1N87A

Solution structure of the u-box of prp19
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
56
structure length
56
Chain Sequence
MLCAISGKVPRRPVLSPKSRTIFEKSLLEQYVKDTGNDPITNEPLSIEEIVEIVPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the U-box, a domain associated with multi-ubiquitination
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ligase/cell cycle
molecule keywords Pre-mRNA splicing factor PRP19
total genus 14
structure length 56
sequence length 56
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2002-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1n87A00
1WEQA 1WEOA 5TABA 4AUQB 2VNFA 3SOXA 2YQLA 4A49A 2KGIA 4YATA 2IDAA 4QF2A 2KYUA 5LKXA 5C13A 4X3GA 4LADB 2L43A 2VJFA 2H0DA 5LCWB 3ZPVE 1Z60A 1WEVA 1WILA 4CCGX 2JMJA 5TRBA 3U5OA 4LLBA 2EA6A 4I7DA 2NAAA 3O36A 2HDPA 4IC3A 4V3KC 4V3LC 2M85A 2QJ0A 4AVXA 2KWNA 2L80A 2KE1A 4UP0A 2E6RA 2M6MA 2Y1MA 4L7XA 5H1TA 5KH7A 2FUUA 2AN6A 4R2YA 1DVPA 4WA6A 4GNFA 5FERA 4ZQLA 2QIZA 2LDRA 1FP0A 3IHPA 3RPGB 4A4BA 2M3HA 2KFTA 2F42A 4YADA 2YYRA 1T1HA 3O35A 5B79A 4QF3A 2G45A 3L11A 4NN2A 2MNYA 1IYMA 1WENA 4B86C 2ECVA 3L1ZB 1WGMA 3N9NA 2BAYA 1G25A 3LQIA 4ZUXU 5D1KB 5FEYA 2E6SA 2L75A 3ZVZB 4YC9A 2LV9A 5B76A 2EODA 2RI7A 1MM3A 5DINA 2K16A 4C9ZA 2KU3A 5G04B 1WFKA 3DQVR 4PTBA 1LDKC 2LXPC 4BBQA 4LK9A 1XWHA 2HYED 4YBSA 2PNXA 4Q6FA 2LGGA 3HCSA 2F6NA 3DPLR 3O33A 1FBVA 5D1LB 4YABA 4YAXA 1X4IA 2F6JA 3SOUA 2YHNA 4CA1A 2MD8C 4S3OB 3MHHA 4XI1A 1WESA 1JM7A 4GNDA 2LGKA 2JMIA 5TBNA 1WEPA 3N9OA 5J3XA 2M1RA 4GNEA 2LRIC 2CKLA 2ECWA 3C6WA 3KV5A 3PUQA 4FIPA 2MA6A 2KWJA 1K2FA 1WEWA 1N87A 2VJEA 2I50A 3HCUA 2YSMA 5TDRA 2YREA 2JMDA 3ZNIA 2LGLA 1WE9A 1VYXA 4I7BA 4IC2A 3O7AA 3ZTGA 1X4JA 2UZGA 4TKPB 4BHWA 2C2VS 5D1MB 3EB5A 3T6RA 3LQJA 2MUMA 1F62A 3PURA 4FO9A 4LKAA 5LKZA 1CHCA 2ZETC 2KIZA 2KWKA 1WEEA 2KR4A 5EYAF 3O37A 2ECJA 3GV4A 5H1UA 5B8DA 2ECNA 1VD4A 1BORA 2KREA 4UI9B 5AITA 1ZBDB 3HCTA 5I3LA 5FB0A 2H0DB 5G0FA 2CSZA 1MM2A 3C5KA 3KV6A 1U6GB 3ZVYA 4ZDTA 2XB1A 2MNZA 4WZ3B 3EB6A 1VFYA 2MIQA 3N9MA 2YSJA 2KWOA 1HYJA 2Y43A 3PHDA 1WIMA 2VJFB 2K4DA 2Y1NA 4PPEA 4F52B 4S3OC 2PUYA 4A4CA 3SHBA 2YU4A 4GB0A 4WZ2A 3LRQA 2XEUA 2VJEB 3RTRB 1WEMA 2L0BA 2VPBA 3ZYQA 2VP7A 2YHOA 4W4UA 5FB1A 5LKTA 4N4FA 2K17A 3M99A 2LN0A 1WEUA 1RMDA 2G6QA 3LQHA 3L1XA 2QICA 4R7EA 2LQ6A 1JM7B 4I7CA 3U5PA 3N9LA 3M62A 5H9MA 3NG2A 3U5MA 2DX8A 2YT5A 2VPDA 4FJCA 2YQMA 4N3WA 3U5NA 3KQIA 3T7LA 4GNGA 3KNVA 2RSDA 2VPGA 2MA5A 5AIUA 3SOWA 4L58A 3N9QA 3FL2A 5B78A 1V87A 4YBMA 2ECIA 2LXHC 2CSYA 5H1VA 4B7YC 2FSAA 4R8PK 1LDJB 1HYIA 5G05B 3O34A 4AYCB 3O70A 5KH9A 4MSXA 2C2LA 1X4UA 3QZVA 2KGGA 2MD7B 1E4UA 3ASLA 3MHSA 2OXQC 2CT2A 4LJNA 3ZPV1 4AYCA 5B77A 2CKLB 5LKUA 4A0CD 1Z6UA 2D8SA 2YUCA 5C11A 3RPGC 2ECGA 5TDWA 1Z2QA 4AP4A 1JOCA 3I2DA 2YURA 4YBTA 2L5UA 3V43A 2G43A 2YW8A 5DKAA 4FK5A 2JRJA 2VPEA 5KH3A 4P5OB 3N9PA 4O64A 3M63A 3GL6A 3VK6A 2MT5A 5B75A 4UP5A 3HTKC 2ECTA 4MVTA 2EGPA 5JG6A 2LGVA 2FUIA 2K1JA 4WZ0A
chains in the Genus database with same CATH superfamily
1WEQA 1WEOA 5TABA 4AUQB 3LJUX 2VNFA 3SOXA 2YQLA 4A49A 2KGIA 4YATA 2IDAA 4QF2A 2KYUA 5LKXA 5C13A 4X3GA 4LADB 2L43A 2VJFA 2H0DA 5LCWB 3ZPVE 1Z60A 3E2DA 1WEVA 1WILA 4CCGX 2JMJA 5TRBA 3U5OA 2XOYA 4LLBA 2EA6A 4I7DA 2NAAA 2CSVA 3O36A 2HDPA 4IC3A 4V3KC 4V3LC 2M85A 2QJ0A 4AVXA 2KWNA 1MBMA 5SVXA 2L80A 2KE1A 4UP0A 2E6RA 2M6MA 2Y1MA 4L7XA 5H1TA 5KH7A 2MKEA 3FANA 2FUUA 2AN6A 4R2YA 1DVPA 4WA6A 4GNFA 5FERA 4ZQLA 2QIZA 3FAOA 2LDRA 1FP0A 3IHPA 3RPGB 2M3HA 4A4BA 2KFTA 2F42A 5SVYA 4YADA 2YYRA 1T1HA 3O35A 4H9DA 5B79A 4QF3A 2B0OE 2G45A 3L11A 4NN2A 2MNYA 3DDTA 1IYMA 1WENA 2ECVA 4B86C 3L1ZB 1WGMA 3N9NA 2BAYA 1G25A 3LQIA 4ZUXU 5D1KB 5FEYA 2E6SA 2L75A 3ZVZB 2XOZA 4YC9A 3H7HA 2LV9A 5B76A 2EODA 2RI7A 1MM3A 5DINA 2K16A 4C9ZA 2KU3A 5G04B 1WFKA 3DQVR 4PTBA 1LDKC 2LXPC 4BBQA 4LK9A 2LAUA 1XWHA 2HYED 4YBSA 2PNXA 4Q6FA 2LGGA 3HCSA 2F6NA 3DPLR 3O33A 1FBVA 5D1LB 4YABA 4YAXA 1X4IA 2F6JA 3SOUA 2YHNA 2M13A 4CA1A 2MD8C 4S3OB 4Z0RA 3MHHA 4XI1A 1WESA 1JM7A 4GNDA 2LGKA 2JMIA 5TBNA 1WEPA 3N9OA 5J3XA 2E61A 2KKXA 2IQJA 2M1RA 4GNEA 2LRIC 2CKLA 2ECWA 3DWDA 3C6WA 3KV5A 3PUQA 4FIPA 2MA6A 2RR4A 2KWJA 1K2FA 1WEWA 1N87A 2VJEA 2I50A 3HCUA 2YSMA 5TDRA 4Z0OA 2YREA 2JMDA 3ZNIA 2LGLA 3FJUB 1WE9A 1VYXA 4I7BA 4IC2A 3O7AA 3ZTGA 1X4JA 2UZGA 4TKPB 4BHWA 2C2VS 5D1MB 3EB5A 3T6RA 5K3QA 3LQJA 2MUMA 1F62A 3MDBC 3PURA 4FO9A 4LKAA 5LKZA 2JM3A 1CHCA 2ZETC 2KIZA 2KWKA 4O62A 3T9KA 1WEEA 2KR4A 5EYAF 3O37A 2L7PA 2ECJA 3GV4A 5H1UA 5B8DA 2JUNA 2ECNA 3Q1DA 1VD4A 1BORA 2KREA 4UI9B 5AITA 1ZBDB 2XP0A 3HCTA 2P57A 4QQ4A 5I3LA 5FB0A 2H0DB 5G0FA 2EXUA 2CSZA 1MM2A 3C5KA 3KV6A 2D8UA 1U6GB 3JUEA 3ZVYA 4ZDTA 1DCQA 4OGCA 2XB1A 2MNZA 4WZ3B 3EB6A 1VFYA 2MIQA 3N9MA 2YSJA 2KWOA 1HYJA 2Y43A 3PHDA 4F1PA 1WIMA 2VJFB 2K4DA 4PPEA 2Y1NA 4F52B 4S3OC 3M7KA 2PUYA 4A4CA 3SHBA 2YU4A 4GB0A 4WZ2A 3LRQA 2XEUA 2VJEB 3RTRB 1WEMA 2CRWA 2L0BA 2VPBA 2FFWA 3ZYQA 3PLWA 2VP7A 2YHOA 4W4UA 5FB1A 5LKTA 4N4FA 2K17A 3M99A 2LN0A 1WEUA 1RMDA 2G6QA 3LQHA 3L1XA 2QICA 4R7EA 2LQ6A 1JM7B 4I7CA 3U5PA 3N9LA 3M62A 3O47A 5H9MA 3NG2A 3U5MA 2DX8A 2YT5A 2VPDA 4FJCA 2YQMA 4N3WA 3U5NA 3KQIA 3T7LA 4GNGA 5SVIA 3KNVA 2RSDA 2VPGA 4OGEA 2MA5A 5AIUA 3LDYA 2EGMA 4L58A 3SOWA 2OWAA 3N9QA 2FD4A 3FL2A 5B78A 1V87A 3FM8C 4YBMA 2ECIA 2LXHC 2CSYA 5H1VA 4B7YC 2FSAA 2XOCA 4R8PK 1LDJB 2KKYA 1HYIA 5G05B 2CONA 3O34A 4AYCB 3O70A 5KH9A 2DJAA 4MSXA 2C2LA 1X4UA 3QZVA 2KGGA 2MD7B 1E4UA 3ASLA 3MHSA 2YVRA 2OXQC 2CT2A 5SVIB 4LJNA 3ZPV1 4AYCA 5B77A 2CKLB 5LKUA 4A0CD 1Z6UA 3FEHA 2D8SA 2YUCA 5C11A 3LVRE 3SUBA 3RPGC 3KDEC 2ECGA 5TDWA 1Z2QA 4AP4A 1JOCA 3I2DA 2YURA 4YBTA 2L5UA 3V43A 2CRRA 2G43A 2YW8A 5DKAA 4FK5A 2JRJA 2VPEA 5KH3A 4P5OB 3N9PA 4O64A 3M63A 3LVQE 3GL6A 3VK6A 2DSMA 2MT5A 3HTKC 2ECTA 4MVTA 4UP5A 2EGPA 5B75A 5JG6A 2LGVA 2FUIA 2K1JA 4WZ0A
chains in the Genus database with same CATH topology
1WEQA 1WEOA 5TABA 4AUQB 2VNFA 3SOXA 2YQLA 4A49A 2KGIA 4YATA 2IDAA 4QF2A 2KYUA 5LKXA 5C13A 4X3GA 4LADB 2L43A 2VJFA 2H0DA 5LCWB 3ZPVE 1Z60A 1WEVA 1WILA 4CCGX 2JMJA 5TRBA 3U5OA 4LLBA 2EA6A 4I7DA 2NAAA 3O36A 2HDPA 4IC3A 4V3KC 4V3LC 2M85A 2QJ0A 4AVXA 2KWNA 2L80A 2KE1A 4UP0A 2E6RA 2M6MA 2Y1MA 4L7XA 5H1TA 5KH7A 2FUUA 2AN6A 4R2YA 1DVPA 4WA6A 4GNFA 5FERA 4ZQLA 2QIZA 2LDRA 1FP0A 3IHPA 3RPGB 4A4BA 2M3HA 2KFTA 2F42A 4YADA 2YYRA 1T1HA 3O35A 5B79A 4QF3A 2G45A 3L11A 4NN2A 2MNYA 1IYMA 1WENA 4B86C 2ECVA 3L1ZB 1WGMA 3N9NA 2BAYA 1G25A 3LQIA 4ZUXU 5D1KB 5FEYA 2E6SA 2L75A 3ZVZB 4YC9A 2LV9A 5B76A 2EODA 2RI7A 1MM3A 5DINA 2K16A 4C9ZA 2KU3A 5G04B 1WFKA 3DQVR 4PTBA 1LDKC 2LXPC 4BBQA 4LK9A 1XWHA 2HYED 4YBSA 2PNXA 4Q6FA 2LGGA 3HCSA 2F6NA 3DPLR 3O33A 1FBVA 5D1LB 4YABA 4YAXA 1X4IA 2F6JA 3SOUA 2YHNA 4CA1A 2MD8C 4S3OB 3MHHA 4XI1A 1WESA 1JM7A 4GNDA 2LGKA 2JMIA 5TBNA 1WEPA 3N9OA 5J3XA 2M1RA 4GNEA 2LRIC 2CKLA 2ECWA 3C6WA 3KV5A 3PUQA 4FIPA 2MA6A 2KWJA 1K2FA 1WEWA 1N87A 2VJEA 2I50A 3HCUA 2YSMA 5TDRA 2YREA 2JMDA 3ZNIA 2LGLA 1WE9A 1VYXA 4I7BA 4IC2A 3O7AA 3ZTGA 1X4JA 2UZGA 4TKPB 4BHWA 2C2VS 5D1MB 3EB5A 3T6RA 3LQJA 2MUMA 1F62A 3PURA 4FO9A 4LKAA 5LKZA 1CHCA 2ZETC 2KIZA 2KWKA 1WEEA 2KR4A 5EYAF 3O37A 2ECJA 3GV4A 5H1UA 5B8DA 2ECNA 1VD4A 1BORA 2KREA 4UI9B 5AITA 1ZBDB 3HCTA 5I3LA 5FB0A 2H0DB 5G0FA 2CSZA 1MM2A 3C5KA 3KV6A 1U6GB 3ZVYA 4ZDTA 2XB1A 2MNZA 4WZ3B 3EB6A 1VFYA 2MIQA 3N9MA 2YSJA 2KWOA 1HYJA 2Y43A 3PHDA 1WIMA 2VJFB 2K4DA 2Y1NA 4PPEA 4F52B 4S3OC 2PUYA 4A4CA 3SHBA 2YU4A 4GB0A 4WZ2A 3LRQA 2XEUA 2VJEB 3RTRB 1WEMA 2L0BA 2VPBA 3ZYQA 2VP7A 2YHOA 4W4UA 5FB1A 5LKTA 4N4FA 2K17A 3M99A 2LN0A 1WEUA 1RMDA 2G6QA 3LQHA 3L1XA 2QICA 4R7EA 2LQ6A 1JM7B 4I7CA 3U5PA 3N9LA 3M62A 5H9MA 3NG2A 3U5MA 2DX8A 2YT5A 2VPDA 4FJCA 2YQMA 4N3WA 3U5NA 3KQIA 3T7LA 4GNGA 3KNVA 2RSDA 2VPGA 2MA5A 5AIUA 3SOWA 4L58A 3N9QA 3FL2A 5B78A 1V87A 4YBMA 2ECIA 2LXHC 2CSYA 5H1VA 4B7YC 2FSAA 4R8PK 1LDJB 1HYIA 5G05B 3O34A 4AYCB 3O70A 5KH9A 4MSXA 2C2LA 1X4UA 3QZVA 2KGGA 2MD7B 1E4UA 3ASLA 3MHSA 2OXQC 2CT2A 4LJNA 3ZPV1 4AYCA 5B77A 2CKLB 5LKUA 4A0CD 1Z6UA 2D8SA 2YUCA 5C11A 3RPGC 2ECGA 5TDWA 1Z2QA 4AP4A 1JOCA 3I2DA 2YURA 4YBTA 2L5UA 3V43A 2G43A 2YW8A 5DKAA 4FK5A 2JRJA 2VPEA 5KH3A 4P5OB 3N9PA 4O64A 3M63A 3GL6A 3VK6A 2MT5A 5B75A 4UP5A 3HTKC 2ECTA 4MVTA 2EGPA 5JG6A 2LGVA 2FUIA 2K1JA 4WZ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WEQ A;  1WEO A;  5TAB A;  4AUQ B;  2VNF A;  3SOX A;  2YQL A;  4A49 A;  2KGI A;  4YAT A;  2IDA A;  4QF2 A;  2KYU A;  5LKX A;  5C13 A;  4X3G A;  4LAD B;  2L43 A;  2VJF A;  2H0D A;  5LCW B;  3ZPV E;  1Z60 A;  1WEV A;  1WIL A;  4CCG X;  2JMJ A;  5TRB A;  3U5O A;  4LLB A;  2EA6 A;  4I7D A;  2NAA A;  3O36 A;  2HDP A;  4IC3 A;  4V3K C;  4V3L C;  2M85 A;  2QJ0 A;  4AVX A;  2KWN A;  2L80 A;  2KE1 A;  4UP0 A;  2E6R A;  2M6M A;  2Y1M A;  4L7X A;  5H1T A;  5KH7 A;  2FUU A;  2AN6 A;  4R2Y A;  1DVP A;  4WA6 A;  4GNF A;  5FER A;  4ZQL A;  2QIZ A;  2LDR A;  1FP0 A;  3IHP A;  3RPG B;  4A4B A;  2M3H A;  2KFT A;  2F42 A;  4YAD A;  2YYR A;  1T1H A;  3O35 A;  5B79 A;  4QF3 A;  2G45 A;  3L11 A;  4NN2 A;  2MNY A;  1IYM A;  1WEN A;  4B86 C;  2ECV A;  3L1Z B;  1WGM A;  3N9N A;  2BAY A;  1G25 A;  3LQI A;  4ZUX U;  5D1K B;  5FEY A;  2E6S A;  2L75 A;  3ZVZ B;  4YC9 A;  2LV9 A;  5B76 A;  2EOD A;  2RI7 A;  1MM3 A;  5DIN A;  2K16 A;  4C9Z A;  2KU3 A;  5G04 B;  1WFK A;  3DQV R;  4PTB A;  1LDK C;  2LXP C;  4BBQ A;  4LK9 A;  1XWH A;  2HYE D;  4YBS A;  2PNX A;  4Q6F A;  2LGG A;  3HCS A;  2F6N A;  3DPL R;  3O33 A;  1FBV A;  5D1L B;  4YAB A;  4YAX A;  1X4I A;  2F6J A;  3SOU A;  2YHN A;  4CA1 A;  2MD8 C;  4S3O B;  3MHH A;  4XI1 A;  1WES A;  1JM7 A;  4GND A;  2LGK A;  2JMI A;  5TBN A;  1WEP A;  3N9O A;  5J3X A;  2M1R A;  4GNE A;  2LRI C;  2CKL A;  2ECW A;  3C6W A;  3KV5 A;  3PUQ A;  4FIP A;  2MA6 A;  2KWJ A;  1K2F A;  1WEW A;  1N87 A;  2VJE A;  2I50 A;  3HCU A;  2YSM A;  5TDR A;  2YRE A;  2JMD A;  3ZNI A;  2LGL A;  1WE9 A;  1VYX A;  4I7B A;  4IC2 A;  3O7A A;  3ZTG A;  1X4J A;  2UZG A;  4TKP B;  4BHW A;  2C2V S;  5D1M B;  3EB5 A;  3T6R A;  3LQJ A;  2MUM A;  1F62 A;  3PUR A;  4FO9 A;  4LKA A;  5LKZ A;  1CHC A;  2ZET C;  2KIZ A;  2KWK A;  1WEE A;  2KR4 A;  5EYA F;  3O37 A;  2ECJ A;  3GV4 A;  5H1U A;  5B8D A;  2ECN A;  1VD4 A;  1BOR A;  2KRE A;  4UI9 B;  5AIT A;  1ZBD B;  3HCT A;  5I3L A;  5FB0 A;  2H0D B;  5G0F A;  2CSZ A;  1MM2 A;  3C5K A;  3KV6 A;  1U6G B;  3ZVY A;  4ZDT A;  2XB1 A;  2MNZ A;  4WZ3 B;  3EB6 A;  1VFY A;  2MIQ A;  3N9M A;  2YSJ A;  2KWO A;  1HYJ A;  2Y43 A;  3PHD A;  1WIM A;  2VJF B;  2K4D A;  2Y1N A;  4PPE A;  4F52 B;  4S3O C;  2PUY A;  4A4C A;  3SHB A;  2YU4 A;  4GB0 A;  4WZ2 A;  3LRQ A;  2XEU A;  2VJE B;  3RTR B;  1WEM A;  2L0B A;  2VPB A;  3ZYQ A;  2VP7 A;  2YHO A;  4W4U A;  5FB1 A;  5LKT A;  4N4F A;  2K17 A;  3M99 A;  2LN0 A;  1WEU A;  1RMD A;  2G6Q A;  3LQH A;  3L1X A;  2QIC A;  4R7E A;  2LQ6 A;  1JM7 B;  4I7C A;  3U5P A;  3N9L A;  3M62 A;  5H9M A;  3NG2 A;  3U5M A;  2DX8 A;  2YT5 A;  2VPD A;  4FJC A;  2YQM A;  4N3W A;  3U5N A;  3KQI A;  3T7L A;  4GNG A;  3KNV A;  2RSD A;  2VPG A;  2MA5 A;  5AIU A;  3SOW A;  4L58 A;  3N9Q A;  3FL2 A;  5B78 A;  1V87 A;  4YBM A;  2ECI A;  2LXH C;  2CSY A;  5H1V A;  4B7Y C;  2FSA A;  4R8P K;  1LDJ B;  1HYI A;  5G05 B;  3O34 A;  4AYC B;  3O70 A;  5KH9 A;  4MSX A;  2C2L A;  1X4U A;  3QZV A;  2KGG A;  2MD7 B;  1E4U A;  3ASL A;  3MHS A;  2OXQ C;  2CT2 A;  4LJN A;  3ZPV 1;  4AYC A;  5B77 A;  2CKL B;  5LKU A;  4A0C D;  1Z6U A;  2D8S A;  2YUC A;  5C11 A;  3RPG C;  2ECG A;  5TDW A;  1Z2Q A;  4AP4 A;  1JOC A;  3I2D A;  2YUR A;  4YBT A;  2L5U A;  3V43 A;  2G43 A;  2YW8 A;  5DKA A;  4FK5 A;  2JRJ A;  2VPE A;  5KH3 A;  4P5O B;  3N9P A;  4O64 A;  3M63 A;  3GL6 A;  3VK6 A;  2MT5 A;  5B75 A;  4UP5 A;  3HTK C;  2ECT A;  4MVT A;  2EGP A;  5JG6 A;  2LGV A;  2FUI A;  2K1J A;  4WZ0 A; 
#chains in the Genus database with same CATH topology
 1WEQ A;  1WEO A;  5TAB A;  4AUQ B;  3LJU X;  2VNF A;  3SOX A;  2YQL A;  4A49 A;  2KGI A;  4YAT A;  2IDA A;  4QF2 A;  2KYU A;  5LKX A;  5C13 A;  4X3G A;  4LAD B;  2L43 A;  2VJF A;  2H0D A;  5LCW B;  3ZPV E;  1Z60 A;  3E2D A;  1WEV A;  1WIL A;  4CCG X;  2JMJ A;  5TRB A;  3U5O A;  2XOY A;  4LLB A;  2EA6 A;  4I7D A;  2NAA A;  2CSV A;  3O36 A;  2HDP A;  4IC3 A;  4V3K C;  4V3L C;  2M85 A;  2QJ0 A;  4AVX A;  2KWN A;  1MBM A;  5SVX A;  2L80 A;  2KE1 A;  4UP0 A;  2E6R A;  2M6M A;  2Y1M A;  4L7X A;  5H1T A;  5KH7 A;  2MKE A;  3FAN A;  2FUU A;  2AN6 A;  4R2Y A;  1DVP A;  4WA6 A;  4GNF A;  5FER A;  4ZQL A;  2QIZ A;  3FAO A;  2LDR A;  1FP0 A;  3IHP A;  3RPG B;  2M3H A;  4A4B A;  2KFT A;  2F42 A;  5SVY A;  4YAD A;  2YYR A;  1T1H A;  3O35 A;  4H9D A;  5B79 A;  4QF3 A;  2B0O E;  2G45 A;  3L11 A;  4NN2 A;  2MNY A;  3DDT A;  1IYM A;  1WEN A;  2ECV A;  4B86 C;  3L1Z B;  1WGM A;  3N9N A;  2BAY A;  1G25 A;  3LQI A;  4ZUX U;  5D1K B;  5FEY A;  2E6S A;  2L75 A;  3ZVZ B;  2XOZ A;  4YC9 A;  3H7H A;  2LV9 A;  5B76 A;  2EOD A;  2RI7 A;  1MM3 A;  5DIN A;  2K16 A;  4C9Z A;  2KU3 A;  5G04 B;  1WFK A;  3DQV R;  4PTB A;  1LDK C;  2LXP C;  4BBQ A;  4LK9 A;  2LAU A;  1XWH A;  2HYE D;  4YBS A;  2PNX A;  4Q6F A;  2LGG A;  3HCS A;  2F6N A;  3DPL R;  3O33 A;  1FBV A;  5D1L B;  4YAB A;  4YAX A;  1X4I A;  2F6J A;  3SOU A;  2YHN A;  2M13 A;  4CA1 A;  2MD8 C;  4S3O B;  4Z0R A;  3MHH A;  4XI1 A;  1WES A;  1JM7 A;  4GND A;  2LGK A;  2JMI A;  5TBN A;  1WEP A;  3N9O A;  5J3X A;  2E61 A;  2KKX A;  2IQJ A;  2M1R A;  4GNE A;  2LRI C;  2CKL A;  2ECW A;  3DWD A;  3C6W A;  3KV5 A;  3PUQ A;  4FIP A;  2MA6 A;  2RR4 A;  2KWJ A;  1K2F A;  1WEW A;  1N87 A;  2VJE A;  2I50 A;  3HCU A;  2YSM A;  5TDR A;  4Z0O A;  2YRE A;  2JMD A;  3ZNI A;  2LGL A;  3FJU B;  1WE9 A;  1VYX A;  4I7B A;  4IC2 A;  3O7A A;  3ZTG A;  1X4J A;  2UZG A;  4TKP B;  4BHW A;  2C2V S;  5D1M B;  3EB5 A;  3T6R A;  5K3Q A;  3LQJ A;  2MUM A;  1F62 A;  3MDB C;  3PUR A;  4FO9 A;  4LKA A;  5LKZ A;  2JM3 A;  1CHC A;  2ZET C;  2KIZ A;  2KWK A;  4O62 A;  3T9K A;  1WEE A;  2KR4 A;  5EYA F;  3O37 A;  2L7P A;  2ECJ A;  3GV4 A;  5H1U A;  5B8D A;  2JUN A;  2ECN A;  3Q1D A;  1VD4 A;  1BOR A;  2KRE A;  4UI9 B;  5AIT A;  1ZBD B;  2XP0 A;  3HCT A;  2P57 A;  4QQ4 A;  5I3L A;  5FB0 A;  2H0D B;  5G0F A;  2EXU A;  2CSZ A;  1MM2 A;  3C5K A;  3KV6 A;  2D8U A;  1U6G B;  3JUE A;  3ZVY A;  4ZDT A;  1DCQ A;  4OGC A;  2XB1 A;  2MNZ A;  4WZ3 B;  3EB6 A;  1VFY A;  2MIQ A;  3N9M A;  2YSJ A;  2KWO A;  1HYJ A;  2Y43 A;  3PHD A;  4F1P A;  1WIM A;  2VJF B;  2K4D A;  4PPE A;  2Y1N A;  4F52 B;  4S3O C;  3M7K A;  2PUY A;  4A4C A;  3SHB A;  2YU4 A;  4GB0 A;  4WZ2 A;  3LRQ A;  2XEU A;  2VJE B;  3RTR B;  1WEM A;  2CRW A;  2L0B A;  2VPB A;  2FFW A;  3ZYQ A;  3PLW A;  2VP7 A;  2YHO A;  4W4U A;  5FB1 A;  5LKT A;  4N4F A;  2K17 A;  3M99 A;  2LN0 A;  1WEU A;  1RMD A;  2G6Q A;  3LQH A;  3L1X A;  2QIC A;  4R7E A;  2LQ6 A;  1JM7 B;  4I7C A;  3U5P A;  3N9L A;  3M62 A;  3O47 A;  5H9M A;  3NG2 A;  3U5M A;  2DX8 A;  2YT5 A;  2VPD A;  4FJC A;  2YQM A;  4N3W A;  3U5N A;  3KQI A;  3T7L A;  4GNG A;  5SVI A;  3KNV A;  2RSD A;  2VPG A;  4OGE A;  2MA5 A;  5AIU A;  3LDY A;  2EGM A;  4L58 A;  3SOW A;  2OWA A;  3N9Q A;  2FD4 A;  3FL2 A;  5B78 A;  1V87 A;  3FM8 C;  4YBM A;  2ECI A;  2LXH C;  2CSY A;  5H1V A;  4B7Y C;  2FSA A;  2XOC A;  4R8P K;  1LDJ B;  2KKY A;  1HYI A;  5G05 B;  2CON A;  3O34 A;  4AYC B;  3O70 A;  5KH9 A;  2DJA A;  4MSX A;  2C2L A;  1X4U A;  3QZV A;  2KGG A;  2MD7 B;  1E4U A;  3ASL A;  3MHS A;  2YVR A;  2OXQ C;  2CT2 A;  5SVI B;  4LJN A;  3ZPV 1;  4AYC A;  5B77 A;  2CKL B;  5LKU A;  4A0C D;  1Z6U A;  3FEH A;  2D8S A;  2YUC A;  5C11 A;  3LVR E;  3SUB A;  3RPG C;  3KDE C;  2ECG A;  5TDW A;  1Z2Q A;  4AP4 A;  1JOC A;  3I2D A;  2YUR A;  4YBT A;  2L5U A;  3V43 A;  2CRR A;  2G43 A;  2YW8 A;  5DKA A;  4FK5 A;  2JRJ A;  2VPE A;  5KH3 A;  4P5O B;  3N9P A;  4O64 A;  3M63 A;  3LVQ E;  3GL6 A;  3VK6 A;  2DSM A;  2MT5 A;  3HTK C;  2ECT A;  4MVT A;  4UP5 A;  2EGP A;  5B75 A;  5JG6 A;  2LGV A;  2FUI A;  2K1J A;  4WZ0 A; 
#chains in the Genus database with same CATH homology
 1WEQ A;  1WEO A;  5TAB A;  4AUQ B;  2VNF A;  3SOX A;  2YQL A;  4A49 A;  2KGI A;  4YAT A;  2IDA A;  4QF2 A;  2KYU A;  5LKX A;  5C13 A;  4X3G A;  4LAD B;  2L43 A;  2VJF A;  2H0D A;  5LCW B;  3ZPV E;  1Z60 A;  1WEV A;  1WIL A;  4CCG X;  2JMJ A;  5TRB A;  3U5O A;  4LLB A;  2EA6 A;  4I7D A;  2NAA A;  3O36 A;  2HDP A;  4IC3 A;  4V3K C;  4V3L C;  2M85 A;  2QJ0 A;  4AVX A;  2KWN A;  2L80 A;  2KE1 A;  4UP0 A;  2E6R A;  2M6M A;  2Y1M A;  4L7X A;  5H1T A;  5KH7 A;  2FUU A;  2AN6 A;  4R2Y A;  1DVP A;  4WA6 A;  4GNF A;  5FER A;  4ZQL A;  2QIZ A;  2LDR A;  1FP0 A;  3IHP A;  3RPG B;  4A4B A;  2M3H A;  2KFT A;  2F42 A;  4YAD A;  2YYR A;  1T1H A;  3O35 A;  5B79 A;  4QF3 A;  2G45 A;  3L11 A;  4NN2 A;  2MNY A;  1IYM A;  1WEN A;  4B86 C;  2ECV A;  3L1Z B;  1WGM A;  3N9N A;  2BAY A;  1G25 A;  3LQI A;  4ZUX U;  5D1K B;  5FEY A;  2E6S A;  2L75 A;  3ZVZ B;  4YC9 A;  2LV9 A;  5B76 A;  2EOD A;  2RI7 A;  1MM3 A;  5DIN A;  2K16 A;  4C9Z A;  2KU3 A;  5G04 B;  1WFK A;  3DQV R;  4PTB A;  1LDK C;  2LXP C;  4BBQ A;  4LK9 A;  1XWH A;  2HYE D;  4YBS A;  2PNX A;  4Q6F A;  2LGG A;  3HCS A;  2F6N A;  3DPL R;  3O33 A;  1FBV A;  5D1L B;  4YAB A;  4YAX A;  1X4I A;  2F6J A;  3SOU A;  2YHN A;  4CA1 A;  2MD8 C;  4S3O B;  3MHH A;  4XI1 A;  1WES A;  1JM7 A;  4GND A;  2LGK A;  2JMI A;  5TBN A;  1WEP A;  3N9O A;  5J3X A;  2M1R A;  4GNE A;  2LRI C;  2CKL A;  2ECW A;  3C6W A;  3KV5 A;  3PUQ A;  4FIP A;  2MA6 A;  2KWJ A;  1K2F A;  1WEW A;  1N87 A;  2VJE A;  2I50 A;  3HCU A;  2YSM A;  5TDR A;  2YRE A;  2JMD A;  3ZNI A;  2LGL A;  1WE9 A;  1VYX A;  4I7B A;  4IC2 A;  3O7A A;  3ZTG A;  1X4J A;  2UZG A;  4TKP B;  4BHW A;  2C2V S;  5D1M B;  3EB5 A;  3T6R A;  3LQJ A;  2MUM A;  1F62 A;  3PUR A;  4FO9 A;  4LKA A;  5LKZ A;  1CHC A;  2ZET C;  2KIZ A;  2KWK A;  1WEE A;  2KR4 A;  5EYA F;  3O37 A;  2ECJ A;  3GV4 A;  5H1U A;  5B8D A;  2ECN A;  1VD4 A;  1BOR A;  2KRE A;  4UI9 B;  5AIT A;  1ZBD B;  3HCT A;  5I3L A;  5FB0 A;  2H0D B;  5G0F A;  2CSZ A;  1MM2 A;  3C5K A;  3KV6 A;  1U6G B;  3ZVY A;  4ZDT A;  2XB1 A;  2MNZ A;  4WZ3 B;  3EB6 A;  1VFY A;  2MIQ A;  3N9M A;  2YSJ A;  2KWO A;  1HYJ A;  2Y43 A;  3PHD A;  1WIM A;  2VJF B;  2K4D A;  2Y1N A;  4PPE A;  4F52 B;  4S3O C;  2PUY A;  4A4C A;  3SHB A;  2YU4 A;  4GB0 A;  4WZ2 A;  3LRQ A;  2XEU A;  2VJE B;  3RTR B;  1WEM A;  2L0B A;  2VPB A;  3ZYQ A;  2VP7 A;  2YHO A;  4W4U A;  5FB1 A;  5LKT A;  4N4F A;  2K17 A;  3M99 A;  2LN0 A;  1WEU A;  1RMD A;  2G6Q A;  3LQH A;  3L1X A;  2QIC A;  4R7E A;  2LQ6 A;  1JM7 B;  4I7C A;  3U5P A;  3N9L A;  3M62 A;  5H9M A;  3NG2 A;  3U5M A;  2DX8 A;  2YT5 A;  2VPD A;  4FJC A;  2YQM A;  4N3W A;  3U5N A;  3KQI A;  3T7L A;  4GNG A;  3KNV A;  2RSD A;  2VPG A;  2MA5 A;  5AIU A;  3SOW A;  4L58 A;  3N9Q A;  3FL2 A;  5B78 A;  1V87 A;  4YBM A;  2ECI A;  2LXH C;  2CSY A;  5H1V A;  4B7Y C;  2FSA A;  4R8P K;  1LDJ B;  1HYI A;  5G05 B;  3O34 A;  4AYC B;  3O70 A;  5KH9 A;  4MSX A;  2C2L A;  1X4U A;  3QZV A;  2KGG A;  2MD7 B;  1E4U A;  3ASL A;  3MHS A;  2OXQ C;  2CT2 A;  4LJN A;  3ZPV 1;  4AYC A;  5B77 A;  2CKL B;  5LKU A;  4A0C D;  1Z6U A;  2D8S A;  2YUC A;  5C11 A;  3RPG C;  2ECG A;  5TDW A;  1Z2Q A;  4AP4 A;  1JOC A;  3I2D A;  2YUR A;  4YBT A;  2L5U A;  3V43 A;  2G43 A;  2YW8 A;  5DKA A;  4FK5 A;  2JRJ A;  2VPE A;  5KH3 A;  4P5O B;  3N9P A;  4O64 A;  3M63 A;  3GL6 A;  3VK6 A;  2MT5 A;  5B75 A;  4UP5 A;  3HTK C;  2ECT A;  4MVT A;  2EGP A;  5JG6 A;  2LGV A;  2FUI A;  2K1J A;  4WZ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...