2LAUA

Solution structure of the thap-zinc finger domain 1-81 from the cell growth suppressor human thap11 protein
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
81
structure length
81
Chain Sequence
GSPGFTCCVPGCYNNSHRDKALHFYTFPKDAELRRLWLKNVSRAGVSGCFSTFQPTTGHRLCSVHFQGGRKTYTVRVPTIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the THAP domain from the cell growth suppressor human THAP11
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords THAP domain-containing protein 11
total genus 6
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2011-03-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.180 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2lauA00
2JM3A 3KDEC 2LAUA
chains in the Genus database with same CATH superfamily
2KWKA 2C2VS 4TKPB 1RMDA 4H9DA 1WILA 4LKAA 4N3WA 5SVXA 2DX8A 5H1UA 2RI7A 3ASLA 3O34A 3RPGC 3DQVR 5G04B 1MM3A 4NN2A 1HYJA 3ZYQA 3EB6A 2YT5A 4FK5A 1VYXA 3QZVA 4L7XA 3SOXA 3DDTA 3PHDA 2JMJA 2KWOA 2MUMA 2DSMA 3L1ZB 1CHCA 1WEEA 4V3LC 5H1TA 3KV6A 4AVXA 2ECJA 2LN0A 2YSMA 5TBNA 2VJEB 4YC9A 2IQJA 3N9LA 2F6NA 4UP5A 2VJFA 3MHHA 2KGIA 4LJNA 3N9OA 1N87A 1WEVA 5J3XA 1WEUA 2P57A 4X3GA 5AIUA 2LRIC 5B77A 1Z6UA 4AYCA 1Z60A 2HYED 2EGPA 2NAAA 4FJCA 5B79A 5B8DA 2B0OE 5C13A 1DCQA 4YBSA 2JM3A 2YREA 5SVYA 2MT5A 5TRBA 3O47A 5SVIA 2M6MA 3O70A 2E61A 2MIQA 2G43A 3M63A 4IC2A 2MD8C 4BBQA 1JM7A 4P5OB 3H7HA 4IC3A 4WZ3B 3LVRE 4B7YC 4GNEA 2YVRA 2QICA 2LGVA 2PUYA 2CSYA 2YUCA 4ZQLA 2M3HA 4YBMA 1WEQA 4F52B 3EB5A 2Y1MA 2FD4A 2JUNA 3FJUB 2K4DA 5LKZA 2KWNA 4S3OB 1WEPA 2KGGA 2C2LA 3O7AA 2H0DB 2VJEA 2JMDA 3U5PA 1ZBDB 3HCSA 3LQJA 2XOYA 3IHPA 3PUQA 4PPEA 2FSAA 2Y1NA 1WESA 2OWAA 1WIMA 2LQ6A 3M62A 1IYMA 3FEHA 2MA5A 4LK9A 2ECIA 2D8SA 1MBMA 4YABA 3HTKC 2KWJA 5H9MA 2KKXA 2ECNA 2E6RA 2KREA 2VNFA 4V3KC 2L80A 2XEUA 3FL2A 5B78A 2KIZA 4QF2A 4QQ4A 5LKXA 2ECWA 2CSVA 2KU3A 3U5OA 3ZPV1 3LVQE 3L11A 2ECVA 4OGEA 2CONA 1WEMA 3ZTGA 5D1MB 2XOZA 4R7EA 4MVTA 3GV4A 2PNXA 2K16A 1LDKC 2E6SA 2M13A 2H0DA 3N9NA 3LQHA 2BAYA 4AYCB 3MDBC 3NG2A 4L58A 2M1RA 4A4BA 5KH7A 4OGCA 1VFYA 3LRQA 3O35A 4AUQB 2L7PA 3HCTA 1WEOA 3N9PA 4Z0OA 3U5NA 3Q1DA 2LGGA 3HCUA 3FM8C 5AITA 5D1KB 3FAOA 4WZ0A 3E2DA 2KYUA 2CRRA 3KQIA 1T1HA 4AP4A 3KDEC 2LXPC 5FEYA 3DWDA 3O37A 3N9MA 1MM2A 2RR4A 4A0CD 2YYRA 4C9ZA 2JRJA 3C6WA 5LKUA 3O33A 1E4UA 3C5KA 4FIPA 2F6JA 3GL6A 4A49A 4I7DA 4GB0A 1HYIA 5TDRA 5SVIB 2YHOA 5D1LB 4WA6A 1F62A 5FERA 2XOCA 2CT2A 4BHWA 2VPDA 2ECTA 2VJFB 5C11A 4LLBA 3MHSA 2YW8A 1K2FA 3RPGB 1WE9A 5FB1A 4UI9B 1WEWA 4F1PA 2VPGA 5G0FA 2LGLA 2EODA 2FFWA 3LQIA 1DVPA 2MNYA 2YSJA 3KV5A 3FANA 3ZNIA 2YURA 2XP0A 4GNDA 3ZVYA 4CA1A 4I7BA 3I2DA 3LDYA 4YATA 2YHNA 3ZVZB 2FUUA 2EXUA 2VP7A 3V43A 2RSDA 5LKTA 5EYAF 5DKAA 2VPBA 3PLWA 3DPLR 1VD4A 4GNGA 5KH9A 1Z2QA 1JM7B 4O62A 2LGKA 2ECGA 5KH3A 3SOWA 5H1VA 1WGMA 1LDJB 3N9QA 2DJAA 3JUEA 4QF3A 4CCGX 3M7KA 3PURA 4YBTA 4Z0RA 5TABA 2EGMA 2MD7B 4PTBA 2CKLB 2JMIA 4Q6FA 2YQMA 2CKLA 3T6RA 3ZPVE 4A4CA 1U6GB 2LAUA 2YQLA 2IDAA 5DINA 2ZETC 5B76A 3U5MA 2VPEA 2KKYA 5G05B 1V87A 2CSZA 2G45A 4R2YA 2MA6A 3L1XA 4WZ2A 2MKEA 2AN6A 2L0BA 1WENA 5TDWA 2I50A 5LCWB 2L5UA 4XI1A 4B86C 2YU4A 4N4FA 4S3OC 4YAXA 2L75A 2K1JA 3M99A 1X4IA 2XB1A 4UP0A 2EA6A 1XWHA 2M85A 4GNFA 4MSXA 2Y43A 2KFTA 4R8PK 5FB0A 2OXQC 2FUIA 2HDPA 3T7LA 4ZUXU 2D8UA 4ZDTA 4O64A 3SHBA 4FO9A 3SUBA 4LADB 1JOCA 1G25A 2KR4A 2MNZA 3O36A 5I3LA 2F42A 5JG6A 3T9KA 1FP0A 2LXHC 1FBVA 4W4UA 3SOUA 1X4JA 1X4UA 3LJUX 4YADA 2UZGA 4I7CA 1BORA 2CRWA 1WFKA 5K3QA 2QIZA 2KE1A 3RTRB 2L43A 3KNVA 5B75A 2LV9A 2QJ0A 2K17A 2LDRA 3VK6A 2G6QA
chains in the Genus database with same CATH topology
3DDTA 3H7HA 2EGMA 2P57A 2RR4A 3LJUX 2XOZA 3PLWA 4OGCA 4H9DA 2MKEA 2XP0A 2L7PA 2CRWA 3LVRE 5K3QA 5SVXA 4Z0OA 2XOYA 2D8UA 2B0OE 2LAUA 1DCQA 3Q1DA 2OWAA 2JM3A 3LDYA 3FM8C 2YREA 2YVRA 5SVYA 4O62A 3FEHA 4F1PA 2M13A 2IQJA 3E2DA 3O47A 4QQ4A 3SUBA 2CRRA 5SVIA 2KKYA 2FFWA 2CSVA 2DJAA 2E61A 5SVIB 2CONA 3LVQE 3JUEA 3MDBC 2EXUA 2FD4A 2XOCA 4OGEA 2KKXA 2JUNA 3T9KA 3FJUB 3M7KA 3DWDA 3KDEC 4Z0RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JM3 A;  3KDE C;  2LAU A; 
#chains in the Genus database with same CATH topology
 2KWK A;  2C2V S;  4TKP B;  1RMD A;  4H9D A;  1WIL A;  4LKA A;  4N3W A;  5SVX A;  2DX8 A;  5H1U A;  2RI7 A;  3ASL A;  3O34 A;  3RPG C;  3DQV R;  5G04 B;  1MM3 A;  4NN2 A;  1HYJ A;  3ZYQ A;  3EB6 A;  2YT5 A;  4FK5 A;  1VYX A;  3QZV A;  4L7X A;  3SOX A;  3DDT A;  3PHD A;  2JMJ A;  2KWO A;  2MUM A;  2DSM A;  3L1Z B;  1CHC A;  1WEE A;  4V3L C;  5H1T A;  3KV6 A;  4AVX A;  2ECJ A;  2LN0 A;  2YSM A;  5TBN A;  2VJE B;  4YC9 A;  2IQJ A;  3N9L A;  2F6N A;  4UP5 A;  2VJF A;  3MHH A;  2KGI A;  4LJN A;  3N9O A;  1N87 A;  1WEV A;  5J3X A;  1WEU A;  2P57 A;  4X3G A;  5AIU A;  2LRI C;  5B77 A;  1Z6U A;  4AYC A;  1Z60 A;  2HYE D;  2EGP A;  2NAA A;  4FJC A;  5B79 A;  5B8D A;  2B0O E;  5C13 A;  1DCQ A;  4YBS A;  2JM3 A;  2YRE A;  5SVY A;  2MT5 A;  5TRB A;  3O47 A;  5SVI A;  2M6M A;  3O70 A;  2E61 A;  2MIQ A;  2G43 A;  3M63 A;  4IC2 A;  2MD8 C;  4BBQ A;  1JM7 A;  4P5O B;  3H7H A;  4IC3 A;  4WZ3 B;  3LVR E;  4B7Y C;  4GNE A;  2YVR A;  2QIC A;  2LGV A;  2PUY A;  2CSY A;  2YUC A;  4ZQL A;  2M3H A;  4YBM A;  1WEQ A;  4F52 B;  3EB5 A;  2Y1M A;  2FD4 A;  2JUN A;  3FJU B;  2K4D A;  5LKZ A;  2KWN A;  4S3O B;  1WEP A;  2KGG A;  2C2L A;  3O7A A;  2H0D B;  2VJE A;  2JMD A;  3U5P A;  1ZBD B;  3HCS A;  3LQJ A;  2XOY A;  3IHP A;  3PUQ A;  4PPE A;  2FSA A;  2Y1N A;  1WES A;  2OWA A;  1WIM A;  2LQ6 A;  3M62 A;  1IYM A;  3FEH A;  2MA5 A;  4LK9 A;  2ECI A;  2D8S A;  1MBM A;  4YAB A;  3HTK C;  2KWJ A;  5H9M A;  2KKX A;  2ECN A;  2E6R A;  2KRE A;  2VNF A;  4V3K C;  2L80 A;  2XEU A;  3FL2 A;  5B78 A;  2KIZ A;  4QF2 A;  4QQ4 A;  5LKX A;  2ECW A;  2CSV A;  2KU3 A;  3U5O A;  3ZPV 1;  3LVQ E;  3L11 A;  2ECV A;  4OGE A;  2CON A;  1WEM A;  3ZTG A;  5D1M B;  2XOZ A;  4R7E A;  4MVT A;  3GV4 A;  2PNX A;  2K16 A;  1LDK C;  2E6S A;  2M13 A;  2H0D A;  3N9N A;  3LQH A;  2BAY A;  4AYC B;  3MDB C;  3NG2 A;  4L58 A;  2M1R A;  4A4B A;  5KH7 A;  4OGC A;  1VFY A;  3LRQ A;  3O35 A;  4AUQ B;  2L7P A;  3HCT A;  1WEO A;  3N9P A;  4Z0O A;  3U5N A;  3Q1D A;  2LGG A;  3HCU A;  3FM8 C;  5AIT A;  5D1K B;  3FAO A;  4WZ0 A;  3E2D A;  2KYU A;  2CRR A;  3KQI A;  1T1H A;  4AP4 A;  3KDE C;  2LXP C;  5FEY A;  3DWD A;  3O37 A;  3N9M A;  1MM2 A;  2RR4 A;  4A0C D;  2YYR A;  4C9Z A;  2JRJ A;  3C6W A;  5LKU A;  3O33 A;  1E4U A;  3C5K A;  4FIP A;  2F6J A;  3GL6 A;  4A49 A;  4I7D A;  4GB0 A;  1HYI A;  5TDR A;  5SVI B;  2YHO A;  5D1L B;  4WA6 A;  1F62 A;  5FER A;  2XOC A;  2CT2 A;  4BHW A;  2VPD A;  2ECT A;  2VJF B;  5C11 A;  4LLB A;  3MHS A;  2YW8 A;  1K2F A;  3RPG B;  1WE9 A;  5FB1 A;  4UI9 B;  1WEW A;  4F1P A;  2VPG A;  5G0F A;  2LGL A;  2EOD A;  2FFW A;  3LQI A;  1DVP A;  2MNY A;  2YSJ A;  3KV5 A;  3FAN A;  3ZNI A;  2YUR A;  2XP0 A;  4GND A;  3ZVY A;  4CA1 A;  4I7B A;  3I2D A;  3LDY A;  4YAT A;  2YHN A;  3ZVZ B;  2FUU A;  2EXU A;  2VP7 A;  3V43 A;  2RSD A;  5LKT A;  5EYA F;  5DKA A;  2VPB A;  3PLW A;  3DPL R;  1VD4 A;  4GNG A;  5KH9 A;  1Z2Q A;  1JM7 B;  4O62 A;  2LGK A;  2ECG A;  5KH3 A;  3SOW A;  5H1V A;  1WGM A;  1LDJ B;  3N9Q A;  2DJA A;  3JUE A;  4QF3 A;  4CCG X;  3M7K A;  3PUR A;  4YBT A;  4Z0R A;  5TAB A;  2EGM A;  2MD7 B;  4PTB A;  2CKL B;  2JMI A;  4Q6F A;  2YQM A;  2CKL A;  3T6R A;  3ZPV E;  4A4C A;  1U6G B;  2LAU A;  2YQL A;  2IDA A;  5DIN A;  2ZET C;  5B76 A;  3U5M A;  2VPE A;  2KKY A;  5G05 B;  1V87 A;  2CSZ A;  2G45 A;  4R2Y A;  2MA6 A;  3L1X A;  4WZ2 A;  2MKE A;  2AN6 A;  2L0B A;  1WEN A;  5TDW A;  2I50 A;  5LCW B;  2L5U A;  4XI1 A;  4B86 C;  2YU4 A;  4N4F A;  4S3O C;  4YAX A;  2L75 A;  2K1J A;  3M99 A;  1X4I A;  2XB1 A;  4UP0 A;  2EA6 A;  1XWH A;  2M85 A;  4GNF A;  4MSX A;  2Y43 A;  2KFT A;  4R8P K;  5FB0 A;  2OXQ C;  2FUI A;  2HDP A;  3T7L A;  4ZUX U;  2D8U A;  4ZDT A;  4O64 A;  3SHB A;  4FO9 A;  3SUB A;  4LAD B;  1JOC A;  1G25 A;  2KR4 A;  2MNZ A;  3O36 A;  5I3L A;  2F42 A;  5JG6 A;  3T9K A;  1FP0 A;  2LXH C;  1FBV A;  4W4U A;  3SOU A;  1X4J A;  1X4U A;  3LJU X;  4YAD A;  2UZG A;  4I7C A;  1BOR A;  2CRW A;  1WFK A;  5K3Q A;  2QIZ A;  2KE1 A;  3RTR B;  2L43 A;  3KNV A;  5B75 A;  2LV9 A;  2QJ0 A;  2K17 A;  2LDR A;  3VK6 A;  2G6Q A; 
#chains in the Genus database with same CATH homology
 3DDT A;  3H7H A;  2EGM A;  2P57 A;  2RR4 A;  3LJU X;  2XOZ A;  3PLW A;  4OGC A;  4H9D A;  2MKE A;  2XP0 A;  2L7P A;  2CRW A;  3LVR E;  5K3Q A;  5SVX A;  4Z0O A;  2XOY A;  2D8U A;  2B0O E;  2LAU A;  1DCQ A;  3Q1D A;  2OWA A;  2JM3 A;  3LDY A;  3FM8 C;  2YRE A;  2YVR A;  5SVY A;  4O62 A;  3FEH A;  4F1P A;  2M13 A;  2IQJ A;  3E2D A;  3O47 A;  4QQ4 A;  3SUB A;  2CRR A;  5SVI A;  2KKY A;  2FFW A;  2CSV A;  2DJA A;  2E61 A;  5SVI B;  2CON A;  3LVQ E;  3JUE A;  3MDB C;  2EXU A;  2FD4 A;  2XOC A;  4OGE A;  2KKX A;  2JUN A;  3T9K A;  3FJU B;  3M7K A;  3DWD A;  3KDE C;  4Z0R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...