2LAUA

Solution structure of the thap-zinc finger domain 1-81 from the cell growth suppressor human thap11 protein
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
81
structure length
81
Chain Sequence
GSPGFTCCVPGCYNNSHRDKALHFYTFPKDAELRRLWLKNVSRAGVSGCFSTFQPTTGHRLCSVHFQGGRKTYTVRVPTIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THAP domain-containing protein 11
publication title Solution structure of the THAP domain from the cell growth suppressor human THAP11
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 6
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2011-03-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.180 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2lauA00
3KDEC 2LAUA 2JM3A
chains in the Genus database with same CATH superfamily
2XOCA 5B76A 1N87A 1WEPA 4A4BA 4LJNA 2KR4A 3GL6A 3T6RA 3DWDA 2D8SA 2CT2A 2OWAA 2CKLB 4V3LC 2CKLA 4N3WA 4LLBA 2IDAA 2YW8A 2HDPA 5KH7A 3L11A 1VD4A 1JM7A 2DSMA 4XI1A 3L1ZB 5LCWB 4O64A 2LXPC 3O37A 1X4JA 3U5OA 5LKZA 2YSJA 1U6GB 2F42A 1WEUA 1DVPA 3U5MA 1CHCA 4UP0A 3LQIA 4S3OC 3MHSA 4OGEA 2LDRA 2KWJA 2CSZA 5DKAA 3SHBA 4GNGA 4Q6FA 2KWNA 5TRBA 2XEUA 5D1MB 2K4DA 3KDEC 3HCTA 2JUNA 2JRJA 4CA1A 2AN6A 2L80A 4W4UA 5H1TA 4C9ZA 2HYED 2YT5A 2K1JA 4H9DA 3ZPVE 3FAOA 3EB5A 2ZETC 2JMJA 3QZVA 3FEHA 1BORA 1FP0A 5TBNA 5TDWA 5DINA 4YAXA 1HYJA 3PURA 2M6MA 2YHOA 3O47A 4FK5A 5JG6A 2YURA 2MA5A 2LGVA 2XOYA 2M3HA 2F6NA 5KH3A 5H1UA 2E61A 2FFWA 5G04B 2LAUA 1G25A 4R7EA 1ZBDB 5H9MA 3M99A 1WEMA 1MBMA 1Z6UA 2KGGA 4B7YC 1MM2A 2ECJA 5C11A 2VP7A 2JMIA 3LQJA 3N9LA 2B0OE 3M63A 2UZGA 2YVRA 3FL2A 2KKXA 4IC3A 4AYCA 2Y1MA 1MM3A 4YC9A 1WE9A 2M1RA 4ZDTA 2EODA 4X3GA 2L43A 2JMDA 4YBMA 2KE1A 5FB0A 3SOXA 3E2DA 3FJUB 4PTBA 2M13A 5B77A 2QJ0A 4GNDA 2CRRA 2VJFB 1HYIA 4L7XA 2VJFA 3ZTGA 2VNFA 2KYUA 2LV9A 2CONA 4YABA 2FUUA 2E6SA 3HCSA 4PPEA 3IHPA 5FEYA 4AUQB 4A0CD 4R2YA 2G6QA 3NG2A 2YREA 2L5UA 2EA6A 5D1LB 4N4FA 3HTKC 2YSMA 3LDYA 2VPEA 1RMDA 3RTRB 4AVXA 2EXUA 2PUYA 5B78A 1V87A 4YBSA 3M7KA 3C6WA 3KV5A 3N9QA 4IC2A 3ASLA 2KFTA 3HCUA 5LKTA 4WA6A 4I7BA 2LGKA 2MIQA 2MA6A 4UI9B 3KNVA 3H7HA 2ECTA 4GNFA 1T1HA 2C2LA 3RPGB 2KWKA 4AP4A 3LQHA 4ZQLA 4I7DA 4OGCA 2FSAA 5B75A 4MSXA 3ZNIA 2L75A 4Z0OA 4V3KC 2K17A 2EGMA 2D8UA 2CRWA 3N9PA 2LRIC 3PHDA 4FIPA 5FERA 2KKYA 2KWOA 4F52B 1WEVA 3SUBA 3KQIA 5AIUA 2VPBA 3LJUX 4TKPB 4LADB 4CCGX 2FD4A 4I7CA 1DCQA 3V43A 2RI7A 2RSDA 4FJCA 4QQ4A 4S3OB 2H0DB 2XB1A 2YQMA 2JM3A 5LKUA 1WEWA 2YHNA 3KV6A 1F62A 2LQ6A 3ZYQA 5B79A 2MD8C 2ECIA 3FANA 2KREA 2OXQC 5G0FA 2YQLA 2C2VS 5SVXA 2VJEB 5G05B 4GB0A 1WFKA 1VFYA 4LKAA 3C5KA 2MD7B 3O36A 4FO9A 1WGMA 2ECVA 2YU4A 1JOCA 2E6RA 4WZ3B 2LXHC 4WZ2A 1E4UA 4YBTA 5H1VA 1Z2QA 2DX8A 4LK9A 2LN0A 1X4IA 2KU3A 2CSYA 3GV4A 5LKXA 1LDJB 3LVRE 3O70A 2G43A 2CSVA 2LGGA 2MT5A 2YUCA 3O35A 1XWHA 3SOUA 4P5OB 1VYXA 3U5PA 1JM7B 5TABA 3MHHA 3M62A 1LDKC 2EGPA 2RR4A 3DPLR 5SVYA 1WEEA 4UP5A 4B86C 3ZPV1 4BBQA 2I50A 2ECNA 2Y1NA 2VPDA 2L7PA 4YATA 2BAYA 4QF3A 2MNZA 1IYMA 3JUEA 1WENA 2ECGA 3N9OA 2XOZA 5D1KB 2FUIA 4BHWA 3O7AA 4O62A 3DDTA 1WILA 2VPGA 4YADA 5I3LA 2MKEA 3LRQA 2L0BA 3FM8C 2KGIA 1WESA 4MVTA 2XP0A 1WEOA 2Y43A 5J3XA 2DJAA 5TDRA 1WIMA 2P57A 4L58A 5C13A 3VK6A 3O33A 3Q1DA 4A4CA 2YYRA 2MNYA 2G45A 3T7LA 5KH9A 4GNEA 3SOWA 4ZUXU 3EB6A 4WZ0A 5B8DA 2QICA 3N9MA 5EYAF 2NAAA 2K16A 3N9NA 1Z60A 1K2FA 3MDBC 3U5NA 2QIZA 3ZVZB 2IQJA 3T9KA 4F1PA 2H0DA 2ECWA 2MUMA 3LVQE 2KIZA 1FBVA 5K3QA 5SVIB 5SVIA 2LGLA 4A49A 5FB1A 3I2DA 3O34A 3ZVYA 3DQVR 5AITA 1X4UA 2M85A 3PUQA 3L1XA 2VJEA 4QF2A 4Z0RA 1WEQA 4AYCB 4R8PK 2F6JA 2PNXA 3PLWA 4NN2A 3RPGC
chains in the Genus database with same CATH topology
3H7HA 2XP0A 4OGEA 2L7PA 2XOCA 2IQJA 2EXUA 3T9KA 2DJAA 2KKYA 2JM3A 2P57A 3FEHA 4F1PA 3JUEA 3LDYA 3M7KA 2XOZA 3LVQE 3Q1DA 3SUBA 3LJUX 5K3QA 4OGCA 3O47A 4O62A 5SVIB 3DWDA 3E2DA 3DDTA 3FJUB 5SVIA 3KDEC 2RR4A 5SVXA 2M13A 2B0OE 2JUNA 5SVYA 2CRRA 2YREA 2FD4A 3LVRE 1DCQA 2MKEA 2XOYA 2YVRA 4Z0RA 2CSVA 2OWAA 2KKXA 3FM8C 4Z0OA 4QQ4A 2E61A 2FFWA 2CONA 3PLWA 2EGMA 2LAUA 2D8UA 4H9DA 2CRWA 3MDBC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KDE C;  2LAU A;  2JM3 A; 
#chains in the Genus database with same CATH topology
 2XOC A;  5B76 A;  1N87 A;  1WEP A;  4A4B A;  4LJN A;  2KR4 A;  3GL6 A;  3T6R A;  3DWD A;  2D8S A;  2CT2 A;  2OWA A;  2CKL B;  4V3L C;  2CKL A;  4N3W A;  4LLB A;  2IDA A;  2YW8 A;  2HDP A;  5KH7 A;  3L11 A;  1VD4 A;  1JM7 A;  2DSM A;  4XI1 A;  3L1Z B;  5LCW B;  4O64 A;  2LXP C;  3O37 A;  1X4J A;  3U5O A;  5LKZ A;  2YSJ A;  1U6G B;  2F42 A;  1WEU A;  1DVP A;  3U5M A;  1CHC A;  4UP0 A;  3LQI A;  4S3O C;  3MHS A;  4OGE A;  2LDR A;  2KWJ A;  2CSZ A;  5DKA A;  3SHB A;  4GNG A;  4Q6F A;  2KWN A;  5TRB A;  2XEU A;  5D1M B;  2K4D A;  3KDE C;  3HCT A;  2JUN A;  2JRJ A;  4CA1 A;  2AN6 A;  2L80 A;  4W4U A;  5H1T A;  4C9Z A;  2HYE D;  2YT5 A;  2K1J A;  4H9D A;  3ZPV E;  3FAO A;  3EB5 A;  2ZET C;  2JMJ A;  3QZV A;  3FEH A;  1BOR A;  1FP0 A;  5TBN A;  5TDW A;  5DIN A;  4YAX A;  1HYJ A;  3PUR A;  2M6M A;  2YHO A;  3O47 A;  4FK5 A;  5JG6 A;  2YUR A;  2MA5 A;  2LGV A;  2XOY A;  2M3H A;  2F6N A;  5KH3 A;  5H1U A;  2E61 A;  2FFW A;  5G04 B;  2LAU A;  1G25 A;  4R7E A;  1ZBD B;  5H9M A;  3M99 A;  1WEM A;  1MBM A;  1Z6U A;  2KGG A;  4B7Y C;  1MM2 A;  2ECJ A;  5C11 A;  2VP7 A;  2JMI A;  3LQJ A;  3N9L A;  2B0O E;  3M63 A;  2UZG A;  2YVR A;  3FL2 A;  2KKX A;  4IC3 A;  4AYC A;  2Y1M A;  1MM3 A;  4YC9 A;  1WE9 A;  2M1R A;  4ZDT A;  2EOD A;  4X3G A;  2L43 A;  2JMD A;  4YBM A;  2KE1 A;  5FB0 A;  3SOX A;  3E2D A;  3FJU B;  4PTB A;  2M13 A;  5B77 A;  2QJ0 A;  4GND A;  2CRR A;  2VJF B;  1HYI A;  4L7X A;  2VJF A;  3ZTG A;  2VNF A;  2KYU A;  2LV9 A;  2CON A;  4YAB A;  2FUU A;  2E6S A;  3HCS A;  4PPE A;  3IHP A;  5FEY A;  4AUQ B;  4A0C D;  4R2Y A;  2G6Q A;  3NG2 A;  2YRE A;  2L5U A;  2EA6 A;  5D1L B;  4N4F A;  3HTK C;  2YSM A;  3LDY A;  2VPE A;  1RMD A;  3RTR B;  4AVX A;  2EXU A;  2PUY A;  5B78 A;  1V87 A;  4YBS A;  3M7K A;  3C6W A;  3KV5 A;  3N9Q A;  4IC2 A;  3ASL A;  2KFT A;  3HCU A;  5LKT A;  4WA6 A;  4I7B A;  2LGK A;  2MIQ A;  2MA6 A;  4UI9 B;  3KNV A;  3H7H A;  2ECT A;  4GNF A;  1T1H A;  2C2L A;  3RPG B;  2KWK A;  4AP4 A;  3LQH A;  4ZQL A;  4I7D A;  4OGC A;  2FSA A;  5B75 A;  4MSX A;  3ZNI A;  2L75 A;  4Z0O A;  4V3K C;  2K17 A;  2EGM A;  2D8U A;  2CRW A;  3N9P A;  2LRI C;  3PHD A;  4FIP A;  5FER A;  2KKY A;  2KWO A;  4F52 B;  1WEV A;  3SUB A;  3KQI A;  5AIU A;  2VPB A;  3LJU X;  4TKP B;  4LAD B;  4CCG X;  2FD4 A;  4I7C A;  1DCQ A;  3V43 A;  2RI7 A;  2RSD A;  4FJC A;  4QQ4 A;  4S3O B;  2H0D B;  2XB1 A;  2YQM A;  2JM3 A;  5LKU A;  1WEW A;  2YHN A;  3KV6 A;  1F62 A;  2LQ6 A;  3ZYQ A;  5B79 A;  2MD8 C;  2ECI A;  3FAN A;  2KRE A;  2OXQ C;  5G0F A;  2YQL A;  2C2V S;  5SVX A;  2VJE B;  5G05 B;  4GB0 A;  1WFK A;  1VFY A;  4LKA A;  3C5K A;  2MD7 B;  3O36 A;  4FO9 A;  1WGM A;  2ECV A;  2YU4 A;  1JOC A;  2E6R A;  4WZ3 B;  2LXH C;  4WZ2 A;  1E4U A;  4YBT A;  5H1V A;  1Z2Q A;  2DX8 A;  4LK9 A;  2LN0 A;  1X4I A;  2KU3 A;  2CSY A;  3GV4 A;  5LKX A;  1LDJ B;  3LVR E;  3O70 A;  2G43 A;  2CSV A;  2LGG A;  2MT5 A;  2YUC A;  3O35 A;  1XWH A;  3SOU A;  4P5O B;  1VYX A;  3U5P A;  1JM7 B;  5TAB A;  3MHH A;  3M62 A;  1LDK C;  2EGP A;  2RR4 A;  3DPL R;  5SVY A;  1WEE A;  4UP5 A;  4B86 C;  3ZPV 1;  4BBQ A;  2I50 A;  2ECN A;  2Y1N A;  2VPD A;  2L7P A;  4YAT A;  2BAY A;  4QF3 A;  2MNZ A;  1IYM A;  3JUE A;  1WEN A;  2ECG A;  3N9O A;  2XOZ A;  5D1K B;  2FUI A;  4BHW A;  3O7A A;  4O62 A;  3DDT A;  1WIL A;  2VPG A;  4YAD A;  5I3L A;  2MKE A;  3LRQ A;  2L0B A;  3FM8 C;  2KGI A;  1WES A;  4MVT A;  2XP0 A;  1WEO A;  2Y43 A;  5J3X A;  2DJA A;  5TDR A;  1WIM A;  2P57 A;  4L58 A;  5C13 A;  3VK6 A;  3O33 A;  3Q1D A;  4A4C A;  2YYR A;  2MNY A;  2G45 A;  3T7L A;  5KH9 A;  4GNE A;  3SOW A;  4ZUX U;  3EB6 A;  4WZ0 A;  5B8D A;  2QIC A;  3N9M A;  5EYA F;  2NAA A;  2K16 A;  3N9N A;  1Z60 A;  1K2F A;  3MDB C;  3U5N A;  2QIZ A;  3ZVZ B;  2IQJ A;  3T9K A;  4F1P A;  2H0D A;  2ECW A;  2MUM A;  3LVQ E;  2KIZ A;  1FBV A;  5K3Q A;  5SVI B;  5SVI A;  2LGL A;  4A49 A;  5FB1 A;  3I2D A;  3O34 A;  3ZVY A;  3DQV R;  5AIT A;  1X4U A;  2M85 A;  3PUQ A;  3L1X A;  2VJE A;  4QF2 A;  4Z0R A;  1WEQ A;  4AYC B;  4R8P K;  2F6J A;  2PNX A;  3PLW A;  4NN2 A;  3RPG C; 
#chains in the Genus database with same CATH homology
 3H7H A;  2XP0 A;  4OGE A;  2L7P A;  2XOC A;  2IQJ A;  2EXU A;  3T9K A;  2DJA A;  2KKY A;  2JM3 A;  2P57 A;  3FEH A;  4F1P A;  3JUE A;  3LDY A;  3M7K A;  2XOZ A;  3LVQ E;  3Q1D A;  3SUB A;  3LJU X;  5K3Q A;  4OGC A;  3O47 A;  4O62 A;  5SVI B;  3DWD A;  3E2D A;  3DDT A;  3FJU B;  5SVI A;  3KDE C;  2RR4 A;  5SVX A;  2M13 A;  2B0O E;  2JUN A;  5SVY A;  2CRR A;  2YRE A;  2FD4 A;  3LVR E;  1DCQ A;  2MKE A;  2XOY A;  2YVR A;  4Z0R A;  2CSV A;  2OWA A;  2KKX A;  3FM8 C;  4Z0O A;  4QQ4 A;  2E61 A;  2FFW A;  2CON A;  3PLW A;  2EGM A;  2LAU A;  2D8U A;  4H9D A;  2CRW A;  3MDB C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...