2LAUA

Solution structure of the thap-zinc finger domain 1-81 from the cell growth suppressor human thap11 protein
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
81
structure length
81
Chain Sequence
b'GSPGFTCCVPGCYNNSHRDKALHFYTFPKDAELRRLWLKNVSRAGVSGCFSTFQPTTGHRLCSVHFQGGRKTYTVRVPTIF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THAP domain-containing protein 11
publication title Solution structure of the THAP domain from the cell growth suppressor human THAP11
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 6
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2011-03-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.180 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2lauA00
2LAUA 2JM3A 3KDEC
chains in the Genus database with same CATH superfamily
5C13A 4LJNA 3SOUA 3IHPA 1K2FA 2P57A 1VD4A 3LQJA 2K4DA 2OXQC 2CSZA 3KV5A 2JRJA 2PNXA 3H7HA 4I7CA 2FUUA 2YQLA 3FM8C 2VPGA 4QF2A 3FJUB 3PUQA 3N9OA 4QQ4A 3HCTA 4AYCB 5KH7A 4YBMA 2VJFB 2XOCA 4B7YC 4ZUXU 4AUQB 3SOXA 2YU4A 3GV4A 3JUEA 5LKUA 3M62A 2KWJA 2XP0A 1RMDA 2LAUA 2Y1NA 2KYUA 2YW8A 2FFWA 2CKLA 2K1JA 4OGEA 4I7BA 4A0CD 3N9NA 4WZ0A 5KH3A 3KV6A 3FAOA 2VPDA 3LDYA 4AYCA 2YHOA 2RR4A 5SVXA 5LKTA 3LRQA 5DKAA 2H0DB 3U5OA 3LQIA 3E2DA 1IYMA 1Z2QA 2EXUA 2M13A 2KWKA 5H1TA 2YT5A 2QIZA 2EA6A 5SVIB 4LK9A 3T9KA 3L1ZB 3FANA 5FB1A 4R7EA 5D1KB 2LGKA 1WFKA 1N87A 3I2DA 2ZETC 2YQMA 2MIQA 3KNVA 2K17A 1WEMA 4V3KC 2K16A 4PPEA 2BAYA 4MVTA 4N3WA 4R8PK 5D1LB 3O33A 4LLBA 4FK5A 5G0FA 3L1XA 2H0DA 5B77A 3SOWA 2MNYA 1JM7B 5SVIA 3MHHA 4UI9B 3HCSA 1WIMA 2M6MA 2ECWA 4O64A 3O70A 5G05B 4OGCA 2FUIA 2E6RA 2MUMA 3KQIA 4O62A 2G43A 5KH9A 4AVXA 4Q6FA 4GNFA 2ECVA 3DDTA 4YADA 3HTKC 3SHBA 4NN2A 4PTBA 2KU3A 1VFYA 2D8UA 4UP0A 2YUCA 4AP4A 4GNGA 3GL6A 2JM3A 1JM7A 2MD7B 2ECNA 2YSMA 3EB6A 2JUNA 5FERA 2F6JA 3QZVA 2KFTA 4XI1A 3DQVR 2EODA 3RTRB 4WA6A 2L0BA 3ZPVE 2DX8A 2YSJA 2FD4A 1FP0A 3C6WA 2CRRA 3U5PA 1WE9A 4F1PA 1WGMA 3O37A 2F6NA 2KR4A 5DINA 4GNEA 2ECTA 2CSYA 2KREA 3LVRE 2B0OE 3O36A 2CSVA 1WEEA 2MA5A 1U6GB 2VPEA 4BBQA 1E4UA 2ECIA 2MD8C 4BHWA 5I3LA 1HYIA 2KE1A 2VJFA 5K3QA 1MBMA 1X4UA 4YATA 2LDRA 3O34A 5LKZA 3PLWA 5EYAF 2L75A 4GB0A 4IC3A 5FB0A 4YC9A 2LGGA 2VP7A 1LDJB 3N9MA 2LXHC 2Y1MA 1WEUA 2C2LA 5AIUA 1T1HA 4GNDA 2JMJA 4YBSA 3Q1DA 4S3OB 1WEPA 2YURA 2JMIA 1VYXA 3ZVZB 2VJEB 4YAXA 2D8SA 2FSAA 4C9ZA 2M3HA 4Z0OA 5H1VA 3LVQE 3N9PA 4LADB 2QICA 1CHCA 4FO9A 4A49A 2YHNA 3RPGC 2IDAA 2KKYA 1XWHA 5H1UA 2YREA 2KGIA 2L7PA 4B86C 3ZYQA 2I50A 2ECGA 2M1RA 3MDBC 3FEHA 2L43A 3ZNIA 2Y43A 2G6QA 2PUYA 1ZBDB 4ZDTA 1WILA 4L58A 2VJEA 4V3LC 3V43A 4P5OB 3M99A 2KIZA 3NG2A 2YVRA 1X4JA 4YBTA 4A4BA 3U5NA 5AITA 4H9DA 5SVYA 4S3OC 1DCQA 5C11A 2G45A 2KWOA 3KDEC 1V87A 3LQHA 3PHDA 3SUBA 2XOZA 5LKXA 2LV9A 1X4IA 1FBVA 2MA6A 3T7LA 2DJAA 5H9MA 4UP5A 4A4CA 2LN0A 2CKLB 3LJUX 2KKXA 3ZTGA 5FEYA 4I7DA 2MT5A 5TRBA 1JOCA 2VNFA 3U5MA 2HDPA 2CT2A 3M7KA 2LGVA 5B75A 3O7AA 1MM2A 2XOYA 4F52B 5B79A 2E61A 2KWNA 3RPGB 3MHSA 1Z60A 3O47A 3M63A 5B8DA 4FJCA 2F42A 3ZPV1 4IC2A 1HYJA 5TBNA 2L5UA 4X3GA 4Z0RA 5TDRA 2LGLA 2VPBA 1WEWA 4ZQLA 4CCGX 4CA1A 2NAAA 1WEQA 2M85A 2UZGA 1WESA 3T6RA 4TKPB 4YABA 2MNZA 3N9QA 2ECJA 2QJ0A 2LXPC 1MM3A 2HYED 5JG6A 2MKEA 3DWDA 4FIPA 1Z6UA 3FL2A 4MSXA 2RSDA 3C5KA 4R2YA 3N9LA 1F62A 2YYRA 5LCWB 3O35A 3DPLR 3HCUA 4L7XA 1DVPA 5G04B 1LDKC 1BORA 2LQ6A 3ZVYA 1WEVA 2LRIC 2CONA 5B78A 3VK6A 2XB1A 2EGMA 4N4FA 2OWAA 4WZ3B 2E6SA 2XEUA 1G25A 3ASLA 3L11A 3PURA 2L80A 2JMDA 2DSMA 3EB5A 2KGGA 5B76A 5J3XA 2RI7A 5TABA 4LKAA 4WZ2A 5TDWA 4W4UA 4QF3A 1WENA 2CRWA 2C2VS 2IQJA 2EGPA 1WEOA 2AN6A 5D1MB
chains in the Genus database with same CATH topology
4OGEA 3LVRE 2XOCA 2XOZA 2B0OE 4O62A 3M7KA 4OGCA 5SVIB 3T9KA 2CSVA 4Z0OA 2XOYA 2P57A 3LVQE 2DJAA 2E61A 3DDTA 3JUEA 3LDYA 2FD4A 2RR4A 3LJUX 2KKXA 2XP0A 2CONA 2YVRA 3O47A 2EGMA 2LAUA 3H7HA 5K3QA 3Q1DA 5SVXA 5SVIA 2CRRA 2OWAA 2KKYA 2YREA 3FM8C 2D8UA 4F1PA 2L7PA 4H9DA 3PLWA 3FJUB 2CRWA 1DCQA 2MKEA 5SVYA 3DWDA 3MDBC 4Z0RA 2IQJA 2JM3A 2FFWA 3E2DA 4QQ4A 3KDEC 3FEHA 2JUNA 2EXUA 3SUBA 2M13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LAU A;  2JM3 A;  3KDE C; 
#chains in the Genus database with same CATH topology
 5C13 A;  4LJN A;  3SOU A;  3IHP A;  1K2F A;  2P57 A;  1VD4 A;  3LQJ A;  2K4D A;  2OXQ C;  2CSZ A;  3KV5 A;  2JRJ A;  2PNX A;  3H7H A;  4I7C A;  2FUU A;  2YQL A;  3FM8 C;  2VPG A;  4QF2 A;  3FJU B;  3PUQ A;  3N9O A;  4QQ4 A;  3HCT A;  4AYC B;  5KH7 A;  4YBM A;  2VJF B;  2XOC A;  4B7Y C;  4ZUX U;  4AUQ B;  3SOX A;  2YU4 A;  3GV4 A;  3JUE A;  5LKU A;  3M62 A;  2KWJ A;  2XP0 A;  1RMD A;  2LAU A;  2Y1N A;  2KYU A;  2YW8 A;  2FFW A;  2CKL A;  2K1J A;  4OGE A;  4I7B A;  4A0C D;  3N9N A;  4WZ0 A;  5KH3 A;  3KV6 A;  3FAO A;  2VPD A;  3LDY A;  4AYC A;  2YHO A;  2RR4 A;  5SVX A;  5LKT A;  3LRQ A;  5DKA A;  2H0D B;  3U5O A;  3LQI A;  3E2D A;  1IYM A;  1Z2Q A;  2EXU A;  2M13 A;  2KWK A;  5H1T A;  2YT5 A;  2QIZ A;  2EA6 A;  5SVI B;  4LK9 A;  3T9K A;  3L1Z B;  3FAN A;  5FB1 A;  4R7E A;  5D1K B;  2LGK A;  1WFK A;  1N87 A;  3I2D A;  2ZET C;  2YQM A;  2MIQ A;  3KNV A;  2K17 A;  1WEM A;  4V3K C;  2K16 A;  4PPE A;  2BAY A;  4MVT A;  4N3W A;  4R8P K;  5D1L B;  3O33 A;  4LLB A;  4FK5 A;  5G0F A;  3L1X A;  2H0D A;  5B77 A;  3SOW A;  2MNY A;  1JM7 B;  5SVI A;  3MHH A;  4UI9 B;  3HCS A;  1WIM A;  2M6M A;  2ECW A;  4O64 A;  3O70 A;  5G05 B;  4OGC A;  2FUI A;  2E6R A;  2MUM A;  3KQI A;  4O62 A;  2G43 A;  5KH9 A;  4AVX A;  4Q6F A;  4GNF A;  2ECV A;  3DDT A;  4YAD A;  3HTK C;  3SHB A;  4NN2 A;  4PTB A;  2KU3 A;  1VFY A;  2D8U A;  4UP0 A;  2YUC A;  4AP4 A;  4GNG A;  3GL6 A;  2JM3 A;  1JM7 A;  2MD7 B;  2ECN A;  2YSM A;  3EB6 A;  2JUN A;  5FER A;  2F6J A;  3QZV A;  2KFT A;  4XI1 A;  3DQV R;  2EOD A;  3RTR B;  4WA6 A;  2L0B A;  3ZPV E;  2DX8 A;  2YSJ A;  2FD4 A;  1FP0 A;  3C6W A;  2CRR A;  3U5P A;  1WE9 A;  4F1P A;  1WGM A;  3O37 A;  2F6N A;  2KR4 A;  5DIN A;  4GNE A;  2ECT A;  2CSY A;  2KRE A;  3LVR E;  2B0O E;  3O36 A;  2CSV A;  1WEE A;  2MA5 A;  1U6G B;  2VPE A;  4BBQ A;  1E4U A;  2ECI A;  2MD8 C;  4BHW A;  5I3L A;  1HYI A;  2KE1 A;  2VJF A;  5K3Q A;  1MBM A;  1X4U A;  4YAT A;  2LDR A;  3O34 A;  5LKZ A;  3PLW A;  5EYA F;  2L75 A;  4GB0 A;  4IC3 A;  5FB0 A;  4YC9 A;  2LGG A;  2VP7 A;  1LDJ B;  3N9M A;  2LXH C;  2Y1M A;  1WEU A;  2C2L A;  5AIU A;  1T1H A;  4GND A;  2JMJ A;  4YBS A;  3Q1D A;  4S3O B;  1WEP A;  2YUR A;  2JMI A;  1VYX A;  3ZVZ B;  2VJE B;  4YAX A;  2D8S A;  2FSA A;  4C9Z A;  2M3H A;  4Z0O A;  5H1V A;  3LVQ E;  3N9P A;  4LAD B;  2QIC A;  1CHC A;  4FO9 A;  4A49 A;  2YHN A;  3RPG C;  2IDA A;  2KKY A;  1XWH A;  5H1U A;  2YRE A;  2KGI A;  2L7P A;  4B86 C;  3ZYQ A;  2I50 A;  2ECG A;  2M1R A;  3MDB C;  3FEH A;  2L43 A;  3ZNI A;  2Y43 A;  2G6Q A;  2PUY A;  1ZBD B;  4ZDT A;  1WIL A;  4L58 A;  2VJE A;  4V3L C;  3V43 A;  4P5O B;  3M99 A;  2KIZ A;  3NG2 A;  2YVR A;  1X4J A;  4YBT A;  4A4B A;  3U5N A;  5AIT A;  4H9D A;  5SVY A;  4S3O C;  1DCQ A;  5C11 A;  2G45 A;  2KWO A;  3KDE C;  1V87 A;  3LQH A;  3PHD A;  3SUB A;  2XOZ A;  5LKX A;  2LV9 A;  1X4I A;  1FBV A;  2MA6 A;  3T7L A;  2DJA A;  5H9M A;  4UP5 A;  4A4C A;  2LN0 A;  2CKL B;  3LJU X;  2KKX A;  3ZTG A;  5FEY A;  4I7D A;  2MT5 A;  5TRB A;  1JOC A;  2VNF A;  3U5M A;  2HDP A;  2CT2 A;  3M7K A;  2LGV A;  5B75 A;  3O7A A;  1MM2 A;  2XOY A;  4F52 B;  5B79 A;  2E61 A;  2KWN A;  3RPG B;  3MHS A;  1Z60 A;  3O47 A;  3M63 A;  5B8D A;  4FJC A;  2F42 A;  3ZPV 1;  4IC2 A;  1HYJ A;  5TBN A;  2L5U A;  4X3G A;  4Z0R A;  5TDR A;  2LGL A;  2VPB A;  1WEW A;  4ZQL A;  4CCG X;  4CA1 A;  2NAA A;  1WEQ A;  2M85 A;  2UZG A;  1WES A;  3T6R A;  4TKP B;  4YAB A;  2MNZ A;  3N9Q A;  2ECJ A;  2QJ0 A;  2LXP C;  1MM3 A;  2HYE D;  5JG6 A;  2MKE A;  3DWD A;  4FIP A;  1Z6U A;  3FL2 A;  4MSX A;  2RSD A;  3C5K A;  4R2Y A;  3N9L A;  1F62 A;  2YYR A;  5LCW B;  3O35 A;  3DPL R;  3HCU A;  4L7X A;  1DVP A;  5G04 B;  1LDK C;  1BOR A;  2LQ6 A;  3ZVY A;  1WEV A;  2LRI C;  2CON A;  5B78 A;  3VK6 A;  2XB1 A;  2EGM A;  4N4F A;  2OWA A;  4WZ3 B;  2E6S A;  2XEU A;  1G25 A;  3ASL A;  3L11 A;  3PUR A;  2L80 A;  2JMD A;  2DSM A;  3EB5 A;  2KGG A;  5B76 A;  5J3X A;  2RI7 A;  5TAB A;  4LKA A;  4WZ2 A;  5TDW A;  4W4U A;  4QF3 A;  1WEN A;  2CRW A;  2C2V S;  2IQJ A;  2EGP A;  1WEO A;  2AN6 A;  5D1M B; 
#chains in the Genus database with same CATH homology
 4OGE A;  3LVR E;  2XOC A;  2XOZ A;  2B0O E;  4O62 A;  3M7K A;  4OGC A;  5SVI B;  3T9K A;  2CSV A;  4Z0O A;  2XOY A;  2P57 A;  3LVQ E;  2DJA A;  2E61 A;  3DDT A;  3JUE A;  3LDY A;  2FD4 A;  2RR4 A;  3LJU X;  2KKX A;  2XP0 A;  2CON A;  2YVR A;  3O47 A;  2EGM A;  2LAU A;  3H7H A;  5K3Q A;  3Q1D A;  5SVX A;  5SVI A;  2CRR A;  2OWA A;  2KKY A;  2YRE A;  3FM8 C;  2D8U A;  4F1P A;  2L7P A;  4H9D A;  3PLW A;  3FJU B;  2CRW A;  1DCQ A;  2MKE A;  5SVY A;  3DWD A;  3MDB C;  4Z0R A;  2IQJ A;  2JM3 A;  2FFW A;  3E2D A;  4QQ4 A;  3KDE C;  3FEH A;  2JUN A;  2EXU A;  3SUB A;  2M13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...