  2VJF A;  2EA6 A;  5TAB A;  2DJA A;  3HCS A;  1ZBD B;  2XEU A;  2EGM A;  1WIM A;  5DKA A;  5TDR A;  4H9D A;  2L0B A;  5D1K B;  2MNZ A;  3JUE A;  4R8P K;  4QF2 A;  2KWN A;  5SVY A;  2YSJ A;  4IC3 A;  2LXH C;  5TRB A;  3LQH A;  1WEE A;  2HYE D;  4Z0R A;  5G04 B;  2I50 A;  2YVR A;  4LJN A;  3O37 A;  4WZ0 A;  2FSA A;  5KH7 A;  4X3G A;  3M62 A;  3N9N A;  4LK9 A;  2CKL A;  1WEW A;  1MBM A;  4TKP B;  2KKX A;  5D1M B;  5LKT A;  4WZ3 B;  3GL6 A;  4A49 A;  2VPE A;  2C2L A;  2CSY A;  2F6N A;  3LDY A;  3LVR E;  2OWA A;  1WEM A;  4A0C D;  2LN0 A;  2Y43 A;  2KYU A;  4V3K C;  3Q1D A;  4ZDT A;  2PUY A;  2FFW A;  1F62 A;  2XB1 A;  2KIZ A;  2Y1N A;  3PLW A;  4R7E A;  5J3X A;  3H7H A;  2LGK A;  2XOZ A;  4GNF A;  3FAN A;  3T9K A;  3FM8 C;  3ZTG A;  2YQL A;  3PHD A;  2VJE A;  2MA5 A;  4GB0 A;  4L7X A;  3VK6 A;  3C6W A;  3E2D A;  5FER A;  3O34 A;  4GND A;  4YAD A;  2JUN A;  4UP0 A;  2D8U A;  2FUI A;  2ZET C;  3U5M A;  1CHC A;  5EYA F;  5B75 A;  4R2Y A;  2XP0 A;  3EB6 A;  2LGL A;  5SVX A;  4O64 A;  4MVT A;  4V3L C;  3U5P A;  3LQI A;  3M99 A;  2YUC A;  4B86 C;  3KV6 A;  2F6J A;  1WEP A;  1WGM A;  2DX8 A;  1Z2Q A;  2B0O E;  4AUQ B;  2KE1 A;  3IHP A;  3I2D A;  2QIC A;  2VPB A;  3N9M A;  2G45 A;  3O35 A;  2YRE A;  4UI9 B;  1WEO A;  1HYI A;  2LGG A;  2KRE A;  5K3Q A;  4PPE A;  4F1P A;  1HYJ A;  2M85 A;  3ZPV 1;  3DWD A;  2EXU A;  3HCT A;  2M3H A;  2JMI A;  2H0D A;  2ECT A;  3QZV A;  1JM7 B;  3ASL A;  1WE9 A;  3O33 A;  1BOR A;  3N9O A;  2MT5 A;  2E6R A;  3O7A A;  4YBT A;  3PUR A;  2KWJ A;  2QIZ A;  1IYM A;  2E6S A;  2LXP C;  4I7B A;  4L58 A;  4Z0O A;  2K17 A;  2M13 A;  2LGV A;  2YUR A;  3O70 A;  1WEV A;  3FAO A;  2MA6 A;  2P57 A;  2CSZ A;  3KV5 A;  2D8S A;  4OGE A;  1X4U A;  2MUM A;  5I3L A;  1T1H A;  3O36 A;  3ZNI A;  2M6M A;  1MM3 A;  3M63 A;  4XI1 A;  2KGG A;  5AIT A;  4ZQL A;  5LKX A;  1Z6U A;  1RMD A;  1E4U A;  4I7D A;  5TBN A;  2FD4 A;  3N9Q A;  4FIP A;  2L43 A;  3SOU A;  2VNF A;  3L1Z B;  3T7L A;  2EOD A;  4S3O C;  5H1V A;  2MD7 B;  2VPD A;  3RPG C;  2YT5 A;  2KGI A;  1K2F A;  1V87 A;  4QF3 A;  5B79 A;  1N87 A;  4LLB A;  3V43 A;  2LQ6 A; 
#chains in the Genus database with same CATH homology
 1VFY A;  3RPG B;  2G43 A;  3ZYQ A;  5D1L B;  1WEQ A;  4YBM A;  3MHH A;  4BHW A;  4CCG X;  4A4C A;  2YQM A;  5LKU A;  2EGP A;  3C5K A;  5FB1 A;  2KU3 A;  1G25 A;  1VD4 A;  2ECJ A;  3EB5 A;  2MIQ A;  4AYC B;  4ZUX U;  2ECV A;  2JRJ A;  4Q6F A;  4FK5 A;  3L11 A;  2K16 A;  4YBS A;  4YAT A;  1FBV A;  1WEN A;  3SOW A;  1LDK C;  2JMJ A;  4YAX A;  1JM7 A;  2ECI A;  2YU4 A;  5JG6 A;  4YAB A;  5LKZ A;  2VJE B;  5B77 A;  2K1J A;  3SOX A;  1XWH A;  5KH9 A;  2YYR A;  4P5O B;  5FEY A;  3HCU A;  4AVX A;  4W4U A;  4UP5 A;  3DPL R;  3RTR B;  3U5O A;  1VYX A;  4C9Z A;  2HDP A;  4LKA A;  1LDJ B;  4GNE A;  1X4J A;  3KNV A;  2Y1M A;  2C2V S;  5B78 A;  1FP0 A;  4YC9 A;  2VP7 A;  3N9L A;  2LDR A;  4I7C A;  2OXQ C;  4IC2 A;  5LCW B;  2FUU A;  2G6Q A;  2VPG A;  5H1U A;  1WEU A;  2YHN A;  2VJF B;  2ECW A;  2YSM A;  5G0F A;  2KR4 A;  5C11 A;  1Z60 A;  2NAA A;  2M1R A;  3L1X A;  2JMD A;  2KWK A;  3ZVY A;  2LV9 A;  2YHO A;  5KH3 A;  4N4F A;  4WZ2 A;  2CT2 A;  1U6G B;  2H0D B;  1DVP A;  4GNG A;  3NG2 A;  2PNX A;  3ZPV E;  3KQI A;  3ZVZ B;  4MSX A;  2AN6 A;  3HTK C;  4AYC A;  3DQV R;  4PTB A;  2RSD A;  2LRI C;  4AP4 A;  3LRQ A;  4FO9 A;  4N3W A;  4S3O B;  1JOC A;  4NN2 A;  2RI7 A;  5B76 A;  3T6R A;  3GV4 A;  2ECG A;  2CKL B;  4F52 B;  2UZG A;  3LQJ A;  2QJ0 A;  2ECN A;  4BBQ A;  2IDA A;  3N9P A;  5H1T A;  5AIU A;  2MD8 C;  2MNY A;  5TDW A;  5B8D A;  1X4I A;  3SHB A;  4A4B A;  5C13 A;  2YW8 A;  5H9M A;  4LAD B;  4B7Y C;  4CA1 A;  2KWO A;  4FJC A;  2KFT A;  2L80 A;  5FB0 A;  3PUQ A;  2L75 A;  2L5U A;  2BAY A;  2K4D A;  1WIL A;  2F42 A;  5G05 B;  1MM2 A;  1WES A;  3FL2 A;  3MHS A;  4WA6 A;  3U5N A;  1WFK A;  5DIN A;  2VJF A;  2EA6 A;  5TAB A;  3HCS A;  1ZBD B;  2XEU A;  1WIM A;  5DKA A;  5TDR A;  5D1K B;  2L0B A;  2MNZ A;  4R8P K;  4QF2 A;  2KWN A;  2YSJ A;  4IC3 A;  2LXH C;  5TRB A;  3LQH A;  1WEE A;  2HYE D;  5G04 B;  2I50 A;  4LJN A;  3O37 A;  4WZ0 A;  2FSA A;  5KH7 A;  4X3G A;  3M62 A;  3N9N A;  4LK9 A;  2CKL A;  1WEW A;  4TKP B;  5D1M B;  5LKT A;  4WZ3 B;  3GL6 A;  4A49 A;  2VPE A;  2C2L A;  2CSY A;  2F6N A;  1WEM A;  4A0C D;  2LN0 A;  2Y43 A;  2KYU A;  4V3K C;  4ZDT A;  2PUY A;  1F62 A;  2XB1 A;  2KIZ A;  2Y1N A;  4R7E A;  5J3X A;  2LGK A;  4GNF A;  3ZTG A;  2YQL A;  3PHD A;  2VJE A;  2MA5 A;  4GB0 A;  4L7X A;  3VK6 A;  3C6W A;  5FER A;  3O34 A;  4GND A;  4YAD A;  4UP0 A;  2FUI A;  2ZET C;  3U5M A;  1CHC A;  5EYA F;  5B75 A;  4R2Y A;  3EB6 A;  2LGL A;  4O64 A;  4MVT A;  4V3L C;  3U5P A;  3LQI A;  3M99 A;  2YUC A;  4B86 C;  3KV6 A;  2F6J A;  1WEP A;  1WGM A;  2DX8 A;  1Z2Q A;  4AUQ B;  2KE1 A;  3IHP A;  3I2D A;  2QIC A;  2VPB A;  3N9M A;  2G45 A;  3O35 A;  2YRE A;  4UI9 B;  1WEO A;  1HYI A;  2LGG A;  2KRE A;  4PPE A;  1HYJ A;  2M85 A;  3ZPV 1;  3HCT A;  2M3H A;  2JMI A;  2H0D A;  2ECT A;  3QZV A;  1JM7 B;  3ASL A;  1WE9 A;  3O33 A;  1BOR A;  3N9O A;  2MT5 A;  2E6R A;  3O7A A;  4YBT A;  3PUR A;  2KWJ A;  2QIZ A;  1IYM A;  2E6S A;  2LXP C;  4I7B A;  4L58 A;  2K17 A;  2LGV A;  2YUR A;  3O70 A;  1WEV A;  2MA6 A;  2CSZ A;  3KV5 A;  2D8S A;  1X4U A;  2MUM A;  5I3L A;  1T1H A;  3O36 A;  3ZNI A;  2M6M A;  1MM3 A;  3M63 A;  4XI1 A;  2KGG A;  5AIT A;  4ZQL A;  5LKX A;  1Z6U A;  1RMD A;  1E4U A;  4I7D A;  5TBN A;  3N9Q A;  4FIP A;  2L43 A;  3SOU A;  2VNF A;  3L1Z B;  3T7L A;  2EOD A;  4S3O C;  5H1V A;  2MD7 B;  2VPD A;  3RPG C;  2YT5 A;  2KGI A;  1K2F A;  1V87 A;  4QF3 A;  5B79 A;  1N87 A;  4LLB A;  3V43 A;  2LQ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...