1N87A

Solution structure of the u-box of prp19
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
56
structure length
56
Chain Sequence
MLCAISGKVPRRPVLSPKSRTIFEKSLLEQYVKDTGNDPITNEPLSIEEIVEIVPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA splicing factor PRP19
publication title Structural insights into the U-box, a domain associated with multi-ubiquitination
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ligase/cell cycle
total genus 14
structure length 56
sequence length 56
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2002-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1n87A00
4AVXA 4GNEA 2YQLA 2LGKA 2Y43A 2JMDA 2MIQA 3V43A 2I50A 2YW8A 4LADB 1WE9A 2VPEA 5H1VA 4AUQB 3ZPVE 2KWJA 5G0FA 4F52B 4ZUXU 3N9LA 1Z60A 5C11A 2KREA 3N9MA 1JM7A 4I7BA 1BORA 2QICA 2Y1MA 4YADA 5KH9A 4GNFA 1WIMA 4L7XA 3RPGC 1FP0A 2ECVA 3DPLR 4ZQLA 3L1ZB 2MA6A 2KYUA 2VJEB 3N9QA 3ZPV1 2MA5A 1MM2A 2UZGA 2ECTA 4B7YC 2NAAA 3U5OA 4YATA 2F6JA 2XB1A 4A4CA 5B76A 4FK5A 4BHWA 2CSZA 2KE1A 2FSAA 4XI1A 3HCSA 4CCGX 4I7CA 4AYCA 2KGIA 4L58A 3RTRB 3ZNIA 4AP4A 5B77A 3U5MA 5J3XA 3QZVA 2VJEA 3O36A 2YHOA 2YURA 4C9ZA 2KU3A 3O7AA 4IC3A 4QF2A 1VFYA 2YUCA 5FERA 5H1UA 3ZVYA 4LKAA 1WEVA 4V3KC 3U5NA 2K16A 4YBMA 5TBNA 1HYIA 4QF3A 1JOCA 2YT5A 4UP5A 3SOUA 5H9MA 2RSDA 1RMDA 2CKLA 3ZTGA 2E6RA 1JM7B 1XWHA 2ECIA 4GNGA 5H1TA 2VNFA 2ECGA 3O70A 1FBVA 2EODA 3HCUA 2LXPC 2XEUA 1WEEA 1Z2QA 4WZ3B 3M99A 2K1JA 3T7LA 5B75A 3PUQA 2AN6A 4N4FA 4N3WA 2JMIA 3L1XA 5D1KB 2YSJA 2YSMA 4ZDTA 2L0BA 1WGMA 3ASLA 2G6QA 1V87A 5LKTA 4IC2A 4MVTA 2LN0A 4R8PK 3I2DA 4AYCB 4S3OB 4V3LC 3HTKC 5TRBA 3MHHA 5LKZA 4YBSA 3IHPA 4YBTA 1N87A 3O33A 5DKAA 3O37A 1G25A 2LGVA 3O35A 2VPDA 4I7DA 5I3LA 2G43A 2VPBA 4YAXA 3SHBA 2MUMA 2IDAA 1WILA 1VYXA 2M3HA 3O34A 1LDKC 1WEOA 5LKUA 3KV5A 1ZBDB 4YABA 3ZYQA 2LRIC 5G04B 1LDJB 4BBQA 2FUUA 2CKLB 3SOXA 5DINA 3GV4A 3GL6A 4WZ0A 2M85A 2Y1NA 5TABA 2VP7A 5B8DA 3U5PA 5FB0A 2PNXA 2L43A 1X4UA 3C6WA 2M6MA 3LQIA 1T1HA 2EGPA 2PUYA 1WFKA 1IYMA 1K2FA 2ZETC 4A49A 4FO9A 4CA1A 2G45A 4WZ2A 3L11A 3N9PA 1HYJA 1MM3A 4LK9A 2E6SA 2L75A 5LCWB 1WEMA 4S3OC 2KWNA 2YHNA 4UP0A 4FJCA 2MD7B 5D1LB 2KGGA 1U6GB 1E4UA 2BAYA 2KIZA 4GB0A 5KH3A 2YREA 2LGLA 2DX8A 2QJ0A 5G05B 1X4IA 2KR4A 4WA6A 2ECNA 2OXQC 3T6RA 4B86C 2VJFA 3LRQA 3N9NA 3MHSA 2HYED 4A0CD 2JMJA 3PURA 2D8SA 4NN2A 2VPGA 2LGGA 3ZVZB 2HDPA 5AITA 2QIZA 2ECWA 4W4UA 1Z6UA 2H0DB 5KH7A 2MT5A 1F62A 3N9OA 2KWKA 2L80A 4O64A 3DQVR 2L5UA 3KQIA 2YYRA 2RI7A 3M62A 4FIPA 3M63A 1WEWA 3C5KA 3KV6A 2YU4A 3PHDA 5B78A 2YQMA 2CSYA 2F6NA 3EB6A 5TDWA 2F42A 2LQ6A 2H0DA 2LXHC 1VD4A 5JG6A 2C2VS 2MD8C 3RPGB 2LV9A 1CHCA 3NG2A 4MSXA 1WESA 3HCTA 3LQHA 3KNVA 2K4DA 4X3GA 2ECJA 3FL2A 4R7EA 2JRJA 5AIUA 1WENA 5FEYA 1DVPA 4P5OB 5B79A 2CT2A 3VK6A 1WEPA 3EB5A 1WEQA 2K17A 1WEUA 2MNZA 4LJNA 2KWOA 4Q6FA 2KFTA 5C13A 4YC9A 4LLBA 3LQJA 5TDRA 2VJFB 2LDRA 4TKPB 2MNYA 4R2YA 2M1RA 4UI9B 2C2LA 2EA6A 4PPEA 4A4BA 4GNDA 1X4JA 2FUIA 5D1MB 5LKXA 5FB1A 3SOWA 5EYAF 4PTBA
chains in the Genus database with same CATH superfamily
4F1PA 4AVXA 4GNEA 2YQLA 2LGKA 1DCQA 2JMDA 2Y43A 2MIQA 3V43A 2I50A 2E61A 2YW8A 4LADB 1WE9A 2VPEA 5H1VA 4AUQB 4OGCA 3ZPVE 2KWJA 5G0FA 4F52B 4ZUXU 3N9LA 1Z60A 5C11A 2KREA 3N9MA 1JM7A 2L7PA 4I7BA 1BORA 2QICA 2Y1MA 4YADA 3H7HA 5KH9A 4GNFA 1WIMA 4L7XA 2KKYA 3LVQE 3RPGC 1FP0A 2ECVA 4H9DA 3DPLR 4ZQLA 3L1ZB 2MA6A 2KYUA 2KKXA 2VJEB 3N9QA 3ZPV1 2MA5A 3DDTA 1MM2A 2UZGA 2ECTA 3SUBA 4B7YC 3FJUB 2NAAA 3U5OA 4Z0RA 4YATA 2F6JA 2XB1A 4A4CA 5B76A 4FK5A 4BHWA 2CSZA 2KE1A 2FSAA 4XI1A 3HCSA 4CCGX 4I7CA 2DJAA 4AYCA 2KGIA 4L58A 3RTRB 3ZNIA 4AP4A 5B77A 3U5MA 5J3XA 3QZVA 2VJEA 3O36A 2YHOA 2YURA 4C9ZA 2KU3A 3O7AA 4IC3A 4QF2A 1VFYA 2YUCA 5FERA 5H1UA 5SVYA 3ZVYA 4LKAA 1WEVA 3FANA 4V3KC 3U5NA 2K16A 4YBMA 5TBNA 1HYIA 4QF3A 1JOCA 2YT5A 2P57A 4UP5A 3SOUA 5H9MA 2RSDA 1RMDA 3O47A 2CKLA 3ZTGA 2E6RA 1JM7B 1XWHA 2ECIA 4QQ4A 4GNGA 5H1TA 2VNFA 3DWDA 2ECGA 3O70A 1FBVA 2EODA 2CSVA 3HCUA 2XOCA 2LXPC 2XEUA 1WEEA 1Z2QA 4WZ3B 3M99A 2K1JA 3T7LA 5B75A 3PUQA 2AN6A 4N4FA 4N3WA 2JMIA 3L1XA 5D1KB 2YSJA 2YSMA 4ZDTA 2EGMA 2L0BA 1WGMA 3ASLA 2G6QA 3MDBC 1V87A 5LKTA 4IC2A 4MVTA 2LN0A 4R8PK 3I2DA 4AYCB 4S3OB 4V3LC 2B0OE 3HTKC 5TRBA 3MHHA 5LKZA 4YBSA 3IHPA 4YBTA 1N87A 3O33A 5DKAA 3O37A 1G25A 2LGVA 3O35A 2VPDA 4I7DA 5I3LA 2G43A 2VPBA 2LAUA 4YAXA 3SHBA 2MUMA 2IDAA 1WILA 1VYXA 2M3HA 3O34A 4Z0OA 3M7KA 1LDKC 2D8UA 1WEOA 5LKUA 3KV5A 1ZBDB 3FEHA 3LDYA 4YABA 3ZYQA 2LRIC 2MKEA 1LDJB 5G04B 4BBQA 2FUUA 2RR4A 3PLWA 2CKLB 4O62A 3SOXA 5DINA 3GV4A 2CRWA 3GL6A 4WZ0A 2M85A 2Y1NA 5SVXA 5TABA 2VP7A 5B8DA 3U5PA 5FB0A 2PNXA 2L43A 1X4UA 3C6WA 2JUNA 5K3QA 2M6MA 3LQIA 2OWAA 1T1HA 2EGPA 2PUYA 2XOYA 1WFKA 1IYMA 3KDEC 1K2FA 2ZETC 4A49A 4FO9A 4CA1A 5SVIB 2G45A 4WZ2A 3L11A 3N9PA 1HYJA 1MM3A 4LK9A 2E6SA 2L75A 2IQJA 5LCWB 1WEMA 4S3OC 2KWNA 2YHNA 4UP0A 4FJCA 2MD7B 3FM8C 5D1LB 2KGGA 1U6GB 1E4UA 2BAYA 3LVRE 2KIZA 4GB0A 5KH3A 2YREA 2LGLA 2CRRA 2DX8A 5SVIA 2QJ0A 5G05B 1X4IA 2KR4A 4WA6A 3E2DA 2ECNA 2OXQC 3JUEA 3T6RA 4B86C 2VJFA 3LRQA 3N9NA 3LJUX 3MHSA 2HYED 2XOZA 4A0CD 2JMJA 3PURA 2D8SA 4NN2A 2VPGA 2LGGA 3ZVZB 2HDPA 5AITA 2QIZA 2ECWA 2FFWA 4W4UA 1Z6UA 2YVRA 2H0DB 5KH7A 2MT5A 1F62A 3N9OA 2KWKA 2L80A 4O64A 3DQVR 2L5UA 3KQIA 2YYRA 2RI7A 3M62A 4FIPA 3M63A 1WEWA 3C5KA 3KV6A 2YU4A 3PHDA 5B78A 2YQMA 2CSYA 2F6NA 3EB6A 5TDWA 2F42A 2LQ6A 2H0DA 2LXHC 3FAOA 1VD4A 5JG6A 2C2VS 2MD8C 3RPGB 2LV9A 1CHCA 3NG2A 4MSXA 1WESA 3HCTA 2XP0A 3LQHA 3KNVA 2K4DA 4X3GA 2ECJA 3FL2A 4R7EA 1MBMA 2JRJA 5AIUA 1WENA 5FEYA 1DVPA 4P5OB 2DSMA 5B79A 2CT2A 3VK6A 3T9KA 2M13A 1WEPA 3EB5A 1WEQA 2K17A 1WEUA 2MNZA 4LJNA 2KWOA 4Q6FA 3Q1DA 2KFTA 5C13A 4YC9A 4LLBA 3LQJA 2VJFB 5TDRA 2JM3A 2LDRA 4TKPB 2MNYA 4R2YA 2M1RA 4UI9B 2C2LA 4OGEA 2EA6A 2EXUA 4PPEA 4A4BA 4GNDA 1X4JA 2FUIA 5D1MB 5LKXA 2FD4A 5FB1A 3SOWA 5EYAF 2CONA 4PTBA
chains in the Genus database with same CATH topology
4AVXA 4GNEA 2YQLA 2LGKA 2Y43A 2JMDA 2MIQA 3V43A 2I50A 2YW8A 4LADB 1WE9A 2VPEA 5H1VA 4AUQB 3ZPVE 2KWJA 5G0FA 4F52B 4ZUXU 3N9LA 1Z60A 5C11A 2KREA 3N9MA 1JM7A 4I7BA 1BORA 2QICA 2Y1MA 4YADA 5KH9A 4GNFA 1WIMA 4L7XA 3RPGC 1FP0A 2ECVA 3DPLR 4ZQLA 3L1ZB 2MA6A 2KYUA 2VJEB 3N9QA 3ZPV1 2MA5A 1MM2A 2UZGA 2ECTA 4B7YC 2NAAA 3U5OA 4YATA 2F6JA 2XB1A 4A4CA 5B76A 4FK5A 4BHWA 2CSZA 2KE1A 2FSAA 4XI1A 3HCSA 4CCGX 4I7CA 4AYCA 2KGIA 4L58A 3RTRB 3ZNIA 4AP4A 5B77A 3U5MA 5J3XA 3QZVA 2VJEA 3O36A 2YHOA 2YURA 4C9ZA 2KU3A 3O7AA 4IC3A 4QF2A 1VFYA 2YUCA 5FERA 5H1UA 3ZVYA 4LKAA 1WEVA 4V3KC 3U5NA 2K16A 4YBMA 5TBNA 1HYIA 4QF3A 1JOCA 2YT5A 4UP5A 3SOUA 5H9MA 2RSDA 1RMDA 2CKLA 3ZTGA 2E6RA 1JM7B 1XWHA 2ECIA 4GNGA 5H1TA 2VNFA 2ECGA 3O70A 1FBVA 2EODA 3HCUA 2LXPC 2XEUA 1WEEA 1Z2QA 4WZ3B 3M99A 2K1JA 3T7LA 5B75A 3PUQA 2AN6A 4N4FA 4N3WA 2JMIA 3L1XA 5D1KB 2YSJA 2YSMA 4ZDTA 2L0BA 1WGMA 3ASLA 2G6QA 1V87A 5LKTA 4IC2A 4MVTA 2LN0A 4R8PK 3I2DA 4AYCB 4S3OB 4V3LC 3HTKC 5TRBA 3MHHA 5LKZA 4YBSA 3IHPA 4YBTA 1N87A 3O33A 5DKAA 3O37A 1G25A 2LGVA 3O35A 2VPDA 4I7DA 5I3LA 2G43A 2VPBA 4YAXA 3SHBA 2MUMA 2IDAA 1WILA 1VYXA 2M3HA 3O34A 1LDKC 1WEOA 5LKUA 3KV5A 1ZBDB 4YABA 3ZYQA 2LRIC 5G04B 1LDJB 4BBQA 2FUUA 2CKLB 3SOXA 5DINA 3GV4A 3GL6A 4WZ0A 2M85A 2Y1NA 5TABA 2VP7A 5B8DA 3U5PA 5FB0A 2PNXA 2L43A 1X4UA 3C6WA 2M6MA 3LQIA 1T1HA 2EGPA 2PUYA 1WFKA 1IYMA 1K2FA 2ZETC 4A49A 4FO9A 4CA1A 2G45A 4WZ2A 3L11A 3N9PA 1HYJA 1MM3A 4LK9A 2E6SA 2L75A 5LCWB 1WEMA 4S3OC 2KWNA 2YHNA 4UP0A 4FJCA 2MD7B 5D1LB 2KGGA 1U6GB 1E4UA 2BAYA 2KIZA 4GB0A 5KH3A 2YREA 2LGLA 2DX8A 2QJ0A 5G05B 1X4IA 2KR4A 4WA6A 2ECNA 2OXQC 3T6RA 4B86C 2VJFA 3LRQA 3N9NA 3MHSA 2HYED 4A0CD 2JMJA 3PURA 2D8SA 4NN2A 2VPGA 2LGGA 3ZVZB 2HDPA 5AITA 2QIZA 2ECWA 4W4UA 1Z6UA 2H0DB 5KH7A 2MT5A 1F62A 3N9OA 2KWKA 2L80A 4O64A 3DQVR 2L5UA 3KQIA 2YYRA 2RI7A 3M62A 4FIPA 3M63A 1WEWA 3C5KA 3KV6A 2YU4A 3PHDA 5B78A 2YQMA 2CSYA 2F6NA 3EB6A 5TDWA 2F42A 2LQ6A 2H0DA 2LXHC 1VD4A 5JG6A 2C2VS 2MD8C 3RPGB 2LV9A 1CHCA 3NG2A 4MSXA 1WESA 3HCTA 3LQHA 3KNVA 2K4DA 4X3GA 2ECJA 3FL2A 4R7EA 2JRJA 5AIUA 1WENA 5FEYA 1DVPA 4P5OB 5B79A 2CT2A 3VK6A 1WEPA 3EB5A 1WEQA 2K17A 1WEUA 2MNZA 4LJNA 2KWOA 4Q6FA 2KFTA 5C13A 4YC9A 4LLBA 3LQJA 5TDRA 2VJFB 2LDRA 4TKPB 2MNYA 4R2YA 2M1RA 4UI9B 2C2LA 2EA6A 4PPEA 4A4BA 4GNDA 1X4JA 2FUIA 5D1MB 5LKXA 5FB1A 3SOWA 5EYAF 4PTBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AVX A;  4GNE A;  2YQL A;  2LGK A;  2Y43 A;  2JMD A;  2MIQ A;  3V43 A;  2I50 A;  2YW8 A;  4LAD B;  1WE9 A;  2VPE A;  5H1V A;  4AUQ B;  3ZPV E;  2KWJ A;  5G0F A;  4F52 B;  4ZUX U;  3N9L A;  1Z60 A;  5C11 A;  2KRE A;  3N9M A;  1JM7 A;  4I7B A;  1BOR A;  2QIC A;  2Y1M A;  4YAD A;  5KH9 A;  4GNF A;  1WIM A;  4L7X A;  3RPG C;  1FP0 A;  2ECV A;  3DPL R;  4ZQL A;  3L1Z B;  2MA6 A;  2KYU A;  2VJE B;  3N9Q A;  3ZPV 1;  2MA5 A;  1MM2 A;  2UZG A;  2ECT A;  4B7Y C;  2NAA A;  3U5O A;  4YAT A;  2F6J A;  2XB1 A;  4A4C A;  5B76 A;  4FK5 A;  4BHW A;  2CSZ A;  2KE1 A;  2FSA A;  4XI1 A;  3HCS A;  4CCG X;  4I7C A;  4AYC A;  2KGI A;  4L58 A;  3RTR B;  3ZNI A;  4AP4 A;  5B77 A;  3U5M A;  5J3X A;  3QZV A;  2VJE A;  3O36 A;  2YHO A;  2YUR A;  4C9Z A;  2KU3 A;  3O7A A;  4IC3 A;  4QF2 A;  1VFY A;  2YUC A;  5FER A;  5H1U A;  3ZVY A;  4LKA A;  1WEV A;  4V3K C;  3U5N A;  2K16 A;  4YBM A;  5TBN A;  1HYI A;  4QF3 A;  1JOC A;  2YT5 A;  4UP5 A;  3SOU A;  5H9M A;  2RSD A;  1RMD A;  2CKL A;  3ZTG A;  2E6R A;  1JM7 B;  1XWH A;  2ECI A;  4GNG A;  5H1T A;  2VNF A;  2ECG A;  3O70 A;  1FBV A;  2EOD A;  3HCU A;  2LXP C;  2XEU A;  1WEE A;  1Z2Q A;  4WZ3 B;  3M99 A;  2K1J A;  3T7L A;  5B75 A;  3PUQ A;  2AN6 A;  4N4F A;  4N3W A;  2JMI A;  3L1X A;  5D1K B;  2YSJ A;  2YSM A;  4ZDT A;  2L0B A;  1WGM A;  3ASL A;  2G6Q A;  1V87 A;  5LKT A;  4IC2 A;  4MVT A;  2LN0 A;  4R8P K;  3I2D A;  4AYC B;  4S3O B;  4V3L C;  3HTK C;  5TRB A;  3MHH A;  5LKZ A;  4YBS A;  3IHP A;  4YBT A;  1N87 A;  3O33 A;  5DKA A;  3O37 A;  1G25 A;  2LGV A;  3O35 A;  2VPD A;  4I7D A;  5I3L A;  2G43 A;  2VPB A;  4YAX A;  3SHB A;  2MUM A;  2IDA A;  1WIL A;  1VYX A;  2M3H A;  3O34 A;  1LDK C;  1WEO A;  5LKU A;  3KV5 A;  1ZBD B;  4YAB A;  3ZYQ A;  2LRI C;  5G04 B;  1LDJ B;  4BBQ A;  2FUU A;  2CKL B;  3SOX A;  5DIN A;  3GV4 A;  3GL6 A;  4WZ0 A;  2M85 A;  2Y1N A;  5TAB A;  2VP7 A;  5B8D A;  3U5P A;  5FB0 A;  2PNX A;  2L43 A;  1X4U A;  3C6W A;  2M6M A;  3LQI A;  1T1H A;  2EGP A;  2PUY A;  1WFK A;  1IYM A;  1K2F A;  2ZET C;  4A49 A;  4FO9 A;  4CA1 A;  2G45 A;  4WZ2 A;  3L11 A;  3N9P A;  1HYJ A;  1MM3 A;  4LK9 A;  2E6S A;  2L75 A;  5LCW B;  1WEM A;  4S3O C;  2KWN A;  2YHN A;  4UP0 A;  4FJC A;  2MD7 B;  5D1L B;  2KGG A;  1U6G B;  1E4U A;  2BAY A;  2KIZ A;  4GB0 A;  5KH3 A;  2YRE A;  2LGL A;  2DX8 A;  2QJ0 A;  5G05 B;  1X4I A;  2KR4 A;  4WA6 A;  2ECN A;  2OXQ C;  3T6R A;  4B86 C;  2VJF A;  3LRQ A;  3N9N A;  3MHS A;  2HYE D;  4A0C D;  2JMJ A;  3PUR A;  2D8S A;  4NN2 A;  2VPG A;  2LGG A;  3ZVZ B;  2HDP A;  5AIT A;  2QIZ A;  2ECW A;  4W4U A;  1Z6U A;  2H0D B;  5KH7 A;  2MT5 A;  1F62 A;  3N9O A;  2KWK A;  2L80 A;  4O64 A;  3DQV R;  2L5U A;  3KQI A;  2YYR A;  2RI7 A;  3M62 A;  4FIP A;  3M63 A;  1WEW A;  3C5K A;  3KV6 A;  2YU4 A;  3PHD A;  5B78 A;  2YQM A;  2CSY A;  2F6N A;  3EB6 A;  5TDW A;  2F42 A;  2LQ6 A;  2H0D A;  2LXH C;  1VD4 A;  5JG6 A;  2C2V S;  2MD8 C;  3RPG B;  2LV9 A;  1CHC A;  3NG2 A;  4MSX A;  1WES A;  3HCT A;  3LQH A;  3KNV A;  2K4D A;  4X3G A;  2ECJ A;  3FL2 A;  4R7E A;  2JRJ A;  5AIU A;  1WEN A;  5FEY A;  1DVP A;  4P5O B;  5B79 A;  2CT2 A;  3VK6 A;  1WEP A;  3EB5 A;  1WEQ A;  2K17 A;  1WEU A;  2MNZ A;  4LJN A;  2KWO A;  4Q6F A;  2KFT A;  5C13 A;  4YC9 A;  4LLB A;  3LQJ A;  5TDR A;  2VJF B;  2LDR A;  4TKP B;  2MNY A;  4R2Y A;  2M1R A;  4UI9 B;  2C2L A;  2EA6 A;  4PPE A;  4A4B A;  4GND A;  1X4J A;  2FUI A;  5D1M B;  5LKX A;  5FB1 A;  3SOW A;  5EYA F;  4PTB A; 
#chains in the Genus database with same CATH topology
 4F1P A;  4AVX A;  4GNE A;  2YQL A;  2LGK A;  1DCQ A;  2JMD A;  2Y43 A;  2MIQ A;  3V43 A;  2I50 A;  2E61 A;  2YW8 A;  4LAD B;  1WE9 A;  2VPE A;  5H1V A;  4AUQ B;  4OGC A;  3ZPV E;  2KWJ A;  5G0F A;  4F52 B;  4ZUX U;  3N9L A;  1Z60 A;  5C11 A;  2KRE A;  3N9M A;  1JM7 A;  2L7P A;  4I7B A;  1BOR A;  2QIC A;  2Y1M A;  4YAD A;  3H7H A;  5KH9 A;  4GNF A;  1WIM A;  4L7X A;  2KKY A;  3LVQ E;  3RPG C;  1FP0 A;  2ECV A;  4H9D A;  3DPL R;  4ZQL A;  3L1Z B;  2MA6 A;  2KYU A;  2KKX A;  2VJE B;  3N9Q A;  3ZPV 1;  2MA5 A;  3DDT A;  1MM2 A;  2UZG A;  2ECT A;  3SUB A;  4B7Y C;  3FJU B;  2NAA A;  3U5O A;  4Z0R A;  4YAT A;  2F6J A;  2XB1 A;  4A4C A;  5B76 A;  4FK5 A;  4BHW A;  2CSZ A;  2KE1 A;  2FSA A;  4XI1 A;  3HCS A;  4CCG X;  4I7C A;  2DJA A;  4AYC A;  2KGI A;  4L58 A;  3RTR B;  3ZNI A;  4AP4 A;  5B77 A;  3U5M A;  5J3X A;  3QZV A;  2VJE A;  3O36 A;  2YHO A;  2YUR A;  4C9Z A;  2KU3 A;  3O7A A;  4IC3 A;  4QF2 A;  1VFY A;  2YUC A;  5FER A;  5H1U A;  5SVY A;  3ZVY A;  4LKA A;  1WEV A;  3FAN A;  4V3K C;  3U5N A;  2K16 A;  4YBM A;  5TBN A;  1HYI A;  4QF3 A;  1JOC A;  2YT5 A;  2P57 A;  4UP5 A;  3SOU A;  5H9M A;  2RSD A;  1RMD A;  3O47 A;  2CKL A;  3ZTG A;  2E6R A;  1JM7 B;  1XWH A;  2ECI A;  4QQ4 A;  4GNG A;  5H1T A;  2VNF A;  3DWD A;  2ECG A;  3O70 A;  1FBV A;  2EOD A;  2CSV A;  3HCU A;  2XOC A;  2LXP C;  2XEU A;  1WEE A;  1Z2Q A;  4WZ3 B;  3M99 A;  2K1J A;  3T7L A;  5B75 A;  3PUQ A;  2AN6 A;  4N4F A;  4N3W A;  2JMI A;  3L1X A;  5D1K B;  2YSJ A;  2YSM A;  4ZDT A;  2EGM A;  2L0B A;  1WGM A;  3ASL A;  2G6Q A;  3MDB C;  1V87 A;  5LKT A;  4IC2 A;  4MVT A;  2LN0 A;  4R8P K;  3I2D A;  4AYC B;  4S3O B;  4V3L C;  2B0O E;  3HTK C;  5TRB A;  3MHH A;  5LKZ A;  4YBS A;  3IHP A;  4YBT A;  1N87 A;  3O33 A;  5DKA A;  3O37 A;  1G25 A;  2LGV A;  3O35 A;  2VPD A;  4I7D A;  5I3L A;  2G43 A;  2VPB A;  2LAU A;  4YAX A;  3SHB A;  2MUM A;  2IDA A;  1WIL A;  1VYX A;  2M3H A;  3O34 A;  4Z0O A;  3M7K A;  1LDK C;  2D8U A;  1WEO A;  5LKU A;  3KV5 A;  1ZBD B;  3FEH A;  3LDY A;  4YAB A;  3ZYQ A;  2LRI C;  2MKE A;  1LDJ B;  5G04 B;  4BBQ A;  2FUU A;  2RR4 A;  3PLW A;  2CKL B;  4O62 A;  3SOX A;  5DIN A;  3GV4 A;  2CRW A;  3GL6 A;  4WZ0 A;  2M85 A;  2Y1N A;  5SVX A;  5TAB A;  2VP7 A;  5B8D A;  3U5P A;  5FB0 A;  2PNX A;  2L43 A;  1X4U A;  3C6W A;  2JUN A;  5K3Q A;  2M6M A;  3LQI A;  2OWA A;  1T1H A;  2EGP A;  2PUY A;  2XOY A;  1WFK A;  1IYM A;  3KDE C;  1K2F A;  2ZET C;  4A49 A;  4FO9 A;  4CA1 A;  5SVI B;  2G45 A;  4WZ2 A;  3L11 A;  3N9P A;  1HYJ A;  1MM3 A;  4LK9 A;  2E6S A;  2L75 A;  2IQJ A;  5LCW B;  1WEM A;  4S3O C;  2KWN A;  2YHN A;  4UP0 A;  4FJC A;  2MD7 B;  3FM8 C;  5D1L B;  2KGG A;  1U6G B;  1E4U A;  2BAY A;  3LVR E;  2KIZ A;  4GB0 A;  5KH3 A;  2YRE A;  2LGL A;  2CRR A;  2DX8 A;  5SVI A;  2QJ0 A;  5G05 B;  1X4I A;  2KR4 A;  4WA6 A;  3E2D A;  2ECN A;  2OXQ C;  3JUE A;  3T6R A;  4B86 C;  2VJF A;  3LRQ A;  3N9N A;  3LJU X;  3MHS A;  2HYE D;  2XOZ A;  4A0C D;  2JMJ A;  3PUR A;  2D8S A;  4NN2 A;  2VPG A;  2LGG A;  3ZVZ B;  2HDP A;  5AIT A;  2QIZ A;  2ECW A;  2FFW A;  4W4U A;  1Z6U A;  2YVR A;  2H0D B;  5KH7 A;  2MT5 A;  1F62 A;  3N9O A;  2KWK A;  2L80 A;  4O64 A;  3DQV R;  2L5U A;  3KQI A;  2YYR A;  2RI7 A;  3M62 A;  4FIP A;  3M63 A;  1WEW A;  3C5K A;  3KV6 A;  2YU4 A;  3PHD A;  5B78 A;  2YQM A;  2CSY A;  2F6N A;  3EB6 A;  5TDW A;  2F42 A;  2LQ6 A;  2H0D A;  2LXH C;  3FAO A;  1VD4 A;  5JG6 A;  2C2V S;  2MD8 C;  3RPG B;  2LV9 A;  1CHC A;  3NG2 A;  4MSX A;  1WES A;  3HCT A;  2XP0 A;  3LQH A;  3KNV A;  2K4D A;  4X3G A;  2ECJ A;  3FL2 A;  4R7E A;  1MBM A;  2JRJ A;  5AIU A;  1WEN A;  5FEY A;  1DVP A;  4P5O B;  2DSM A;  5B79 A;  2CT2 A;  3VK6 A;  3T9K A;  2M13 A;  1WEP A;  3EB5 A;  1WEQ A;  2K17 A;  1WEU A;  2MNZ A;  4LJN A;  2KWO A;  4Q6F A;  3Q1D A;  2KFT A;  5C13 A;  4YC9 A;  4LLB A;  3LQJ A;  2VJF B;  5TDR A;  2JM3 A;  2LDR A;  4TKP B;  2MNY A;  4R2Y A;  2M1R A;  4UI9 B;  2C2L A;  4OGE A;  2EA6 A;  2EXU A;  4PPE A;  4A4B A;  4GND A;  1X4J A;  2FUI A;  5D1M B;  5LKX A;  2FD4 A;  5FB1 A;  3SOW A;  5EYA F;  2CON A;  4PTB A; 
#chains in the Genus database with same CATH homology
 4AVX A;  4GNE A;  2YQL A;  2LGK A;  2Y43 A;  2JMD A;  2MIQ A;  3V43 A;  2I50 A;  2YW8 A;  4LAD B;  1WE9 A;  2VPE A;  5H1V A;  4AUQ B;  3ZPV E;  2KWJ A;  5G0F A;  4F52 B;  4ZUX U;  3N9L A;  1Z60 A;  5C11 A;  2KRE A;  3N9M A;  1JM7 A;  4I7B A;  1BOR A;  2QIC A;  2Y1M A;  4YAD A;  5KH9 A;  4GNF A;  1WIM A;  4L7X A;  3RPG C;  1FP0 A;  2ECV A;  3DPL R;  4ZQL A;  3L1Z B;  2MA6 A;  2KYU A;  2VJE B;  3N9Q A;  3ZPV 1;  2MA5 A;  1MM2 A;  2UZG A;  2ECT A;  4B7Y C;  2NAA A;  3U5O A;  4YAT A;  2F6J A;  2XB1 A;  4A4C A;  5B76 A;  4FK5 A;  4BHW A;  2CSZ A;  2KE1 A;  2FSA A;  4XI1 A;  3HCS A;  4CCG X;  4I7C A;  4AYC A;  2KGI A;  4L58 A;  3RTR B;  3ZNI A;  4AP4 A;  5B77 A;  3U5M A;  5J3X A;  3QZV A;  2VJE A;  3O36 A;  2YHO A;  2YUR A;  4C9Z A;  2KU3 A;  3O7A A;  4IC3 A;  4QF2 A;  1VFY A;  2YUC A;  5FER A;  5H1U A;  3ZVY A;  4LKA A;  1WEV A;  4V3K C;  3U5N A;  2K16 A;  4YBM A;  5TBN A;  1HYI A;  4QF3 A;  1JOC A;  2YT5 A;  4UP5 A;  3SOU A;  5H9M A;  2RSD A;  1RMD A;  2CKL A;  3ZTG A;  2E6R A;  1JM7 B;  1XWH A;  2ECI A;  4GNG A;  5H1T A;  2VNF A;  2ECG A;  3O70 A;  1FBV A;  2EOD A;  3HCU A;  2LXP C;  2XEU A;  1WEE A;  1Z2Q A;  4WZ3 B;  3M99 A;  2K1J A;  3T7L A;  5B75 A;  3PUQ A;  2AN6 A;  4N4F A;  4N3W A;  2JMI A;  3L1X A;  5D1K B;  2YSJ A;  2YSM A;  4ZDT A;  2L0B A;  1WGM A;  3ASL A;  2G6Q A;  1V87 A;  5LKT A;  4IC2 A;  4MVT A;  2LN0 A;  4R8P K;  3I2D A;  4AYC B;  4S3O B;  4V3L C;  3HTK C;  5TRB A;  3MHH A;  5LKZ A;  4YBS A;  3IHP A;  4YBT A;  1N87 A;  3O33 A;  5DKA A;  3O37 A;  1G25 A;  2LGV A;  3O35 A;  2VPD A;  4I7D A;  5I3L A;  2G43 A;  2VPB A;  4YAX A;  3SHB A;  2MUM A;  2IDA A;  1WIL A;  1VYX A;  2M3H A;  3O34 A;  1LDK C;  1WEO A;  5LKU A;  3KV5 A;  1ZBD B;  4YAB A;  3ZYQ A;  2LRI C;  5G04 B;  1LDJ B;  4BBQ A;  2FUU A;  2CKL B;  3SOX A;  5DIN A;  3GV4 A;  3GL6 A;  4WZ0 A;  2M85 A;  2Y1N A;  5TAB A;  2VP7 A;  5B8D A;  3U5P A;  5FB0 A;  2PNX A;  2L43 A;  1X4U A;  3C6W A;  2M6M A;  3LQI A;  1T1H A;  2EGP A;  2PUY A;  1WFK A;  1IYM A;  1K2F A;  2ZET C;  4A49 A;  4FO9 A;  4CA1 A;  2G45 A;  4WZ2 A;  3L11 A;  3N9P A;  1HYJ A;  1MM3 A;  4LK9 A;  2E6S A;  2L75 A;  5LCW B;  1WEM A;  4S3O C;  2KWN A;  2YHN A;  4UP0 A;  4FJC A;  2MD7 B;  5D1L B;  2KGG A;  1U6G B;  1E4U A;  2BAY A;  2KIZ A;  4GB0 A;  5KH3 A;  2YRE A;  2LGL A;  2DX8 A;  2QJ0 A;  5G05 B;  1X4I A;  2KR4 A;  4WA6 A;  2ECN A;  2OXQ C;  3T6R A;  4B86 C;  2VJF A;  3LRQ A;  3N9N A;  3MHS A;  2HYE D;  4A0C D;  2JMJ A;  3PUR A;  2D8S A;  4NN2 A;  2VPG A;  2LGG A;  3ZVZ B;  2HDP A;  5AIT A;  2QIZ A;  2ECW A;  4W4U A;  1Z6U A;  2H0D B;  5KH7 A;  2MT5 A;  1F62 A;  3N9O A;  2KWK A;  2L80 A;  4O64 A;  3DQV R;  2L5U A;  3KQI A;  2YYR A;  2RI7 A;  3M62 A;  4FIP A;  3M63 A;  1WEW A;  3C5K A;  3KV6 A;  2YU4 A;  3PHD A;  5B78 A;  2YQM A;  2CSY A;  2F6N A;  3EB6 A;  5TDW A;  2F42 A;  2LQ6 A;  2H0D A;  2LXH C;  1VD4 A;  5JG6 A;  2C2V S;  2MD8 C;  3RPG B;  2LV9 A;  1CHC A;  3NG2 A;  4MSX A;  1WES A;  3HCT A;  3LQH A;  3KNV A;  2K4D A;  4X3G A;  2ECJ A;  3FL2 A;  4R7E A;  2JRJ A;  5AIU A;  1WEN A;  5FEY A;  1DVP A;  4P5O B;  5B79 A;  2CT2 A;  3VK6 A;  1WEP A;  3EB5 A;  1WEQ A;  2K17 A;  1WEU A;  2MNZ A;  4LJN A;  2KWO A;  4Q6F A;  2KFT A;  5C13 A;  4YC9 A;  4LLB A;  3LQJ A;  5TDR A;  2VJF B;  2LDR A;  4TKP B;  2MNY A;  4R2Y A;  2M1R A;  4UI9 B;  2C2L A;  2EA6 A;  4PPE A;  4A4B A;  4GND A;  1X4J A;  2FUI A;  5D1M B;  5LKX A;  5FB1 A;  3SOW A;  5EYA F;  4PTB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...