1N87A

Solution structure of the u-box of prp19
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
56
structure length
56
Chain Sequence
b'MLCAISGKVPRRPVLSPKSRTIFEKSLLEQYVKDTGNDPITNEPLSIEEIVEIVPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA splicing factor PRP19
publication title Structural insights into the U-box, a domain associated with multi-ubiquitination
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ligase/cell cycle
total genus 14
structure length 56
sequence length 56
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2002-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1n87A00
2CSZA 1X4IA 3O35A 5LCWB 4A4BA 3NG2A 4LK9A 4N3WA 1N87A 1VFYA 4V3LC 2PNXA 3T7LA 3GL6A 2ECNA 1FP0A 2YSMA 3C5KA 4R8PK 3PHDA 5LKTA 2JMDA 2CKLA 4WZ2A 3SOXA 2VP7A 4YBSA 1FBVA 2I50A 1T1HA 4GNEA 2KWKA 2LRIC 4B7YC 3O36A 4CA1A 3O37A 5G04B 5FB1A 2YQMA 2CKLB 2OXQC 1WILA 5I3LA 5DINA 2KWOA 5D1KB 2K16A 3I2DA 3U5OA 1WEWA 2KIZA 4L58A 5TDWA 2KGGA 1WIMA 3ZTGA 4WZ0A 2C2VS 2YU4A 2M3HA 5TBNA 3N9QA 3ZVYA 4BHWA 1Z2QA 2VPBA 4LKAA 2D8SA 1DVPA 2BAYA 2YQLA 3MHHA 3KQIA 2JMJA 4I7DA 4A0CD 2FUUA 3O33A 1WGMA 4IC3A 4LADB 5AIUA 4YADA 5B8DA 2F42A 3ZPV1 5C11A 5H1VA 2LGKA 2G45A 4O64A 5H1TA 4LLBA 2VPGA 5TRBA 4R2YA 2KWJA 4L7XA 2LXPC 1F62A 4AUQB 5FEYA 2YREA 2YT5A 5AITA 2JMIA 4MSXA 2LV9A 4YC9A 1IYMA 2YW8A 3SOWA 1JOCA 2ECVA 2MA5A 3EB5A 4ZQLA 5J3XA 4BBQA 2Y1NA 1XWHA 3RTRB 3M99A 5B79A 4B86C 2KFTA 5EYAF 3GV4A 4A49A 1WFKA 2LGGA 3N9MA 2RSDA 2KYUA 2C2LA 2M85A 3HCUA 2ECTA 3ASLA 2VJFA 3L1ZB 3U5NA 4ZUXU 2ECGA 2M6MA 2YUCA 4YBMA 2IDAA 2YYRA 3RPGB 2CT2A 3HTKC 5TDRA 5D1MB 4FO9A 4QF2A 2YSJA 5B78A 2LGLA 3ZNIA 2VJFB 3M62A 1VYXA 5DKAA 2L5UA 5B76A 1WENA 1HYIA 2VPDA 3ZYQA 2L0BA 1WEVA 4FK5A 3N9OA 3O34A 1LDKC 1WEMA 2ECIA 4Q6FA 4S3OB 4V3KC 2MIQA 4A4CA 3M63A 2KE1A 5B75A 2K17A 2NAAA 4YBTA 2HDPA 4I7BA 4UI9B 5LKZA 2Y1MA 3U5MA 1ZBDB 5KH3A 1U6GB 2L75A 4X3GA 4N4FA 1LDJB 1WEEA 3V43A 2G6QA 2K4DA 2MT5A 4UP0A 4CCGX 3N9LA 3U5PA 2EA6A 1WE9A 2EODA 2YHNA 2MD7B 3LRQA 4R7EA 1CHCA 1WEOA 5G05B 4YATA 2LXHC 4GNGA 4LJNA 2KREA 3SOUA 5KH9A 4AYCA 2KR4A 2HYED 3ZPVE 1K2FA 2E6SA 4WZ3B 1X4UA 3KV6A 4UP5A 2LN0A 5LKUA 4AYCB 2QJ0A 3LQIA 2G43A 3RPGC 5H9MA 2AN6A 5LKXA 4FIPA 3DPLR 1MM2A 2RI7A 2YURA 4NN2A 2F6JA 1VD4A 2ZETC 5G0FA 2FUIA 3N9NA 3L11A 2VNFA 3LQJA 4FJCA 3HCTA 5JG6A 2L43A 5H1UA 4MVTA 1Z60A 3PURA 2ECWA 2LDRA 2MNZA 2DX8A 1RMDA 3O7AA 1WEQA 3L1XA 3MHSA 2JRJA 4S3OC 2MA6A 2YHOA 1BORA 2QICA 5FERA 4PTBA 2LQ6A 4AVXA 2MUMA 3C6WA 2QIZA 3ZVZB 2FSAA 2F6NA 1WESA 5C13A 5FB0A 3IHPA 3HCSA 2XB1A 4C9ZA 2Y43A 1HYJA 1X4JA 4IC2A 2L80A 4GB0A 4GNDA 1WEUA 4QF3A 1JM7A 2MD8C 1MM3A 4AP4A 5KH7A 2EGPA 2H0DA 3KNVA 4PPEA 5D1LB 2K1JA 2UZGA 4YAXA 3FL2A 2M1RA 1JM7B 2KGIA 5TABA 2MNYA 3LQHA 3DQVR 4I7CA 4XI1A 4GNFA 2H0DB 4WA6A 3PUQA 2PUYA 2VJEA 2XEUA 4ZDTA 2E6RA 1G25A 3EB6A 2ECJA 1E4UA 5B77A 2CSYA 2LGVA 4TKPB 4P5OB 3T6RA 3VK6A 2KU3A 4W4UA 1WEPA 3SHBA 3KV5A 2VJEB 1Z6UA 3QZVA 2KWNA 4F52B 4YABA 1V87A 3O70A 3N9PA 2VPEA
chains in the Genus database with same CATH superfamily
4OGEA 2CSZA 3E2DA 1X4IA 3O35A 5LCWB 4A4BA 3NG2A 4LK9A 4N3WA 1N87A 1VFYA 4V3LC 3M7KA 2PNXA 2XOZA 3T7LA 3GL6A 2ECNA 1FP0A 2YSMA 3C5KA 4R8PK 3PHDA 2XOCA 5LKTA 2JMDA 2CKLA 2OWAA 4WZ2A 3SOXA 2VP7A 4YBSA 1FBVA 2I50A 1T1HA 4GNEA 2EXUA 2KWKA 2LAUA 2DSMA 2LRIC 4Z0OA 4B7YC 3O36A 4CA1A 2XOYA 3O37A 5G04B 5FB1A 2YQMA 2CKLB 2OXQC 1WILA 5I3LA 5DINA 2KWOA 5D1KB 2K16A 3I2DA 3U5OA 1WEWA 2KIZA 4L58A 2KKYA 5TDWA 2KGGA 1WIMA 4QQ4A 3ZTGA 4WZ0A 2C2VS 3JUEA 2YU4A 2M3HA 5TBNA 3N9QA 3ZVYA 4BHWA 1Z2QA 2VPBA 4LKAA 2D8SA 1DVPA 2D8UA 2CRWA 2BAYA 2YQLA 3DDTA 2KKXA 3MHHA 2CRRA 3KQIA 3DWDA 2JMJA 4I7DA 3Q1DA 4A0CD 2FUUA 3O33A 4LADB 1WGMA 3LJUX 4IC3A 5AIUA 4YADA 2FFWA 5B8DA 2F42A 3ZPV1 2P57A 4Z0RA 2M13A 5SVYA 5C11A 5H1VA 2LGKA 2G45A 4O64A 5H1TA 4LLBA 2VPGA 5TRBA 4R2YA 2KWJA 4L7XA 2LXPC 1F62A 4AUQB 5FEYA 2YREA 3T9KA 2YT5A 5AITA 2JMIA 4MSXA 3FANA 2LV9A 4OGCA 4YC9A 1IYMA 2YW8A 3SOWA 1JOCA 2ECVA 2MA5A 5SVXA 3EB5A 3O47A 3LVQE 2CONA 4ZQLA 4H9DA 5J3XA 4BBQA 2Y1NA 1XWHA 3RTRB 3M99A 2JM3A 5B79A 4B86C 2KFTA 5EYAF 4F1PA 3FM8C 3GV4A 4A49A 1WFKA 2LGGA 3N9MA 2RSDA 2KYUA 2C2LA 2M85A 3HCUA 2ECTA 3ASLA 2VJFA 3L1ZB 3U5NA 4ZUXU 2ECGA 2M6MA 2YUCA 4YBMA 2CSVA 2IDAA 2YYRA 3RPGB 2CT2A 3HTKC 5TDRA 5D1MB 4FO9A 4QF2A 2YSJA 5B78A 2B0OE 2LGLA 3ZNIA 2VJFB 3M62A 1VYXA 5DKAA 2L5UA 5B76A 1WENA 1HYIA 2VPDA 3ZYQA 2L0BA 1WEVA 4FK5A 2L7PA 3N9OA 3O34A 1LDKC 1WEMA 2ECIA 4Q6FA 4S3OB 4V3KC 2MIQA 4A4CA 3M63A 2KE1A 5B75A 2K17A 2NAAA 4YBTA 2HDPA 4I7BA 4UI9B 5LKZA 2Y1MA 3U5MA 1ZBDB 5KH3A 1U6GB 3FJUB 2L75A 4X3GA 4N4FA 1LDJB 2IQJA 1WEEA 3V43A 2G6QA 2K4DA 2MT5A 4UP0A 4CCGX 2RR4A 3N9LA 3U5PA 2EA6A 1WE9A 2EODA 2YHNA 2MD7B 3LRQA 2MKEA 4R7EA 1CHCA 1WEOA 5G05B 2DJAA 4YATA 2LXHC 4GNGA 4LJNA 3FAOA 5K3QA 2KREA 3LVRE 3SOUA 5KH9A 4AYCA 2KR4A 2HYED 3ZPVE 1K2FA 5SVIA 2JUNA 2E6SA 2E61A 4WZ3B 1X4UA 3KV6A 4UP5A 2FD4A 2LN0A 3KDEC 5LKUA 4AYCB 2QJ0A 3LDYA 5SVIB 3LQIA 2G43A 3RPGC 5H9MA 2AN6A 5LKXA 4FIPA 3DPLR 1MM2A 2RI7A 2YURA 4NN2A 2F6JA 1VD4A 2ZETC 2FUIA 5G0FA 3N9NA 3L11A 2VNFA 3LQJA 3MDBC 4FJCA 3HCTA 5JG6A 2L43A 5H1UA 3FEHA 4MVTA 1Z60A 3PURA 2ECWA 2LDRA 2MNZA 2DX8A 1RMDA 3O7AA 1WEQA 3L1XA 3MHSA 2JRJA 4S3OC 2MA6A 3H7HA 2YHOA 1BORA 2QICA 5FERA 4PTBA 2YVRA 1MBMA 2LQ6A 4AVXA 2MUMA 3C6WA 2QIZA 3ZVZB 2FSAA 2F6NA 1WESA 5C13A 5FB0A 3IHPA 3HCSA 2XB1A 4C9ZA 2Y43A 1HYJA 1X4JA 4IC2A 2L80A 4GB0A 4GNDA 1WEUA 4QF3A 1JM7A 2MD8C 1MM3A 4AP4A 5KH7A 2EGPA 1DCQA 2H0DA 3KNVA 4PPEA 5D1LB 2K1JA 2UZGA 4YAXA 3FL2A 2M1RA 2XP0A 1JM7B 2KGIA 5TABA 2MNYA 3LQHA 2EGMA 3DQVR 4I7CA 4XI1A 4GNFA 2H0DB 4WA6A 3PUQA 2PUYA 2VJEA 2XEUA 4ZDTA 2E6RA 3PLWA 4O62A 3EB6A 1G25A 2ECJA 1E4UA 5B77A 2CSYA 2LGVA 4TKPB 4P5OB 3T6RA 3VK6A 2KU3A 3SUBA 4W4UA 1WEPA 3SHBA 3KV5A 2VJEB 1Z6UA 3QZVA 2KWNA 4F52B 4YABA 1V87A 3O70A 3N9PA 2VPEA
chains in the Genus database with same CATH topology
2CSZA 1X4IA 3O35A 5LCWB 4A4BA 3NG2A 4LK9A 4N3WA 1N87A 1VFYA 4V3LC 2PNXA 3T7LA 3GL6A 2ECNA 1FP0A 2YSMA 3C5KA 4R8PK 3PHDA 5LKTA 2JMDA 2CKLA 4WZ2A 3SOXA 2VP7A 4YBSA 1FBVA 2I50A 1T1HA 4GNEA 2KWKA 2LRIC 4B7YC 3O36A 4CA1A 3O37A 5G04B 5FB1A 2YQMA 2CKLB 2OXQC 1WILA 5I3LA 5DINA 2KWOA 5D1KB 2K16A 3I2DA 3U5OA 1WEWA 2KIZA 4L58A 5TDWA 2KGGA 1WIMA 3ZTGA 4WZ0A 2C2VS 2YU4A 2M3HA 5TBNA 3N9QA 3ZVYA 4BHWA 1Z2QA 2VPBA 4LKAA 2D8SA 1DVPA 2BAYA 2YQLA 3MHHA 3KQIA 2JMJA 4I7DA 4A0CD 2FUUA 3O33A 1WGMA 4IC3A 4LADB 5AIUA 4YADA 5B8DA 2F42A 3ZPV1 5C11A 5H1VA 2LGKA 2G45A 4O64A 5H1TA 4LLBA 2VPGA 5TRBA 4R2YA 2KWJA 4L7XA 2LXPC 1F62A 4AUQB 5FEYA 2YREA 2YT5A 5AITA 2JMIA 4MSXA 2LV9A 4YC9A 1IYMA 2YW8A 3SOWA 1JOCA 2ECVA 2MA5A 3EB5A 4ZQLA 5J3XA 4BBQA 2Y1NA 1XWHA 3RTRB 3M99A 5B79A 4B86C 2KFTA 5EYAF 3GV4A 4A49A 1WFKA 2LGGA 3N9MA 2RSDA 2KYUA 2C2LA 2M85A 3HCUA 2ECTA 3ASLA 2VJFA 3L1ZB 3U5NA 4ZUXU 2ECGA 2M6MA 2YUCA 4YBMA 2IDAA 2YYRA 3RPGB 2CT2A 3HTKC 5TDRA 5D1MB 4FO9A 4QF2A 2YSJA 5B78A 2LGLA 3ZNIA 2VJFB 3M62A 1VYXA 5DKAA 2L5UA 5B76A 1WENA 1HYIA 2VPDA 3ZYQA 2L0BA 1WEVA 4FK5A 3N9OA 3O34A 1LDKC 1WEMA 2ECIA 4Q6FA 4S3OB 4V3KC 2MIQA 4A4CA 3M63A 2KE1A 5B75A 2K17A 2NAAA 4YBTA 2HDPA 4I7BA 4UI9B 5LKZA 2Y1MA 3U5MA 1ZBDB 5KH3A 1U6GB 2L75A 4X3GA 4N4FA 1LDJB 1WEEA 3V43A 2G6QA 2K4DA 2MT5A 4UP0A 4CCGX 3N9LA 3U5PA 2EA6A 1WE9A 2EODA 2YHNA 2MD7B 3LRQA 4R7EA 1CHCA 1WEOA 5G05B 4YATA 2LXHC 4GNGA 4LJNA 2KREA 3SOUA 5KH9A 4AYCA 2KR4A 2HYED 3ZPVE 1K2FA 2E6SA 4WZ3B 1X4UA 3KV6A 4UP5A 2LN0A 5LKUA 4AYCB 2QJ0A 3LQIA 2G43A 3RPGC 5H9MA 2AN6A 5LKXA 4FIPA 3DPLR 1MM2A 2RI7A 2YURA 4NN2A 2F6JA 1VD4A 2ZETC 5G0FA 2FUIA 3N9NA 3L11A 2VNFA 3LQJA 4FJCA 3HCTA 5JG6A 2L43A 5H1UA 4MVTA 1Z60A 3PURA 2ECWA 2LDRA 2MNZA 2DX8A 1RMDA 3O7AA 1WEQA 3L1XA 3MHSA 2JRJA 4S3OC 2MA6A 2YHOA 1BORA 2QICA 5FERA 4PTBA 2LQ6A 4AVXA 2MUMA 3C6WA 2QIZA 3ZVZB 2FSAA 2F6NA 1WESA 5C13A 5FB0A 3IHPA 3HCSA 2XB1A 4C9ZA 2Y43A 1HYJA 1X4JA 4IC2A 2L80A 4GB0A 4GNDA 1WEUA 4QF3A 1JM7A 2MD8C 1MM3A 4AP4A 5KH7A 2EGPA 2H0DA 3KNVA 4PPEA 5D1LB 2K1JA 2UZGA 4YAXA 3FL2A 2M1RA 1JM7B 2KGIA 5TABA 2MNYA 3LQHA 3DQVR 4I7CA 4XI1A 4GNFA 2H0DB 4WA6A 3PUQA 2PUYA 2VJEA 2XEUA 4ZDTA 2E6RA 1G25A 3EB6A 2ECJA 1E4UA 5B77A 2CSYA 2LGVA 4TKPB 4P5OB 3T6RA 3VK6A 2KU3A 4W4UA 1WEPA 3SHBA 3KV5A 2VJEB 1Z6UA 3QZVA 2KWNA 4F52B 4YABA 1V87A 3O70A 3N9PA 2VPEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CSZ A;  1X4I A;  3O35 A;  5LCW B;  4A4B A;  3NG2 A;  4LK9 A;  4N3W A;  1N87 A;  1VFY A;  4V3L C;  2PNX A;  3T7L A;  3GL6 A;  2ECN A;  1FP0 A;  2YSM A;  3C5K A;  4R8P K;  3PHD A;  5LKT A;  2JMD A;  2CKL A;  4WZ2 A;  3SOX A;  2VP7 A;  4YBS A;  1FBV A;  2I50 A;  1T1H A;  4GNE A;  2KWK A;  2LRI C;  4B7Y C;  3O36 A;  4CA1 A;  3O37 A;  5G04 B;  5FB1 A;  2YQM A;  2CKL B;  2OXQ C;  1WIL A;  5I3L A;  5DIN A;  2KWO A;  5D1K B;  2K16 A;  3I2D A;  3U5O A;  1WEW A;  2KIZ A;  4L58 A;  5TDW A;  2KGG A;  1WIM A;  3ZTG A;  4WZ0 A;  2C2V S;  2YU4 A;  2M3H A;  5TBN A;  3N9Q A;  3ZVY A;  4BHW A;  1Z2Q A;  2VPB A;  4LKA A;  2D8S A;  1DVP A;  2BAY A;  2YQL A;  3MHH A;  3KQI A;  2JMJ A;  4I7D A;  4A0C D;  2FUU A;  3O33 A;  1WGM A;  4IC3 A;  4LAD B;  5AIU A;  4YAD A;  5B8D A;  2F42 A;  3ZPV 1;  5C11 A;  5H1V A;  2LGK A;  2G45 A;  4O64 A;  5H1T A;  4LLB A;  2VPG A;  5TRB A;  4R2Y A;  2KWJ A;  4L7X A;  2LXP C;  1F62 A;  4AUQ B;  5FEY A;  2YRE A;  2YT5 A;  5AIT A;  2JMI A;  4MSX A;  2LV9 A;  4YC9 A;  1IYM A;  2YW8 A;  3SOW A;  1JOC A;  2ECV A;  2MA5 A;  3EB5 A;  4ZQL A;  5J3X A;  4BBQ A;  2Y1N A;  1XWH A;  3RTR B;  3M99 A;  5B79 A;  4B86 C;  2KFT A;  5EYA F;  3GV4 A;  4A49 A;  1WFK A;  2LGG A;  3N9M A;  2RSD A;  2KYU A;  2C2L A;  2M85 A;  3HCU A;  2ECT A;  3ASL A;  2VJF A;  3L1Z B;  3U5N A;  4ZUX U;  2ECG A;  2M6M A;  2YUC A;  4YBM A;  2IDA A;  2YYR A;  3RPG B;  2CT2 A;  3HTK C;  5TDR A;  5D1M B;  4FO9 A;  4QF2 A;  2YSJ A;  5B78 A;  2LGL A;  3ZNI A;  2VJF B;  3M62 A;  1VYX A;  5DKA A;  2L5U A;  5B76 A;  1WEN A;  1HYI A;  2VPD A;  3ZYQ A;  2L0B A;  1WEV A;  4FK5 A;  3N9O A;  3O34 A;  1LDK C;  1WEM A;  2ECI A;  4Q6F A;  4S3O B;  4V3K C;  2MIQ A;  4A4C A;  3M63 A;  2KE1 A;  5B75 A;  2K17 A;  2NAA A;  4YBT A;  2HDP A;  4I7B A;  4UI9 B;  5LKZ A;  2Y1M A;  3U5M A;  1ZBD B;  5KH3 A;  1U6G B;  2L75 A;  4X3G A;  4N4F A;  1LDJ B;  1WEE A;  3V43 A;  2G6Q A;  2K4D A;  2MT5 A;  4UP0 A;  4CCG X;  3N9L A;  3U5P A;  2EA6 A;  1WE9 A;  2EOD A;  2YHN A;  2MD7 B;  3LRQ A;  4R7E A;  1CHC A;  1WEO A;  5G05 B;  4YAT A;  2LXH C;  4GNG A;  4LJN A;  2KRE A;  3SOU A;  5KH9 A;  4AYC A;  2KR4 A;  2HYE D;  3ZPV E;  1K2F A;  2E6S A;  4WZ3 B;  1X4U A;  3KV6 A;  4UP5 A;  2LN0 A;  5LKU A;  4AYC B;  2QJ0 A;  3LQI A;  2G43 A;  3RPG C;  5H9M A;  2AN6 A;  5LKX A;  4FIP A;  3DPL R;  1MM2 A;  2RI7 A;  2YUR A;  4NN2 A;  2F6J A;  1VD4 A;  2ZET C;  5G0F A;  2FUI A;  3N9N A;  3L11 A;  2VNF A;  3LQJ A;  4FJC A;  3HCT A;  5JG6 A;  2L43 A;  5H1U A;  4MVT A;  1Z60 A;  3PUR A;  2ECW A;  2LDR A;  2MNZ A;  2DX8 A;  1RMD A;  3O7A A;  1WEQ A;  3L1X A;  3MHS A;  2JRJ A;  4S3O C;  2MA6 A;  2YHO A;  1BOR A;  2QIC A;  5FER A;  4PTB A;  2LQ6 A;  4AVX A;  2MUM A;  3C6W A;  2QIZ A;  3ZVZ B;  2FSA A;  2F6N A;  1WES A;  5C13 A;  5FB0 A;  3IHP A;  3HCS A;  2XB1 A;  4C9Z A;  2Y43 A;  1HYJ A;  1X4J A;  4IC2 A;  2L80 A;  4GB0 A;  4GND A;  1WEU A;  4QF3 A;  1JM7 A;  2MD8 C;  1MM3 A;  4AP4 A;  5KH7 A;  2EGP A;  2H0D A;  3KNV A;  4PPE A;  5D1L B;  2K1J A;  2UZG A;  4YAX A;  3FL2 A;  2M1R A;  1JM7 B;  2KGI A;  5TAB A;  2MNY A;  3LQH A;  3DQV R;  4I7C A;  4XI1 A;  4GNF A;  2H0D B;  4WA6 A;  3PUQ A;  2PUY A;  2VJE A;  2XEU A;  4ZDT A;  2E6R A;  1G25 A;  3EB6 A;  2ECJ A;  1E4U A;  5B77 A;  2CSY A;  2LGV A;  4TKP B;  4P5O B;  3T6R A;  3VK6 A;  2KU3 A;  4W4U A;  1WEP A;  3SHB A;  3KV5 A;  2VJE B;  1Z6U A;  3QZV A;  2KWN A;  4F52 B;  4YAB A;  1V87 A;  3O70 A;  3N9P A;  2VPE A; 
#chains in the Genus database with same CATH topology
 4OGE A;  2CSZ A;  3E2D A;  1X4I A;  3O35 A;  5LCW B;  4A4B A;  3NG2 A;  4LK9 A;  4N3W A;  1N87 A;  1VFY A;  4V3L C;  3M7K A;  2PNX A;  2XOZ A;  3T7L A;  3GL6 A;  2ECN A;  1FP0 A;  2YSM A;  3C5K A;  4R8P K;  3PHD A;  2XOC A;  5LKT A;  2JMD A;  2CKL A;  2OWA A;  4WZ2 A;  3SOX A;  2VP7 A;  4YBS A;  1FBV A;  2I50 A;  1T1H A;  4GNE A;  2EXU A;  2KWK A;  2LAU A;  2DSM A;  2LRI C;  4Z0O A;  4B7Y C;  3O36 A;  4CA1 A;  2XOY A;  3O37 A;  5G04 B;  5FB1 A;  2YQM A;  2CKL B;  2OXQ C;  1WIL A;  5I3L A;  5DIN A;  2KWO A;  5D1K B;  2K16 A;  3I2D A;  3U5O A;  1WEW A;  2KIZ A;  4L58 A;  2KKY A;  5TDW A;  2KGG A;  1WIM A;  4QQ4 A;  3ZTG A;  4WZ0 A;  2C2V S;  3JUE A;  2YU4 A;  2M3H A;  5TBN A;  3N9Q A;  3ZVY A;  4BHW A;  1Z2Q A;  2VPB A;  4LKA A;  2D8S A;  1DVP A;  2D8U A;  2CRW A;  2BAY A;  2YQL A;  3DDT A;  2KKX A;  3MHH A;  2CRR A;  3KQI A;  3DWD A;  2JMJ A;  4I7D A;  3Q1D A;  4A0C D;  2FUU A;  3O33 A;  4LAD B;  1WGM A;  3LJU X;  4IC3 A;  5AIU A;  4YAD A;  2FFW A;  5B8D A;  2F42 A;  3ZPV 1;  2P57 A;  4Z0R A;  2M13 A;  5SVY A;  5C11 A;  5H1V A;  2LGK A;  2G45 A;  4O64 A;  5H1T A;  4LLB A;  2VPG A;  5TRB A;  4R2Y A;  2KWJ A;  4L7X A;  2LXP C;  1F62 A;  4AUQ B;  5FEY A;  2YRE A;  3T9K A;  2YT5 A;  5AIT A;  2JMI A;  4MSX A;  3FAN A;  2LV9 A;  4OGC A;  4YC9 A;  1IYM A;  2YW8 A;  3SOW A;  1JOC A;  2ECV A;  2MA5 A;  5SVX A;  3EB5 A;  3O47 A;  3LVQ E;  2CON A;  4ZQL A;  4H9D A;  5J3X A;  4BBQ A;  2Y1N A;  1XWH A;  3RTR B;  3M99 A;  2JM3 A;  5B79 A;  4B86 C;  2KFT A;  5EYA F;  4F1P A;  3FM8 C;  3GV4 A;  4A49 A;  1WFK A;  2LGG A;  3N9M A;  2RSD A;  2KYU A;  2C2L A;  2M85 A;  3HCU A;  2ECT A;  3ASL A;  2VJF A;  3L1Z B;  3U5N A;  4ZUX U;  2ECG A;  2M6M A;  2YUC A;  4YBM A;  2CSV A;  2IDA A;  2YYR A;  3RPG B;  2CT2 A;  3HTK C;  5TDR A;  5D1M B;  4FO9 A;  4QF2 A;  2YSJ A;  5B78 A;  2B0O E;  2LGL A;  3ZNI A;  2VJF B;  3M62 A;  1VYX A;  5DKA A;  2L5U A;  5B76 A;  1WEN A;  1HYI A;  2VPD A;  3ZYQ A;  2L0B A;  1WEV A;  4FK5 A;  2L7P A;  3N9O A;  3O34 A;  1LDK C;  1WEM A;  2ECI A;  4Q6F A;  4S3O B;  4V3K C;  2MIQ A;  4A4C A;  3M63 A;  2KE1 A;  5B75 A;  2K17 A;  2NAA A;  4YBT A;  2HDP A;  4I7B A;  4UI9 B;  5LKZ A;  2Y1M A;  3U5M A;  1ZBD B;  5KH3 A;  1U6G B;  3FJU B;  2L75 A;  4X3G A;  4N4F A;  1LDJ B;  2IQJ A;  1WEE A;  3V43 A;  2G6Q A;  2K4D A;  2MT5 A;  4UP0 A;  4CCG X;  2RR4 A;  3N9L A;  3U5P A;  2EA6 A;  1WE9 A;  2EOD A;  2YHN A;  2MD7 B;  3LRQ A;  2MKE A;  4R7E A;  1CHC A;  1WEO A;  5G05 B;  2DJA A;  4YAT A;  2LXH C;  4GNG A;  4LJN A;  3FAO A;  5K3Q A;  2KRE A;  3LVR E;  3SOU A;  5KH9 A;  4AYC A;  2KR4 A;  2HYE D;  3ZPV E;  1K2F A;  5SVI A;  2JUN A;  2E6S A;  2E61 A;  4WZ3 B;  1X4U A;  3KV6 A;  4UP5 A;  2FD4 A;  2LN0 A;  3KDE C;  5LKU A;  4AYC B;  2QJ0 A;  3LDY A;  5SVI B;  3LQI A;  2G43 A;  3RPG C;  5H9M A;  2AN6 A;  5LKX A;  4FIP A;  3DPL R;  1MM2 A;  2RI7 A;  2YUR A;  4NN2 A;  2F6J A;  1VD4 A;  2ZET C;  2FUI A;  5G0F A;  3N9N A;  3L11 A;  2VNF A;  3LQJ A;  3MDB C;  4FJC A;  3HCT A;  5JG6 A;  2L43 A;  5H1U A;  3FEH A;  4MVT A;  1Z60 A;  3PUR A;  2ECW A;  2LDR A;  2MNZ A;  2DX8 A;  1RMD A;  3O7A A;  1WEQ A;  3L1X A;  3MHS A;  2JRJ A;  4S3O C;  2MA6 A;  3H7H A;  2YHO A;  1BOR A;  2QIC A;  5FER A;  4PTB A;  2YVR A;  1MBM A;  2LQ6 A;  4AVX A;  2MUM A;  3C6W A;  2QIZ A;  3ZVZ B;  2FSA A;  2F6N A;  1WES A;  5C13 A;  5FB0 A;  3IHP A;  3HCS A;  2XB1 A;  4C9Z A;  2Y43 A;  1HYJ A;  1X4J A;  4IC2 A;  2L80 A;  4GB0 A;  4GND A;  1WEU A;  4QF3 A;  1JM7 A;  2MD8 C;  1MM3 A;  4AP4 A;  5KH7 A;  2EGP A;  1DCQ A;  2H0D A;  3KNV A;  4PPE A;  5D1L B;  2K1J A;  2UZG A;  4YAX A;  3FL2 A;  2M1R A;  2XP0 A;  1JM7 B;  2KGI A;  5TAB A;  2MNY A;  3LQH A;  2EGM A;  3DQV R;  4I7C A;  4XI1 A;  4GNF A;  2H0D B;  4WA6 A;  3PUQ A;  2PUY A;  2VJE A;  2XEU A;  4ZDT A;  2E6R A;  3PLW A;  4O62 A;  3EB6 A;  1G25 A;  2ECJ A;  1E4U A;  5B77 A;  2CSY A;  2LGV A;  4TKP B;  4P5O B;  3T6R A;  3VK6 A;  2KU3 A;  3SUB A;  4W4U A;  1WEP A;  3SHB A;  3KV5 A;  2VJE B;  1Z6U A;  3QZV A;  2KWN A;  4F52 B;  4YAB A;  1V87 A;  3O70 A;  3N9P A;  2VPE A; 
#chains in the Genus database with same CATH homology
 2CSZ A;  1X4I A;  3O35 A;  5LCW B;  4A4B A;  3NG2 A;  4LK9 A;  4N3W A;  1N87 A;  1VFY A;  4V3L C;  2PNX A;  3T7L A;  3GL6 A;  2ECN A;  1FP0 A;  2YSM A;  3C5K A;  4R8P K;  3PHD A;  5LKT A;  2JMD A;  2CKL A;  4WZ2 A;  3SOX A;  2VP7 A;  4YBS A;  1FBV A;  2I50 A;  1T1H A;  4GNE A;  2KWK A;  2LRI C;  4B7Y C;  3O36 A;  4CA1 A;  3O37 A;  5G04 B;  5FB1 A;  2YQM A;  2CKL B;  2OXQ C;  1WIL A;  5I3L A;  5DIN A;  2KWO A;  5D1K B;  2K16 A;  3I2D A;  3U5O A;  1WEW A;  2KIZ A;  4L58 A;  5TDW A;  2KGG A;  1WIM A;  3ZTG A;  4WZ0 A;  2C2V S;  2YU4 A;  2M3H A;  5TBN A;  3N9Q A;  3ZVY A;  4BHW A;  1Z2Q A;  2VPB A;  4LKA A;  2D8S A;  1DVP A;  2BAY A;  2YQL A;  3MHH A;  3KQI A;  2JMJ A;  4I7D A;  4A0C D;  2FUU A;  3O33 A;  1WGM A;  4IC3 A;  4LAD B;  5AIU A;  4YAD A;  5B8D A;  2F42 A;  3ZPV 1;  5C11 A;  5H1V A;  2LGK A;  2G45 A;  4O64 A;  5H1T A;  4LLB A;  2VPG A;  5TRB A;  4R2Y A;  2KWJ A;  4L7X A;  2LXP C;  1F62 A;  4AUQ B;  5FEY A;  2YRE A;  2YT5 A;  5AIT A;  2JMI A;  4MSX A;  2LV9 A;  4YC9 A;  1IYM A;  2YW8 A;  3SOW A;  1JOC A;  2ECV A;  2MA5 A;  3EB5 A;  4ZQL A;  5J3X A;  4BBQ A;  2Y1N A;  1XWH A;  3RTR B;  3M99 A;  5B79 A;  4B86 C;  2KFT A;  5EYA F;  3GV4 A;  4A49 A;  1WFK A;  2LGG A;  3N9M A;  2RSD A;  2KYU A;  2C2L A;  2M85 A;  3HCU A;  2ECT A;  3ASL A;  2VJF A;  3L1Z B;  3U5N A;  4ZUX U;  2ECG A;  2M6M A;  2YUC A;  4YBM A;  2IDA A;  2YYR A;  3RPG B;  2CT2 A;  3HTK C;  5TDR A;  5D1M B;  4FO9 A;  4QF2 A;  2YSJ A;  5B78 A;  2LGL A;  3ZNI A;  2VJF B;  3M62 A;  1VYX A;  5DKA A;  2L5U A;  5B76 A;  1WEN A;  1HYI A;  2VPD A;  3ZYQ A;  2L0B A;  1WEV A;  4FK5 A;  3N9O A;  3O34 A;  1LDK C;  1WEM A;  2ECI A;  4Q6F A;  4S3O B;  4V3K C;  2MIQ A;  4A4C A;  3M63 A;  2KE1 A;  5B75 A;  2K17 A;  2NAA A;  4YBT A;  2HDP A;  4I7B A;  4UI9 B;  5LKZ A;  2Y1M A;  3U5M A;  1ZBD B;  5KH3 A;  1U6G B;  2L75 A;  4X3G A;  4N4F A;  1LDJ B;  1WEE A;  3V43 A;  2G6Q A;  2K4D A;  2MT5 A;  4UP0 A;  4CCG X;  3N9L A;  3U5P A;  2EA6 A;  1WE9 A;  2EOD A;  2YHN A;  2MD7 B;  3LRQ A;  4R7E A;  1CHC A;  1WEO A;  5G05 B;  4YAT A;  2LXH C;  4GNG A;  4LJN A;  2KRE A;  3SOU A;  5KH9 A;  4AYC A;  2KR4 A;  2HYE D;  3ZPV E;  1K2F A;  2E6S A;  4WZ3 B;  1X4U A;  3KV6 A;  4UP5 A;  2LN0 A;  5LKU A;  4AYC B;  2QJ0 A;  3LQI A;  2G43 A;  3RPG C;  5H9M A;  2AN6 A;  5LKX A;  4FIP A;  3DPL R;  1MM2 A;  2RI7 A;  2YUR A;  4NN2 A;  2F6J A;  1VD4 A;  2ZET C;  5G0F A;  2FUI A;  3N9N A;  3L11 A;  2VNF A;  3LQJ A;  4FJC A;  3HCT A;  5JG6 A;  2L43 A;  5H1U A;  4MVT A;  1Z60 A;  3PUR A;  2ECW A;  2LDR A;  2MNZ A;  2DX8 A;  1RMD A;  3O7A A;  1WEQ A;  3L1X A;  3MHS A;  2JRJ A;  4S3O C;  2MA6 A;  2YHO A;  1BOR A;  2QIC A;  5FER A;  4PTB A;  2LQ6 A;  4AVX A;  2MUM A;  3C6W A;  2QIZ A;  3ZVZ B;  2FSA A;  2F6N A;  1WES A;  5C13 A;  5FB0 A;  3IHP A;  3HCS A;  2XB1 A;  4C9Z A;  2Y43 A;  1HYJ A;  1X4J A;  4IC2 A;  2L80 A;  4GB0 A;  4GND A;  1WEU A;  4QF3 A;  1JM7 A;  2MD8 C;  1MM3 A;  4AP4 A;  5KH7 A;  2EGP A;  2H0D A;  3KNV A;  4PPE A;  5D1L B;  2K1J A;  2UZG A;  4YAX A;  3FL2 A;  2M1R A;  1JM7 B;  2KGI A;  5TAB A;  2MNY A;  3LQH A;  3DQV R;  4I7C A;  4XI1 A;  4GNF A;  2H0D B;  4WA6 A;  3PUQ A;  2PUY A;  2VJE A;  2XEU A;  4ZDT A;  2E6R A;  1G25 A;  3EB6 A;  2ECJ A;  1E4U A;  5B77 A;  2CSY A;  2LGV A;  4TKP B;  4P5O B;  3T6R A;  3VK6 A;  2KU3 A;  4W4U A;  1WEP A;  3SHB A;  3KV5 A;  2VJE B;  1Z6U A;  3QZV A;  2KWN A;  4F52 B;  4YAB A;  1V87 A;  3O70 A;  3N9P A;  2VPE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...