1WEPA

Solution structure of phd domain in phf8
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
79
structure length
79
Chain Sequence
GSSGSSGMALVPVYCLCRQPYNVNHFMIECGLCQDWFHGSCVGIEEENAVDIDIYHCPDCEAVFGPSIMKNWHSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHF8
publication title Solution structure of PHD domain in protein AA017385
rcsb
source organism Mus musculus
molecule tags Dna binding protein
total genus 9
structure length 79
sequence length 79
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2004-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1wepA00
1FP0A 1WESA 1F62A 2KYUA 2MT5A 5JG6A 2VJEA 2E6RA 5AITA 2YU4A 2LN0A 3SOUA 5H1VA 5KH9A 1WEQA 2IDAA 2M85A 1T1HA 4ZUXU 2M1RA 3KV5A 4O64A 2ECIA 2MNZA 5G04B 4TKPB 4GNDA 4NN2A 2KGGA 4ZQLA 2L80A 3GL6A 5J3XA 2QIZA 4GNGA 3O37A 3N9OA 4W4UA 3T6RA 3N9QA 5FEYA 2YSMA 5G0FA 5AIUA 3GV4A 2KREA 5EYAF 2EODA 1MM2A 2VPBA 3HTKC 5D1KB 4A49A 3C5KA 2L0BA 3IHPA 4MVTA 3N9MA 2NAAA 2LXPC 4FIPA 2JRJA 4YABA 4BBQA 3LQJA 4MSXA 2K1JA 2EA6A 3N9PA 2LDRA 4X3GA 3MHHA 4I7BA 4WZ2A 4YBTA 4YATA 5B75A 1WILA 2VP7A 2MUMA 4C9ZA 2LXHC 1WFKA 3LRQA 5TDWA 4FK5A 1X4JA 2HYED 2ECWA 2KWKA 3LQIA 5B8DA 4WZ3B 4YBSA 2YUCA 2EGPA 3FL2A 4Q6FA 4I7CA 1WENA 2K16A 1WEEA 2YURA 2YW8A 5B79A 2VJEB 1WGMA 3HCTA 2M3HA 5B78A 2FUUA 2QJ0A 4LJNA 1VYXA 4GNEA 2I50A 4LLBA 2MNYA 2YYRA 1K2FA 1VFYA 2PNXA 5H9MA 2KWNA 4AP4A 1Z6UA 3L1XA 2LRIC 5LKXA 3RPGB 4A4BA 3QZVA 1X4IA 2YQLA 3M99A 2MD7B 2KE1A 2ECGA 5D1LB 4A0CD 4ZDTA 4QF2A 4L58A 4L7XA 5I3LA 4V3KC 5B76A 3EB5A 4R7EA 2C2VS 3U5OA 4S3OB 1JM7B 2E6SA 2L43A 1WIMA 2KWOA 1V87A 2L5UA 3V43A 4FO9A 1IYMA 3EB6A 2VPEA 1WEUA 3O36A 2AN6A 2FUIA 1MM3A 3VK6A 1JM7A 2MIQA 3ZNIA 1VD4A 3LQHA 3KV6A 2VJFA 3ZTGA 3M62A 3DQVR 5C11A 2F42A 2M6MA 3DPLR 4B7YC 2MD8C 2ECVA 3RPGC 1DVPA 2G43A 1G25A 2JMJA 3N9LA 4WA6A 1FBVA 3ZPV1 2F6JA 2KU3A 3HCSA 4UP0A 1LDJB 2VPGA 2C2LA 3C6WA 4GNFA 2KFTA 5LKZA 3U5PA 4YADA 2JMIA 4AVXA 3KQIA 3SOXA 5DINA 2LGLA 2MA5A 2YHNA 1LDKC 3ASLA 5TRBA 4S3OC 4YAXA 3PHDA 1WEPA 2CT2A 3ZVZB 4AYCA 3HCUA 3NG2A 2UZGA 2G6QA 4WZ0A 4BHWA 2Y1MA 2ECJA 4R2YA 3KNVA 3PUQA 4PTBA 4LK9A 2F6NA 4R8PK 4YC9A 3M63A 2FSAA 1U6GB 1Z2QA 4IC2A 2RI7A 3MHSA 5TBNA 2H0DA 4CCGX 2JMDA 2KGIA 1X4UA 2RSDA 1E4UA 5G05B 1RMDA 3ZVYA 3L11A 2MA6A 3PURA 3O35A 5LKUA 2OXQC 5FB1A 5H1UA 4CA1A 4V3LC 5KH3A 4AUQB 2LGKA 1HYJA 2L75A 3ZPVE 2KIZA 2G45A 2VJFB 2YHOA 4UI9B 5D1MB 2YREA 1JOCA 1Z60A 5H1TA 1WEOA 2DX8A 2D8SA 2VNFA 3T7LA 5LKTA 4YBMA 2ECNA 1ZBDB 4P5OB 3U5NA 2LGVA 2KWJA 1HYIA 3SHBA 2Y43A 2LV9A 4UP5A 5FB0A 2CKLB 5LCWB 1XWHA 4N3WA 3SOWA 3U5MA 1CHCA 2XEUA 2Y1NA 3O7AA 2PUYA 1WEWA 2XB1A 4F52B 3O70A 4B86C 5C13A 1WEVA 2QICA 4AYCB 2LGGA 2CKLA 4GB0A 2HDPA 3O33A 1BORA 3RTRB 2K17A 4I7DA 2ECTA 4FJCA 5TDRA 5FERA 4IC3A 2CSYA 2BAYA 1N87A 4A4CA 4PPEA 5B77A 1WE9A 2VPDA 2H0DB 2YT5A 5DKAA 3ZYQA 4LKAA 2KR4A 4XI1A 2K4DA 1WEMA 4N4FA 3I2DA 4QF3A 5KH7A 2YQMA 2YSJA 4LADB 3O34A 2CSZA 2ZETC 3L1ZB 3N9NA 2LQ6A 5TABA
chains in the Genus database with same CATH superfamily
1FP0A 3LVRE 1WESA 1F62A 2KYUA 2MT5A 5JG6A 2VJEA 2E6RA 5SVYA 5AITA 2YU4A 2D8UA 2LN0A 3SOUA 5H1VA 5KH9A 1WEQA 2IDAA 2M85A 1T1HA 4ZUXU 2IQJA 2M1RA 3KV5A 4O64A 2ECIA 2MNZA 5G04B 4TKPB 4GNDA 4NN2A 2KGGA 4H9DA 2L80A 4ZQLA 3GL6A 5J3XA 2QIZA 4GNGA 3O37A 2E61A 2XOCA 1MBMA 2FFWA 3N9OA 2RR4A 4W4UA 3T6RA 3N9QA 5FEYA 2YSMA 5G0FA 5AIUA 3GV4A 2KREA 5EYAF 2EODA 1MM2A 2VPBA 3HTKC 5D1KB 4A49A 3C5KA 2L0BA 3IHPA 4MVTA 3N9MA 2XOZA 2NAAA 2LXPC 4FIPA 2JRJA 4YABA 3FAOA 4BBQA 3LQJA 4MSXA 2K1JA 2EA6A 3N9PA 2LDRA 2DJAA 4X3GA 3MHHA 4I7BA 4WZ2A 4YBTA 4YATA 5B75A 1WILA 2VP7A 2MUMA 4C9ZA 2LXHC 1WFKA 3LRQA 5TDWA 4FK5A 1X4JA 2HYED 2ECWA 2KWKA 3LQIA 5B8DA 4WZ3B 4YBSA 2YUCA 2EGPA 2L7PA 3FL2A 3PLWA 4Q6FA 4I7CA 1WENA 2K16A 1WEEA 2YURA 2YW8A 5B79A 2VJEB 1WGMA 3HCTA 2M3HA 4Z0OA 5B78A 2FUUA 2QJ0A 4LJNA 1VYXA 4GNEA 2I50A 3FANA 4LLBA 3T9KA 2MNYA 2YYRA 1K2FA 1VFYA 2PNXA 5H9MA 2KWNA 4AP4A 1Z6UA 3JUEA 3L1XA 2LRIC 2CSVA 5LKXA 3RPGB 4A4BA 3LDYA 3QZVA 2LAUA 2XP0A 1X4IA 3FEHA 2XOYA 2YQLA 3M99A 2MD7B 2KE1A 2ECGA 2MKEA 5D1LB 2YVRA 4A0CD 4ZDTA 4QF2A 4L58A 4L7XA 5I3LA 4V3KC 5B76A 3EB5A 4R7EA 2C2VS 3U5OA 4S3OB 1JM7B 2E6SA 2L43A 3DDTA 1WIMA 2KWOA 1V87A 2L5UA 3Q1DA 3E2DA 3V43A 4FO9A 1IYMA 3EB6A 4QQ4A 2VPEA 1WEUA 2FD4A 3O36A 2AN6A 2FUIA 1MM3A 3VK6A 1JM7A 2KKXA 2MIQA 3ZNIA 1VD4A 3LQHA 3KV6A 2VJFA 3ZTGA 3M62A 4O62A 3DQVR 5C11A 2F42A 2M6MA 3DPLR 4B7YC 2MD8C 2ECVA 3RPGC 2M13A 1DVPA 2G43A 1DCQA 2JMJA 1G25A 3N9LA 4WA6A 1FBVA 3ZPV1 4OGEA 2F6JA 2KU3A 3HCSA 4UP0A 1LDJB 2VPGA 2CRWA 5SVIA 5SVXA 2C2LA 3C6WA 4GNFA 2KFTA 5LKZA 3U5PA 4YADA 2JMIA 4AVXA 3KQIA 3SOXA 5DINA 2LGLA 2MA5A 3H7HA 2YHNA 1LDKC 4F1PA 3ASLA 5TRBA 4S3OC 4YAXA 3PHDA 2DSMA 3KDEC 1WEPA 2KKYA 2CT2A 3ZVZB 4AYCA 3HCUA 3NG2A 2UZGA 2G6QA 4WZ0A 3SUBA 4BHWA 2Y1MA 2ECJA 4R2YA 3KNVA 3PUQA 4PTBA 2CONA 4LK9A 2F6NA 4R8PK 3O47A 4YC9A 3M63A 2FSAA 1U6GB 2CRRA 1Z2QA 4IC2A 2RI7A 3MHSA 5TBNA 2H0DA 4CCGX 2JMDA 2KGIA 1X4UA 2RSDA 1E4UA 5G05B 1RMDA 3ZVYA 3L11A 2MA6A 3PURA 3O35A 5LKUA 2OXQC 5FB1A 5H1UA 4Z0RA 4CA1A 4V3LC 5KH3A 4AUQB 2LGKA 1HYJA 2L75A 3ZPVE 2KIZA 2JUNA 2G45A 2VJFB 3M7KA 2YHOA 4OGCA 4UI9B 5D1MB 2YREA 1JOCA 1Z60A 5H1TA 1WEOA 2DX8A 2D8SA 2VNFA 3T7LA 5LKTA 4YBMA 2B0OE 2EGMA 2EXUA 2ECNA 1ZBDB 4P5OB 3U5NA 2LGVA 2KWJA 1HYIA 5SVIB 3SHBA 2Y43A 2LV9A 3DWDA 4UP5A 5FB0A 2CKLB 5LCWB 1XWHA 4N3WA 3SOWA 2JM3A 3U5MA 1CHCA 2XEUA 3FJUB 2OWAA 2Y1NA 3O7AA 2PUYA 1WEWA 2XB1A 2P57A 3MDBC 4F52B 3O70A 3FM8C 4B86C 5C13A 1WEVA 2QICA 4AYCB 2LGGA 2CKLA 4GB0A 2HDPA 3O33A 1BORA 3RTRB 2K17A 4I7DA 2ECTA 4FJCA 5TDRA 3LJUX 5FERA 4IC3A 2CSYA 3LVQE 2BAYA 1N87A 4A4CA 4PPEA 5B77A 1WE9A 2VPDA 2H0DB 2YT5A 5DKAA 3ZYQA 4LKAA 2KR4A 4XI1A 2K4DA 1WEMA 4N4FA 3I2DA 4QF3A 5KH7A 2YQMA 2YSJA 4LADB 3O34A 2CSZA 2ZETC 5K3QA 3L1ZB 3N9NA 2LQ6A 5TABA
chains in the Genus database with same CATH topology
1FP0A 1WESA 1F62A 2KYUA 2MT5A 5JG6A 2VJEA 2E6RA 5AITA 2YU4A 2LN0A 3SOUA 5H1VA 5KH9A 1WEQA 2IDAA 2M85A 1T1HA 4ZUXU 2M1RA 3KV5A 4O64A 2ECIA 2MNZA 5G04B 4TKPB 4GNDA 4NN2A 2KGGA 4ZQLA 2L80A 3GL6A 5J3XA 2QIZA 4GNGA 3O37A 3N9OA 4W4UA 3T6RA 3N9QA 5FEYA 2YSMA 5G0FA 5AIUA 3GV4A 2KREA 5EYAF 2EODA 1MM2A 2VPBA 3HTKC 5D1KB 4A49A 3C5KA 2L0BA 3IHPA 4MVTA 3N9MA 2NAAA 2LXPC 4FIPA 2JRJA 4YABA 4BBQA 3LQJA 4MSXA 2K1JA 2EA6A 3N9PA 2LDRA 4X3GA 3MHHA 4I7BA 4WZ2A 4YBTA 4YATA 5B75A 1WILA 2VP7A 2MUMA 4C9ZA 2LXHC 1WFKA 3LRQA 5TDWA 4FK5A 1X4JA 2HYED 2ECWA 2KWKA 3LQIA 5B8DA 4WZ3B 4YBSA 2YUCA 2EGPA 3FL2A 4Q6FA 4I7CA 1WENA 2K16A 1WEEA 2YURA 2YW8A 5B79A 2VJEB 1WGMA 3HCTA 2M3HA 5B78A 2FUUA 2QJ0A 4LJNA 1VYXA 4GNEA 2I50A 4LLBA 2MNYA 2YYRA 1K2FA 1VFYA 2PNXA 5H9MA 2KWNA 4AP4A 1Z6UA 3L1XA 2LRIC 5LKXA 3RPGB 4A4BA 3QZVA 1X4IA 2YQLA 3M99A 2MD7B 2KE1A 2ECGA 5D1LB 4A0CD 4ZDTA 4QF2A 4L58A 4L7XA 5I3LA 4V3KC 5B76A 3EB5A 4R7EA 2C2VS 3U5OA 4S3OB 1JM7B 2E6SA 2L43A 1WIMA 2KWOA 1V87A 2L5UA 3V43A 4FO9A 1IYMA 3EB6A 2VPEA 1WEUA 3O36A 2AN6A 2FUIA 1MM3A 3VK6A 1JM7A 2MIQA 3ZNIA 1VD4A 3LQHA 3KV6A 2VJFA 3ZTGA 3M62A 3DQVR 5C11A 2F42A 2M6MA 3DPLR 4B7YC 2MD8C 2ECVA 3RPGC 1DVPA 2G43A 1G25A 2JMJA 3N9LA 4WA6A 1FBVA 3ZPV1 2F6JA 2KU3A 3HCSA 4UP0A 1LDJB 2VPGA 2C2LA 3C6WA 4GNFA 2KFTA 5LKZA 3U5PA 4YADA 2JMIA 4AVXA 3KQIA 3SOXA 5DINA 2LGLA 2MA5A 2YHNA 1LDKC 3ASLA 5TRBA 4S3OC 4YAXA 3PHDA 1WEPA 2CT2A 3ZVZB 4AYCA 3HCUA 3NG2A 2UZGA 2G6QA 4WZ0A 4BHWA 2Y1MA 2ECJA 4R2YA 3KNVA 3PUQA 4PTBA 4LK9A 2F6NA 4R8PK 4YC9A 3M63A 2FSAA 1U6GB 1Z2QA 4IC2A 2RI7A 3MHSA 5TBNA 2H0DA 4CCGX 2JMDA 2KGIA 1X4UA 2RSDA 1E4UA 5G05B 1RMDA 3ZVYA 3L11A 2MA6A 3PURA 3O35A 5LKUA 2OXQC 5FB1A 5H1UA 4CA1A 4V3LC 5KH3A 4AUQB 2LGKA 1HYJA 2L75A 3ZPVE 2KIZA 2G45A 2VJFB 2YHOA 4UI9B 5D1MB 2YREA 1JOCA 1Z60A 5H1TA 1WEOA 2DX8A 2D8SA 2VNFA 3T7LA 5LKTA 4YBMA 2ECNA 1ZBDB 4P5OB 3U5NA 2LGVA 2KWJA 1HYIA 3SHBA 2Y43A 2LV9A 4UP5A 5FB0A 2CKLB 5LCWB 1XWHA 4N3WA 3SOWA 3U5MA 1CHCA 2XEUA 2Y1NA 3O7AA 2PUYA 1WEWA 2XB1A 4F52B 3O70A 4B86C 5C13A 1WEVA 2QICA 4AYCB 2LGGA 2CKLA 4GB0A 2HDPA 3O33A 1BORA 3RTRB 2K17A 4I7DA 2ECTA 4FJCA 5TDRA 5FERA 4IC3A 2CSYA 2BAYA 1N87A 4A4CA 4PPEA 5B77A 1WE9A 2VPDA 2H0DB 2YT5A 5DKAA 3ZYQA 4LKAA 2KR4A 4XI1A 2K4DA 1WEMA 4N4FA 3I2DA 4QF3A 5KH7A 2YQMA 2YSJA 4LADB 3O34A 2CSZA 2ZETC 3L1ZB 3N9NA 2LQ6A 5TABA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FP0 A;  1WES A;  1F62 A;  2KYU A;  2MT5 A;  5JG6 A;  2VJE A;  2E6R A;  5AIT A;  2YU4 A;  2LN0 A;  3SOU A;  5H1V A;  5KH9 A;  1WEQ A;  2IDA A;  2M85 A;  1T1H A;  4ZUX U;  2M1R A;  3KV5 A;  4O64 A;  2ECI A;  2MNZ A;  5G04 B;  4TKP B;  4GND A;  4NN2 A;  2KGG A;  4ZQL A;  2L80 A;  3GL6 A;  5J3X A;  2QIZ A;  4GNG A;  3O37 A;  3N9O A;  4W4U A;  3T6R A;  3N9Q A;  5FEY A;  2YSM A;  5G0F A;  5AIU A;  3GV4 A;  2KRE A;  5EYA F;  2EOD A;  1MM2 A;  2VPB A;  3HTK C;  5D1K B;  4A49 A;  3C5K A;  2L0B A;  3IHP A;  4MVT A;  3N9M A;  2NAA A;  2LXP C;  4FIP A;  2JRJ A;  4YAB A;  4BBQ A;  3LQJ A;  4MSX A;  2K1J A;  2EA6 A;  3N9P A;  2LDR A;  4X3G A;  3MHH A;  4I7B A;  4WZ2 A;  4YBT A;  4YAT A;  5B75 A;  1WIL A;  2VP7 A;  2MUM A;  4C9Z A;  2LXH C;  1WFK A;  3LRQ A;  5TDW A;  4FK5 A;  1X4J A;  2HYE D;  2ECW A;  2KWK A;  3LQI A;  5B8D A;  4WZ3 B;  4YBS A;  2YUC A;  2EGP A;  3FL2 A;  4Q6F A;  4I7C A;  1WEN A;  2K16 A;  1WEE A;  2YUR A;  2YW8 A;  5B79 A;  2VJE B;  1WGM A;  3HCT A;  2M3H A;  5B78 A;  2FUU A;  2QJ0 A;  4LJN A;  1VYX A;  4GNE A;  2I50 A;  4LLB A;  2MNY A;  2YYR A;  1K2F A;  1VFY A;  2PNX A;  5H9M A;  2KWN A;  4AP4 A;  1Z6U A;  3L1X A;  2LRI C;  5LKX A;  3RPG B;  4A4B A;  3QZV A;  1X4I A;  2YQL A;  3M99 A;  2MD7 B;  2KE1 A;  2ECG A;  5D1L B;  4A0C D;  4ZDT A;  4QF2 A;  4L58 A;  4L7X A;  5I3L A;  4V3K C;  5B76 A;  3EB5 A;  4R7E A;  2C2V S;  3U5O A;  4S3O B;  1JM7 B;  2E6S A;  2L43 A;  1WIM A;  2KWO A;  1V87 A;  2L5U A;  3V43 A;  4FO9 A;  1IYM A;  3EB6 A;  2VPE A;  1WEU A;  3O36 A;  2AN6 A;  2FUI A;  1MM3 A;  3VK6 A;  1JM7 A;  2MIQ A;  3ZNI A;  1VD4 A;  3LQH A;  3KV6 A;  2VJF A;  3ZTG A;  3M62 A;  3DQV R;  5C11 A;  2F42 A;  2M6M A;  3DPL R;  4B7Y C;  2MD8 C;  2ECV A;  3RPG C;  1DVP A;  2G43 A;  1G25 A;  2JMJ A;  3N9L A;  4WA6 A;  1FBV A;  3ZPV 1;  2F6J A;  2KU3 A;  3HCS A;  4UP0 A;  1LDJ B;  2VPG A;  2C2L A;  3C6W A;  4GNF A;  2KFT A;  5LKZ A;  3U5P A;  4YAD A;  2JMI A;  4AVX A;  3KQI A;  3SOX A;  5DIN A;  2LGL A;  2MA5 A;  2YHN A;  1LDK C;  3ASL A;  5TRB A;  4S3O C;  4YAX A;  3PHD A;  1WEP A;  2CT2 A;  3ZVZ B;  4AYC A;  3HCU A;  3NG2 A;  2UZG A;  2G6Q A;  4WZ0 A;  4BHW A;  2Y1M A;  2ECJ A;  4R2Y A;  3KNV A;  3PUQ A;  4PTB A;  4LK9 A;  2F6N A;  4R8P K;  4YC9 A;  3M63 A;  2FSA A;  1U6G B;  1Z2Q A;  4IC2 A;  2RI7 A;  3MHS A;  5TBN A;  2H0D A;  4CCG X;  2JMD A;  2KGI A;  1X4U A;  2RSD A;  1E4U A;  5G05 B;  1RMD A;  3ZVY A;  3L11 A;  2MA6 A;  3PUR A;  3O35 A;  5LKU A;  2OXQ C;  5FB1 A;  5H1U A;  4CA1 A;  4V3L C;  5KH3 A;  4AUQ B;  2LGK A;  1HYJ A;  2L75 A;  3ZPV E;  2KIZ A;  2G45 A;  2VJF B;  2YHO A;  4UI9 B;  5D1M B;  2YRE A;  1JOC A;  1Z60 A;  5H1T A;  1WEO A;  2DX8 A;  2D8S A;  2VNF A;  3T7L A;  5LKT A;  4YBM A;  2ECN A;  1ZBD B;  4P5O B;  3U5N A;  2LGV A;  2KWJ A;  1HYI A;  3SHB A;  2Y43 A;  2LV9 A;  4UP5 A;  5FB0 A;  2CKL B;  5LCW B;  1XWH A;  4N3W A;  3SOW A;  3U5M A;  1CHC A;  2XEU A;  2Y1N A;  3O7A A;  2PUY A;  1WEW A;  2XB1 A;  4F52 B;  3O70 A;  4B86 C;  5C13 A;  1WEV A;  2QIC A;  4AYC B;  2LGG A;  2CKL A;  4GB0 A;  2HDP A;  3O33 A;  1BOR A;  3RTR B;  2K17 A;  4I7D A;  2ECT A;  4FJC A;  5TDR A;  5FER A;  4IC3 A;  2CSY A;  2BAY A;  1N87 A;  4A4C A;  4PPE A;  5B77 A;  1WE9 A;  2VPD A;  2H0D B;  2YT5 A;  5DKA A;  3ZYQ A;  4LKA A;  2KR4 A;  4XI1 A;  2K4D A;  1WEM A;  4N4F A;  3I2D A;  4QF3 A;  5KH7 A;  2YQM A;  2YSJ A;  4LAD B;  3O34 A;  2CSZ A;  2ZET C;  3L1Z B;  3N9N A;  2LQ6 A;  5TAB A; 
#chains in the Genus database with same CATH topology
 1FP0 A;  3LVR E;  1WES A;  1F62 A;  2KYU A;  2MT5 A;  5JG6 A;  2VJE A;  2E6R A;  5SVY A;  5AIT A;  2YU4 A;  2D8U A;  2LN0 A;  3SOU A;  5H1V A;  5KH9 A;  1WEQ A;  2IDA A;  2M85 A;  1T1H A;  4ZUX U;  2IQJ A;  2M1R A;  3KV5 A;  4O64 A;  2ECI A;  2MNZ A;  5G04 B;  4TKP B;  4GND A;  4NN2 A;  2KGG A;  4H9D A;  2L80 A;  4ZQL A;  3GL6 A;  5J3X A;  2QIZ A;  4GNG A;  3O37 A;  2E61 A;  2XOC A;  1MBM A;  2FFW A;  3N9O A;  2RR4 A;  4W4U A;  3T6R A;  3N9Q A;  5FEY A;  2YSM A;  5G0F A;  5AIU A;  3GV4 A;  2KRE A;  5EYA F;  2EOD A;  1MM2 A;  2VPB A;  3HTK C;  5D1K B;  4A49 A;  3C5K A;  2L0B A;  3IHP A;  4MVT A;  3N9M A;  2XOZ A;  2NAA A;  2LXP C;  4FIP A;  2JRJ A;  4YAB A;  3FAO A;  4BBQ A;  3LQJ A;  4MSX A;  2K1J A;  2EA6 A;  3N9P A;  2LDR A;  2DJA A;  4X3G A;  3MHH A;  4I7B A;  4WZ2 A;  4YBT A;  4YAT A;  5B75 A;  1WIL A;  2VP7 A;  2MUM A;  4C9Z A;  2LXH C;  1WFK A;  3LRQ A;  5TDW A;  4FK5 A;  1X4J A;  2HYE D;  2ECW A;  2KWK A;  3LQI A;  5B8D A;  4WZ3 B;  4YBS A;  2YUC A;  2EGP A;  2L7P A;  3FL2 A;  3PLW A;  4Q6F A;  4I7C A;  1WEN A;  2K16 A;  1WEE A;  2YUR A;  2YW8 A;  5B79 A;  2VJE B;  1WGM A;  3HCT A;  2M3H A;  4Z0O A;  5B78 A;  2FUU A;  2QJ0 A;  4LJN A;  1VYX A;  4GNE A;  2I50 A;  3FAN A;  4LLB A;  3T9K A;  2MNY A;  2YYR A;  1K2F A;  1VFY A;  2PNX A;  5H9M A;  2KWN A;  4AP4 A;  1Z6U A;  3JUE A;  3L1X A;  2LRI C;  2CSV A;  5LKX A;  3RPG B;  4A4B A;  3LDY A;  3QZV A;  2LAU A;  2XP0 A;  1X4I A;  3FEH A;  2XOY A;  2YQL A;  3M99 A;  2MD7 B;  2KE1 A;  2ECG A;  2MKE A;  5D1L B;  2YVR A;  4A0C D;  4ZDT A;  4QF2 A;  4L58 A;  4L7X A;  5I3L A;  4V3K C;  5B76 A;  3EB5 A;  4R7E A;  2C2V S;  3U5O A;  4S3O B;  1JM7 B;  2E6S A;  2L43 A;  3DDT A;  1WIM A;  2KWO A;  1V87 A;  2L5U A;  3Q1D A;  3E2D A;  3V43 A;  4FO9 A;  1IYM A;  3EB6 A;  4QQ4 A;  2VPE A;  1WEU A;  2FD4 A;  3O36 A;  2AN6 A;  2FUI A;  1MM3 A;  3VK6 A;  1JM7 A;  2KKX A;  2MIQ A;  3ZNI A;  1VD4 A;  3LQH A;  3KV6 A;  2VJF A;  3ZTG A;  3M62 A;  4O62 A;  3DQV R;  5C11 A;  2F42 A;  2M6M A;  3DPL R;  4B7Y C;  2MD8 C;  2ECV A;  3RPG C;  2M13 A;  1DVP A;  2G43 A;  1DCQ A;  2JMJ A;  1G25 A;  3N9L A;  4WA6 A;  1FBV A;  3ZPV 1;  4OGE A;  2F6J A;  2KU3 A;  3HCS A;  4UP0 A;  1LDJ B;  2VPG A;  2CRW A;  5SVI A;  5SVX A;  2C2L A;  3C6W A;  4GNF A;  2KFT A;  5LKZ A;  3U5P A;  4YAD A;  2JMI A;  4AVX A;  3KQI A;  3SOX A;  5DIN A;  2LGL A;  2MA5 A;  3H7H A;  2YHN A;  1LDK C;  4F1P A;  3ASL A;  5TRB A;  4S3O C;  4YAX A;  3PHD A;  2DSM A;  3KDE C;  1WEP A;  2KKY A;  2CT2 A;  3ZVZ B;  4AYC A;  3HCU A;  3NG2 A;  2UZG A;  2G6Q A;  4WZ0 A;  3SUB A;  4BHW A;  2Y1M A;  2ECJ A;  4R2Y A;  3KNV A;  3PUQ A;  4PTB A;  2CON A;  4LK9 A;  2F6N A;  4R8P K;  3O47 A;  4YC9 A;  3M63 A;  2FSA A;  1U6G B;  2CRR A;  1Z2Q A;  4IC2 A;  2RI7 A;  3MHS A;  5TBN A;  2H0D A;  4CCG X;  2JMD A;  2KGI A;  1X4U A;  2RSD A;  1E4U A;  5G05 B;  1RMD A;  3ZVY A;  3L11 A;  2MA6 A;  3PUR A;  3O35 A;  5LKU A;  2OXQ C;  5FB1 A;  5H1U A;  4Z0R A;  4CA1 A;  4V3L C;  5KH3 A;  4AUQ B;  2LGK A;  1HYJ A;  2L75 A;  3ZPV E;  2KIZ A;  2JUN A;  2G45 A;  2VJF B;  3M7K A;  2YHO A;  4OGC A;  4UI9 B;  5D1M B;  2YRE A;  1JOC A;  1Z60 A;  5H1T A;  1WEO A;  2DX8 A;  2D8S A;  2VNF A;  3T7L A;  5LKT A;  4YBM A;  2B0O E;  2EGM A;  2EXU A;  2ECN A;  1ZBD B;  4P5O B;  3U5N A;  2LGV A;  2KWJ A;  1HYI A;  5SVI B;  3SHB A;  2Y43 A;  2LV9 A;  3DWD A;  4UP5 A;  5FB0 A;  2CKL B;  5LCW B;  1XWH A;  4N3W A;  3SOW A;  2JM3 A;  3U5M A;  1CHC A;  2XEU A;  3FJU B;  2OWA A;  2Y1N A;  3O7A A;  2PUY A;  1WEW A;  2XB1 A;  2P57 A;  3MDB C;  4F52 B;  3O70 A;  3FM8 C;  4B86 C;  5C13 A;  1WEV A;  2QIC A;  4AYC B;  2LGG A;  2CKL A;  4GB0 A;  2HDP A;  3O33 A;  1BOR A;  3RTR B;  2K17 A;  4I7D A;  2ECT A;  4FJC A;  5TDR A;  3LJU X;  5FER A;  4IC3 A;  2CSY A;  3LVQ E;  2BAY A;  1N87 A;  4A4C A;  4PPE A;  5B77 A;  1WE9 A;  2VPD A;  2H0D B;  2YT5 A;  5DKA A;  3ZYQ A;  4LKA A;  2KR4 A;  4XI1 A;  2K4D A;  1WEM A;  4N4F A;  3I2D A;  4QF3 A;  5KH7 A;  2YQM A;  2YSJ A;  4LAD B;  3O34 A;  2CSZ A;  2ZET C;  5K3Q A;  3L1Z B;  3N9N A;  2LQ6 A;  5TAB A; 
#chains in the Genus database with same CATH homology
 1FP0 A;  1WES A;  1F62 A;  2KYU A;  2MT5 A;  5JG6 A;  2VJE A;  2E6R A;  5AIT A;  2YU4 A;  2LN0 A;  3SOU A;  5H1V A;  5KH9 A;  1WEQ A;  2IDA A;  2M85 A;  1T1H A;  4ZUX U;  2M1R A;  3KV5 A;  4O64 A;  2ECI A;  2MNZ A;  5G04 B;  4TKP B;  4GND A;  4NN2 A;  2KGG A;  4ZQL A;  2L80 A;  3GL6 A;  5J3X A;  2QIZ A;  4GNG A;  3O37 A;  3N9O A;  4W4U A;  3T6R A;  3N9Q A;  5FEY A;  2YSM A;  5G0F A;  5AIU A;  3GV4 A;  2KRE A;  5EYA F;  2EOD A;  1MM2 A;  2VPB A;  3HTK C;  5D1K B;  4A49 A;  3C5K A;  2L0B A;  3IHP A;  4MVT A;  3N9M A;  2NAA A;  2LXP C;  4FIP A;  2JRJ A;  4YAB A;  4BBQ A;  3LQJ A;  4MSX A;  2K1J A;  2EA6 A;  3N9P A;  2LDR A;  4X3G A;  3MHH A;  4I7B A;  4WZ2 A;  4YBT A;  4YAT A;  5B75 A;  1WIL A;  2VP7 A;  2MUM A;  4C9Z A;  2LXH C;  1WFK A;  3LRQ A;  5TDW A;  4FK5 A;  1X4J A;  2HYE D;  2ECW A;  2KWK A;  3LQI A;  5B8D A;  4WZ3 B;  4YBS A;  2YUC A;  2EGP A;  3FL2 A;  4Q6F A;  4I7C A;  1WEN A;  2K16 A;  1WEE A;  2YUR A;  2YW8 A;  5B79 A;  2VJE B;  1WGM A;  3HCT A;  2M3H A;  5B78 A;  2FUU A;  2QJ0 A;  4LJN A;  1VYX A;  4GNE A;  2I50 A;  4LLB A;  2MNY A;  2YYR A;  1K2F A;  1VFY A;  2PNX A;  5H9M A;  2KWN A;  4AP4 A;  1Z6U A;  3L1X A;  2LRI C;  5LKX A;  3RPG B;  4A4B A;  3QZV A;  1X4I A;  2YQL A;  3M99 A;  2MD7 B;  2KE1 A;  2ECG A;  5D1L B;  4A0C D;  4ZDT A;  4QF2 A;  4L58 A;  4L7X A;  5I3L A;  4V3K C;  5B76 A;  3EB5 A;  4R7E A;  2C2V S;  3U5O A;  4S3O B;  1JM7 B;  2E6S A;  2L43 A;  1WIM A;  2KWO A;  1V87 A;  2L5U A;  3V43 A;  4FO9 A;  1IYM A;  3EB6 A;  2VPE A;  1WEU A;  3O36 A;  2AN6 A;  2FUI A;  1MM3 A;  3VK6 A;  1JM7 A;  2MIQ A;  3ZNI A;  1VD4 A;  3LQH A;  3KV6 A;  2VJF A;  3ZTG A;  3M62 A;  3DQV R;  5C11 A;  2F42 A;  2M6M A;  3DPL R;  4B7Y C;  2MD8 C;  2ECV A;  3RPG C;  1DVP A;  2G43 A;  1G25 A;  2JMJ A;  3N9L A;  4WA6 A;  1FBV A;  3ZPV 1;  2F6J A;  2KU3 A;  3HCS A;  4UP0 A;  1LDJ B;  2VPG A;  2C2L A;  3C6W A;  4GNF A;  2KFT A;  5LKZ A;  3U5P A;  4YAD A;  2JMI A;  4AVX A;  3KQI A;  3SOX A;  5DIN A;  2LGL A;  2MA5 A;  2YHN A;  1LDK C;  3ASL A;  5TRB A;  4S3O C;  4YAX A;  3PHD A;  1WEP A;  2CT2 A;  3ZVZ B;  4AYC A;  3HCU A;  3NG2 A;  2UZG A;  2G6Q A;  4WZ0 A;  4BHW A;  2Y1M A;  2ECJ A;  4R2Y A;  3KNV A;  3PUQ A;  4PTB A;  4LK9 A;  2F6N A;  4R8P K;  4YC9 A;  3M63 A;  2FSA A;  1U6G B;  1Z2Q A;  4IC2 A;  2RI7 A;  3MHS A;  5TBN A;  2H0D A;  4CCG X;  2JMD A;  2KGI A;  1X4U A;  2RSD A;  1E4U A;  5G05 B;  1RMD A;  3ZVY A;  3L11 A;  2MA6 A;  3PUR A;  3O35 A;  5LKU A;  2OXQ C;  5FB1 A;  5H1U A;  4CA1 A;  4V3L C;  5KH3 A;  4AUQ B;  2LGK A;  1HYJ A;  2L75 A;  3ZPV E;  2KIZ A;  2G45 A;  2VJF B;  2YHO A;  4UI9 B;  5D1M B;  2YRE A;  1JOC A;  1Z60 A;  5H1T A;  1WEO A;  2DX8 A;  2D8S A;  2VNF A;  3T7L A;  5LKT A;  4YBM A;  2ECN A;  1ZBD B;  4P5O B;  3U5N A;  2LGV A;  2KWJ A;  1HYI A;  3SHB A;  2Y43 A;  2LV9 A;  4UP5 A;  5FB0 A;  2CKL B;  5LCW B;  1XWH A;  4N3W A;  3SOW A;  3U5M A;  1CHC A;  2XEU A;  2Y1N A;  3O7A A;  2PUY A;  1WEW A;  2XB1 A;  4F52 B;  3O70 A;  4B86 C;  5C13 A;  1WEV A;  2QIC A;  4AYC B;  2LGG A;  2CKL A;  4GB0 A;  2HDP A;  3O33 A;  1BOR A;  3RTR B;  2K17 A;  4I7D A;  2ECT A;  4FJC A;  5TDR A;  5FER A;  4IC3 A;  2CSY A;  2BAY A;  1N87 A;  4A4C A;  4PPE A;  5B77 A;  1WE9 A;  2VPD A;  2H0D B;  2YT5 A;  5DKA A;  3ZYQ A;  4LKA A;  2KR4 A;  4XI1 A;  2K4D A;  1WEM A;  4N4F A;  3I2D A;  4QF3 A;  5KH7 A;  2YQM A;  2YSJ A;  4LAD B;  3O34 A;  2CSZ A;  2ZET C;  3L1Z B;  3N9N A;  2LQ6 A;  5TAB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...