2LAUA

Solution structure of the thap-zinc finger domain 1-81 from the cell growth suppressor human thap11 protein
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
81
structure length
81
Chain Sequence
GSPGFTCCVPGCYNNSHRDKALHFYTFPKDAELRRLWLKNVSRAGVSGCFSTFQPTTGHRLCSVHFQGGRKTYTVRVPTIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords THAP domain-containing protein 11
publication title Solution structure of the THAP domain from the cell growth suppressor human THAP11
rcsb
source organism Homo sapiens
total genus 6
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2011-03-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.180 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2lauA00
3KDEC 2JM3A 2LAUA
chains in the Genus database with same CATH superfamily
1HYIA 2CSZA 2YSMA 1WESA 5JG6A 3SHBA 1VYXA 2KIZA 3FAOA 5B79A 1JOCA 3LDYA 2MIQA 4LJNA 4LKAA 2FFWA 5KH7A 1X4JA 1MM2A 4GB0A 3VK6A 2YHNA 2PNXA 3ZPV1 1Z60A 3GL6A 2YQMA 2QJ0A 2EA6A 4AUQB 2JMJA 2M3HA 3L1XA 3LVQE 2DJAA 2LQ6A 2VJFA 3Q1DA 2CT2A 4ZQLA 2FUUA 4FK5A 5LKUA 4FIPA 3DPLR 3PUQA 3HCUA 5TDWA 3U5MA 2KWKA 2RSDA 3PHDA 3MDBC 2MNYA 1X4UA 1WEUA 2CKLA 3O7AA 3T6RA 5B76A 3T9KA 2LGLA 5G05B 2D8UA 4R7EA 2MUMA 4GNGA 4V3LC 3O36A 1JM7B 3FM8C 2XOYA 2EGMA 5H1VA 5TBNA 2YURA 3HCSA 2MNZA 4YABA 5FERA 4B86C 2YYRA 1DVPA 5D1MB 4QQ4A 2NAAA 4QF2A 2AN6A 2ECJA 2KE1A 2KYUA 3O35A 3EB6A 3GV4A 2VPEA 2Y43A 4GNDA 3L11A 3HTKC 3SOWA 3LJUX 3RPGC 3JUEA 3O33A 3ZPVE 2XB1A 2LRIC 5SVIA 1V87A 4GNEA 2LN0A 2KFTA 4O62A 1U6GB 4A0CD 2K4DA 2KGGA 1LDKC 4ZDTA 3ZNIA 1WEQA 3LQJA 3PURA 2FSAA 5SVYA 2YSJA 3QZVA 2G43A 5H1UA 1X4IA 2LXHC 2MA5A 4WZ2A 3I2DA 2XP0A 1WEWA 5LKZA 4S3OC 1VFYA 4YC9A 1MBMA 3V43A 2RR4A 2ECVA 2L43A 2K1JA 2M13A 2LAUA 2E61A 3MHSA 2FD4A 4AYCA 3ZVYA 3N9NA 2CSYA 2VJFB 1WFKA 2RI7A 3H7HA 4C9ZA 5C13A 4R2YA 1LDJB 3EB5A 3DQVR 4LK9A 2F42A 2YHOA 3KNVA 3U5PA 5B77A 2JUNA 1WEOA 5KH9A 4PPEA 2L7PA 2OWAA 2CSVA 1ZBDB 2YQLA 2CKLB 4AP4A 2JMDA 5D1KB 3RTRB 2KWOA 5KH3A 4OGEA 2KREA 4N4FA 2XOZA 3E2DA 2LXPC 4LADB 1FBVA 3N9OA 2CONA 4L58A 5LCWB 3SOUA 3KQIA 2E6RA 2L80A 4OGCA 2UZGA 4WA6A 2E6SA 2VNFA 2JMIA 3SOXA 4YBTA 2M85A 5TRBA 2XOCA 3O70A 3O47A 3RPGB 4F1PA 5LKTA 1WEPA 2VJEA 4CCGX 2I50A 2H0DA 3N9QA 3N9PA 3PLWA 5DKAA 2MD8C 2F6NA 2PUYA 2Y1MA 2YUCA 5AITA 4IC2A 4WZ3B 2P57A 2IQJA 2F6JA 5G0FA 5D1LB 4YAXA 2K16A 3FEHA 2FUIA 2MKEA 5SVIB 3C5KA 4S3OB 3FJUB 3LVRE 3FL2A 4I7DA 2C2VS 4LLBA 4X3GA 1MM3A 3MHHA 5FB0A 2KWJA 2MA6A 2YVRA 2BAYA 4N3WA 5B78A 5LKXA 3NG2A 3C6WA 2YT5A 2ECGA 2CRRA 3ZYQA 4BHWA 4B7YC 1WGMA 4I7CA 4MSXA 5FEYA 4TKPB 4YBMA 1BORA 4Q6FA 4AYCB 2VPDA 2M1RA 3LRQA 2K17A 1CHCA 5H9MA 5I3LA 2ECWA 4I7BA 4PTBA 5SVXA 4A4CA 3U5NA 2VP7A 4CA1A 4FJCA 3M7KA 1G25A 2KGIA 4F52B 3HCTA 2XEUA 1N87A 1WE9A 2VPGA 2KKXA 1XWHA 1RMDA 4XI1A 1HYJA 2KKYA 2ECIA 2C2LA 2EODA 3ZVZB 4A49A 4YBSA 2HDPA 4V3KC 2G45A 4GNFA 5EYAF 5B75A 1Z2QA 4A4BA 4Z0OA 3M62A 4ZUXU 1FP0A 2JM3A 2ECNA 3N9MA 5AIUA 4L7XA 2VPBA 2MT5A 3LQHA 2ZETC 5B8DA 2LV9A 2LDRA 4UP0A 4YATA 4AVXA 2JRJA 3M99A 4W4UA 1DCQA 2YU4A 4WZ0A 4O64A 2OXQC 3IHPA 1WEMA 2KWNA 5G04B 1VD4A 2VJEB 2ECTA 2H0DB 5K3QA 1WIMA 2Y1NA 2KU3A 1E4UA 2L75A 2IDAA 5H1TA 1WILA 4QF3A 3T7LA 3ASLA 3KV5A 5TDRA 4R8PK 1K2FA 3SUBA 3N9LA 2LGGA 1JM7A 2B0OE 2M6MA 2DX8A 3O34A 3ZTGA 5J3XA 4P5OB 2EXUA 3KDEC 2KR4A 4FO9A 1T1HA 1Z6UA 2L5UA 3KV6A 5TABA 4UP5A 4H9DA 5C11A 2YW8A 3L1ZB 3M63A 2HYED 3U5OA 4YADA 2YREA 1WENA 2EGPA 1WEEA 2QIZA 2LGVA 3LQIA 1IYMA 2G6QA 3DWDA 3O37A 3DDTA 4MVTA 4Z0RA 2DSMA 4BBQA 2CRWA 2MD7B 2LGKA 3FANA 2L0BA 5FB1A 5DINA 2D8SA 4NN2A 4IC3A 1WEVA 2QICA 1F62A 4UI9B
chains in the Genus database with same CATH topology
2CONA 2D8UA 2CRRA 4H9DA 3PLWA 5SVIA 3DWDA 2KKYA 3DDTA 2XP0A 3FJUB 3LVRE 4Z0RA 4OGCA 2CRWA 4O62A 2JUNA 3LDYA 2RR4A 2P57A 2L7PA 2M13A 2FFWA 2LAUA 2IQJA 3SUBA 3FM8C 2E61A 1DCQA 2OWAA 2CSVA 2FD4A 2XOYA 2EGMA 2YVRA 5SVXA 2B0OE 3MDBC 2YREA 2XOCA 2EXUA 3KDEC 3O47A 4Z0OA 3M7KA 3H7HA 4F1PA 4OGEA 3LVQE 3FEHA 5SVYA 2DJAA 2KKXA 2XOZA 3E2DA 3LJUX 3Q1DA 4QQ4A 2JM3A 5K3QA 3T9KA 5SVIB 2MKEA 3JUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KDE C;  2JM3 A;  2LAU A; 
#chains in the Genus database with same CATH topology
 1HYI A;  2CSZ A;  2YSM A;  1WES A;  5JG6 A;  3SHB A;  1VYX A;  2KIZ A;  3FAO A;  5B79 A;  1JOC A;  3LDY A;  2MIQ A;  4LJN A;  4LKA A;  2FFW A;  5KH7 A;  1X4J A;  1MM2 A;  4GB0 A;  3VK6 A;  2YHN A;  2PNX A;  3ZPV 1;  1Z60 A;  3GL6 A;  2YQM A;  2QJ0 A;  2EA6 A;  4AUQ B;  2JMJ A;  2M3H A;  3L1X A;  3LVQ E;  2DJA A;  2LQ6 A;  2VJF A;  3Q1D A;  2CT2 A;  4ZQL A;  2FUU A;  4FK5 A;  5LKU A;  4FIP A;  3DPL R;  3PUQ A;  3HCU A;  5TDW A;  3U5M A;  2KWK A;  2RSD A;  3PHD A;  3MDB C;  2MNY A;  1X4U A;  1WEU A;  2CKL A;  3O7A A;  3T6R A;  5B76 A;  3T9K A;  2LGL A;  5G05 B;  2D8U A;  4R7E A;  2MUM A;  4GNG A;  4V3L C;  3O36 A;  1JM7 B;  3FM8 C;  2XOY A;  2EGM A;  5H1V A;  5TBN A;  2YUR A;  3HCS A;  2MNZ A;  4YAB A;  5FER A;  4B86 C;  2YYR A;  1DVP A;  5D1M B;  4QQ4 A;  2NAA A;  4QF2 A;  2AN6 A;  2ECJ A;  2KE1 A;  2KYU A;  3O35 A;  3EB6 A;  3GV4 A;  2VPE A;  2Y43 A;  4GND A;  3L11 A;  3HTK C;  3SOW A;  3LJU X;  3RPG C;  3JUE A;  3O33 A;  3ZPV E;  2XB1 A;  2LRI C;  5SVI A;  1V87 A;  4GNE A;  2LN0 A;  2KFT A;  4O62 A;  1U6G B;  4A0C D;  2K4D A;  2KGG A;  1LDK C;  4ZDT A;  3ZNI A;  1WEQ A;  3LQJ A;  3PUR A;  2FSA A;  5SVY A;  2YSJ A;  3QZV A;  2G43 A;  5H1U A;  1X4I A;  2LXH C;  2MA5 A;  4WZ2 A;  3I2D A;  2XP0 A;  1WEW A;  5LKZ A;  4S3O C;  1VFY A;  4YC9 A;  1MBM A;  3V43 A;  2RR4 A;  2ECV A;  2L43 A;  2K1J A;  2M13 A;  2LAU A;  2E61 A;  3MHS A;  2FD4 A;  4AYC A;  3ZVY A;  3N9N A;  2CSY A;  2VJF B;  1WFK A;  2RI7 A;  3H7H A;  4C9Z A;  5C13 A;  4R2Y A;  1LDJ B;  3EB5 A;  3DQV R;  4LK9 A;  2F42 A;  2YHO A;  3KNV A;  3U5P A;  5B77 A;  2JUN A;  1WEO A;  5KH9 A;  4PPE A;  2L7P A;  2OWA A;  2CSV A;  1ZBD B;  2YQL A;  2CKL B;  4AP4 A;  2JMD A;  5D1K B;  3RTR B;  2KWO A;  5KH3 A;  4OGE A;  2KRE A;  4N4F A;  2XOZ A;  3E2D A;  2LXP C;  4LAD B;  1FBV A;  3N9O A;  2CON A;  4L58 A;  5LCW B;  3SOU A;  3KQI A;  2E6R A;  2L80 A;  4OGC A;  2UZG A;  4WA6 A;  2E6S A;  2VNF A;  2JMI A;  3SOX A;  4YBT A;  2M85 A;  5TRB A;  2XOC A;  3O70 A;  3O47 A;  3RPG B;  4F1P A;  5LKT A;  1WEP A;  2VJE A;  4CCG X;  2I50 A;  2H0D A;  3N9Q A;  3N9P A;  3PLW A;  5DKA A;  2MD8 C;  2F6N A;  2PUY A;  2Y1M A;  2YUC A;  5AIT A;  4IC2 A;  4WZ3 B;  2P57 A;  2IQJ A;  2F6J A;  5G0F A;  5D1L B;  4YAX A;  2K16 A;  3FEH A;  2FUI A;  2MKE A;  5SVI B;  3C5K A;  4S3O B;  3FJU B;  3LVR E;  3FL2 A;  4I7D A;  2C2V S;  4LLB A;  4X3G A;  1MM3 A;  3MHH A;  5FB0 A;  2KWJ A;  2MA6 A;  2YVR A;  2BAY A;  4N3W A;  5B78 A;  5LKX A;  3NG2 A;  3C6W A;  2YT5 A;  2ECG A;  2CRR A;  3ZYQ A;  4BHW A;  4B7Y C;  1WGM A;  4I7C A;  4MSX A;  5FEY A;  4TKP B;  4YBM A;  1BOR A;  4Q6F A;  4AYC B;  2VPD A;  2M1R A;  3LRQ A;  2K17 A;  1CHC A;  5H9M A;  5I3L A;  2ECW A;  4I7B A;  4PTB A;  5SVX A;  4A4C A;  3U5N A;  2VP7 A;  4CA1 A;  4FJC A;  3M7K A;  1G25 A;  2KGI A;  4F52 B;  3HCT A;  2XEU A;  1N87 A;  1WE9 A;  2VPG A;  2KKX A;  1XWH A;  1RMD A;  4XI1 A;  1HYJ A;  2KKY A;  2ECI A;  2C2L A;  2EOD A;  3ZVZ B;  4A49 A;  4YBS A;  2HDP A;  4V3K C;  2G45 A;  4GNF A;  5EYA F;  5B75 A;  1Z2Q A;  4A4B A;  4Z0O A;  3M62 A;  4ZUX U;  1FP0 A;  2JM3 A;  2ECN A;  3N9M A;  5AIU A;  4L7X A;  2VPB A;  2MT5 A;  3LQH A;  2ZET C;  5B8D A;  2LV9 A;  2LDR A;  4UP0 A;  4YAT A;  4AVX A;  2JRJ A;  3M99 A;  4W4U A;  1DCQ A;  2YU4 A;  4WZ0 A;  4O64 A;  2OXQ C;  3IHP A;  1WEM A;  2KWN A;  5G04 B;  1VD4 A;  2VJE B;  2ECT A;  2H0D B;  5K3Q A;  1WIM A;  2Y1N A;  2KU3 A;  1E4U A;  2L75 A;  2IDA A;  5H1T A;  1WIL A;  4QF3 A;  3T7L A;  3ASL A;  3KV5 A;  5TDR A;  4R8P K;  1K2F A;  3SUB A;  3N9L A;  2LGG A;  1JM7 A;  2B0O E;  2M6M A;  2DX8 A;  3O34 A;  3ZTG A;  5J3X A;  4P5O B;  2EXU A;  3KDE C;  2KR4 A;  4FO9 A;  1T1H A;  1Z6U A;  2L5U A;  3KV6 A;  5TAB A;  4UP5 A;  4H9D A;  5C11 A;  2YW8 A;  3L1Z B;  3M63 A;  2HYE D;  3U5O A;  4YAD A;  2YRE A;  1WEN A;  2EGP A;  1WEE A;  2QIZ A;  2LGV A;  3LQI A;  1IYM A;  2G6Q A;  3DWD A;  3O37 A;  3DDT A;  4MVT A;  4Z0R A;  2DSM A;  4BBQ A;  2CRW A;  2MD7 B;  2LGK A;  3FAN A;  2L0B A;  5FB1 A;  5DIN A;  2D8S A;  4NN2 A;  4IC3 A;  1WEV A;  2QIC A;  1F62 A;  4UI9 B; 
#chains in the Genus database with same CATH homology
 2CON A;  2D8U A;  2CRR A;  4H9D A;  3PLW A;  5SVI A;  3DWD A;  2KKY A;  3DDT A;  2XP0 A;  3FJU B;  3LVR E;  4Z0R A;  4OGC A;  2CRW A;  4O62 A;  2JUN A;  3LDY A;  2RR4 A;  2P57 A;  2L7P A;  2M13 A;  2FFW A;  2LAU A;  2IQJ A;  3SUB A;  3FM8 C;  2E61 A;  1DCQ A;  2OWA A;  2CSV A;  2FD4 A;  2XOY A;  2EGM A;  2YVR A;  5SVX A;  2B0O E;  3MDB C;  2YRE A;  2XOC A;  2EXU A;  3KDE C;  3O47 A;  4Z0O A;  3M7K A;  3H7H A;  4F1P A;  4OGE A;  3LVQ E;  3FEH A;  5SVY A;  2DJA A;  2KKX A;  2XOZ A;  3E2D A;  3LJU X;  3Q1D A;  4QQ4 A;  2JM3 A;  5K3Q A;  3T9K A;  5SVI B;  2MKE A;  3JUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...