1WEPA

Solution structure of phd domain in phf8
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
79
structure length
79
Chain Sequence
b'GSSGSSGMALVPVYCLCRQPYNVNHFMIECGLCQDWFHGSCVGIEEENAVDIDIYHCPDCEAVFGPSIMKNWHSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHF8
publication title Solution structure of PHD domain in protein AA017385
rcsb
source organism Mus musculus
molecule tags Dna binding protein
total genus 9
structure length 79
sequence length 79
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2004-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1wepA00
1DVPA 1K2FA 4YABA 4FJCA 4AVXA 3SOWA 2C2LA 5FEYA 2YW8A 5DKAA 4YAXA 2HYED 3SOXA 5LKUA 3MHSA 2H0DA 3IHPA 3SOUA 2K1JA 5B77A 1F62A 2EODA 3NG2A 1WEEA 2I50A 4PPEA 2NAAA 5H9MA 3U5OA 2M3HA 4CCGX 4LLBA 4B86C 2YSJA 4WZ3B 1IYMA 4BBQA 5J3XA 4A49A 5D1MB 1WEUA 5B79A 4WA6A 2VPBA 4GNGA 2KWJA 3ZVZB 3O70A 3RPGC 3ASLA 4YC9A 5KH3A 4L58A 3PHDA 2L5UA 2CT2A 3N9MA 4AP4A 5LKTA 4IC3A 2IDAA 5KH9A 4ZUXU 5D1LB 5AIUA 2K16A 2LXPC 2XEUA 2Y43A 4AYCB 2AN6A 1WFKA 2KU3A 5JG6A 3KNVA 4R7EA 3U5PA 1WEQA 3N9OA 5C13A 3U5NA 5FB0A 2MA5A 2ECNA 4I7CA 4BHWA 4N3WA 1WGMA 1WEOA 4W4UA 4YBTA 2MUMA 4LKAA 5B76A 2YQLA 4PTBA 2ECGA 4YATA 4QF2A 3ZNIA 2L0BA 3M99A 1HYIA 3DQVR 2LXHC 4ZDTA 3ZPV1 2E6SA 4CA1A 4GNEA 2LN0A 1T1HA 1FBVA 2KE1A 2VJFB 3V43A 1JM7B 4UP0A 5G05B 2KFTA 2E6RA 2HDPA 2YUCA 2DX8A 3QZVA 3GL6A 2MD7B 3ZTGA 5G0FA 2F42A 2K4DA 3C6WA 1WIMA 2FSAA 2M85A 2MA6A 4B7YC 4L7XA 2F6NA 3N9LA 2YT5A 3KQIA 3L11A 4V3LC 3KV5A 3T6RA 3GV4A 5FERA 4A4CA 3ZVYA 4I7BA 5I3LA 3ZPVE 5LKZA 2UZGA 3PURA 5LKXA 2KYUA 5B78A 2M6MA 1E4UA 2KIZA 4A0CD 3FL2A 2G6QA 2KWKA 2LGLA 2JRJA 3O37A 2YHNA 1WENA 2LDRA 4FO9A 4AUQB 4YBSA 2YSMA 2ECJA 2RSDA 4P5OB 1LDJB 2H0DB 5D1KB 2KWNA 2YYRA 3HCSA 3U5MA 1XWHA 2ECIA 3O33A 3L1XA 3LQJA 2MNYA 1BORA 5EYAF 3PUQA 2QICA 1X4IA 4FIPA 4GB0A 3HCTA 2EGPA 2LRIC 3MHHA 4F52B 1WE9A 2LQ6A 3O7AA 1VFYA 3N9NA 1LDKC 1Z60A 2JMJA 2D8SA 5LCWB 3HTKC 4IC2A 2QIZA 2YQMA 3LQHA 5AITA 5DINA 2VNFA 5H1TA 3M63A 3EB5A 2LGVA 2L43A 4YBMA 4LK9A 5G04B 2CKLA 1U6GB 2F6JA 1JM7A 4XI1A 4Q6FA 4O64A 4R8PK 2XB1A 2K17A 5FB1A 1WEVA 4ZQLA 4QF3A 1WESA 3O36A 2KR4A 4WZ2A 5TRBA 4GNFA 2LGKA 5B75A 1VYXA 3DPLR 2VJEB 2C2VS 3T7LA 1X4UA 1Z6UA 2CSZA 2Y1MA 2VPGA 4YADA 3N9PA 2MNZA 2M1RA 2BAYA 5TDRA 3VK6A 2JMIA 2PUYA 3I2DA 1X4JA 5TDWA 3EB6A 2EA6A 2Y1NA 5TBNA 3RTRB 2L75A 5TABA 2KREA 2YURA 2YREA 2JMDA 2ECVA 4TKPB 3LQIA 1Z2QA 2VP7A 2ECTA 2LV9A 1N87A 3KV6A 4C9ZA 4AYCA 2OXQC 2G43A 5KH7A 2LGGA 4MVTA 4NN2A 4UI9B 2MD8C 3RPGB 5C11A 1WILA 1JOCA 1WEWA 4R2YA 2FUUA 4UP5A 4A4BA 2YU4A 3ZYQA 1MM3A 2L80A 4MSXA 4LADB 4N4FA 1FP0A 2FUIA 2CSYA 5H1UA 3M62A 3SHBA 1RMDA 4I7DA 4LJNA 1V87A 3LRQA 2KWOA 1WEMA 2G45A 3N9QA 2VJFA 2QJ0A 4V3KC 4WZ0A 2VJEA 5H1VA 2MT5A 4S3OB 1VD4A 3C5KA 5B8DA 4S3OC 1HYJA 1G25A 1WEPA 2ZETC 2VPEA 2MIQA 2YHOA 2VPDA 1CHCA 1ZBDB 3O35A 4FK5A 2KGGA 2CKLB 4GNDA 3L1ZB 2KGIA 2PNXA 3O34A 2ECWA 1MM2A 2RI7A 3HCUA 4X3GA
chains in the Genus database with same CATH superfamily
1DVPA 3FM8C 1K2FA 4YABA 4FJCA 4AVXA 3SOWA 2C2LA 5FEYA 2YW8A 5DKAA 4YAXA 2HYED 3SOXA 3PLWA 5LKUA 3MHSA 2FFWA 2H0DA 5SVIA 3IHPA 3SOUA 2K1JA 5B77A 1F62A 2EODA 3NG2A 1WEEA 2XOYA 2I50A 4PPEA 2NAAA 5H9MA 3U5OA 2M3HA 4CCGX 4LLBA 4B86C 2YSJA 4WZ3B 1IYMA 4BBQA 4F1PA 1DCQA 5J3XA 3T9KA 4A49A 5D1MB 1WEUA 5B79A 4WA6A 2VPBA 4GNGA 2KWJA 3ZVZB 3O70A 3RPGC 4Z0RA 3ASLA 4YC9A 5KH3A 4L58A 3PHDA 2L5UA 2CT2A 3N9MA 4AP4A 5LKTA 4IC3A 2IDAA 5KH9A 4ZUXU 5D1LB 5AIUA 2K16A 2LXPC 2XEUA 2Y43A 4AYCB 3SUBA 4QQ4A 2AN6A 1WFKA 2KU3A 5JG6A 3KNVA 4R7EA 2M13A 2YVRA 3U5PA 1WEQA 3N9OA 5C13A 3M7KA 3U5NA 5FB0A 2MA5A 2ECNA 4I7CA 3DDTA 4BHWA 4N3WA 1WGMA 1WEOA 4W4UA 4YBTA 2MUMA 4LKAA 5B76A 2YQLA 4PTBA 2ECGA 2EGMA 3E2DA 4YATA 4QF2A 3ZNIA 2L0BA 3M99A 1HYIA 3DQVR 2LXHC 4ZDTA 3ZPV1 3DWDA 2E6SA 4CA1A 4GNEA 2LN0A 1T1HA 1FBVA 2KE1A 2VJFB 3V43A 1JM7B 4UP0A 5G05B 2P57A 2KFTA 2E6RA 2HDPA 2YUCA 2DX8A 2FD4A 3QZVA 3GL6A 2MD7B 3ZTGA 4Z0OA 5G0FA 2F42A 2K4DA 3C6WA 1WIMA 2FSAA 2M85A 2MA6A 4B7YC 4L7XA 2F6NA 2OWAA 3N9LA 2YT5A 3KQIA 3L11A 2XOZA 4V3LC 3KV5A 3T6RA 3GV4A 5FERA 4A4CA 3ZVYA 4I7BA 5I3LA 2E61A 3ZPVE 3Q1DA 5LKZA 2UZGA 3PURA 5LKXA 2KYUA 3O47A 5B78A 2M6MA 1E4UA 2KIZA 4A0CD 3FL2A 2G6QA 2KWKA 2LGLA 2JRJA 3O37A 2YHNA 1WENA 2LDRA 4FO9A 4AUQB 4YBSA 2YSMA 3MDBC 2ECJA 2RSDA 4P5OB 1LDJB 2H0DB 5SVXA 5D1KB 3JUEA 2KWNA 3LVRE 2YYRA 3HCSA 3U5MA 1XWHA 2ECIA 3O33A 3L1XA 3LQJA 2MNYA 1BORA 5EYAF 3PUQA 2QICA 3KDEC 1X4IA 4FIPA 2RR4A 4GB0A 3HCTA 2EGPA 2LRIC 3LVQE 2CRRA 3MHHA 3LJUX 4F52B 1WE9A 2LQ6A 3O7AA 2CSVA 1VFYA 3N9NA 4O62A 3FJUB 1MBMA 1LDKC 1Z60A 2KKYA 2JMJA 2D8SA 5LCWB 3HTKC 4IC2A 2QIZA 2YQMA 3LQHA 5AITA 5DINA 2VNFA 2JM3A 5H1TA 3M63A 3EB5A 2LGVA 2L43A 4YBMA 4LK9A 5G04B 2CKLA 1U6GB 2F6JA 1JM7A 4XI1A 4Q6FA 4O64A 4R8PK 2XB1A 3FANA 2K17A 5FB1A 1WEVA 4ZQLA 4QF3A 1WESA 3O36A 2KR4A 4WZ2A 4GNFA 5TRBA 2LGKA 5B75A 1VYXA 3DPLR 2KKXA 2VJEB 2C2VS 3T7LA 2B0OE 1X4UA 1Z6UA 2CSZA 2Y1MA 2VPGA 4YADA 3FEHA 2CRWA 3N9PA 2MNZA 2M1RA 2BAYA 5TDRA 5K3QA 2DSMA 3VK6A 2JMIA 2PUYA 3I2DA 1X4JA 2EXUA 3H7HA 5TDWA 2CONA 3FAOA 3EB6A 2EA6A 2Y1NA 5TBNA 3RTRB 2L75A 5TABA 2KREA 2YURA 2YREA 2JMDA 2ECVA 4TKPB 3LQIA 1Z2QA 2VP7A 2ECTA 2LV9A 1N87A 2MKEA 3KV6A 4C9ZA 4AYCA 2OXQC 5SVIB 2G43A 5KH7A 2LGGA 4MVTA 4NN2A 4UI9B 2MD8C 3RPGB 5C11A 1WILA 1JOCA 1WEWA 3LDYA 4R2YA 2JUNA 2FUUA 2XOCA 4UP5A 4A4BA 2YU4A 3ZYQA 1MM3A 2L80A 4MSXA 4LADB 4N4FA 1FP0A 2FUIA 2CSYA 5H1UA 2D8UA 3M62A 3SHBA 1RMDA 4I7DA 4LJNA 5SVYA 1V87A 3LRQA 4H9DA 4OGCA 2DJAA 2KWOA 1WEMA 2G45A 3N9QA 2VJFA 4OGEA 2XP0A 2QJ0A 4V3KC 4WZ0A 2VJEA 5H1VA 2MT5A 4S3OB 1VD4A 3C5KA 5B8DA 4S3OC 1HYJA 2LAUA 1G25A 1WEPA 2ZETC 2VPEA 2MIQA 2YHOA 2VPDA 1CHCA 2L7PA 1ZBDB 3O35A 4FK5A 2KGGA 2CKLB 4GNDA 3L1ZB 2KGIA 2PNXA 2IQJA 3O34A 2ECWA 1MM2A 2RI7A 3HCUA 4X3GA
chains in the Genus database with same CATH topology
1DVPA 1K2FA 4YABA 4FJCA 4AVXA 3SOWA 2C2LA 5FEYA 2YW8A 5DKAA 4YAXA 2HYED 3SOXA 5LKUA 3MHSA 2H0DA 3IHPA 3SOUA 2K1JA 5B77A 1F62A 2EODA 3NG2A 1WEEA 2I50A 4PPEA 2NAAA 5H9MA 3U5OA 2M3HA 4CCGX 4LLBA 4B86C 2YSJA 4WZ3B 1IYMA 4BBQA 5J3XA 4A49A 5D1MB 1WEUA 5B79A 4WA6A 2VPBA 4GNGA 2KWJA 3ZVZB 3O70A 3RPGC 3ASLA 4YC9A 5KH3A 4L58A 3PHDA 2L5UA 2CT2A 3N9MA 4AP4A 5LKTA 4IC3A 2IDAA 5KH9A 4ZUXU 5D1LB 5AIUA 2K16A 2LXPC 2XEUA 2Y43A 4AYCB 2AN6A 1WFKA 2KU3A 5JG6A 3KNVA 4R7EA 3U5PA 1WEQA 3N9OA 5C13A 3U5NA 5FB0A 2MA5A 2ECNA 4I7CA 4BHWA 4N3WA 1WGMA 1WEOA 4W4UA 4YBTA 2MUMA 4LKAA 5B76A 2YQLA 4PTBA 2ECGA 4YATA 4QF2A 3ZNIA 2L0BA 3M99A 1HYIA 3DQVR 2LXHC 4ZDTA 3ZPV1 2E6SA 4CA1A 4GNEA 2LN0A 1T1HA 1FBVA 2KE1A 2VJFB 3V43A 1JM7B 4UP0A 5G05B 2KFTA 2E6RA 2HDPA 2YUCA 2DX8A 3QZVA 3GL6A 2MD7B 3ZTGA 5G0FA 2F42A 2K4DA 3C6WA 1WIMA 2FSAA 2M85A 2MA6A 4B7YC 4L7XA 2F6NA 3N9LA 2YT5A 3KQIA 3L11A 4V3LC 3KV5A 3T6RA 3GV4A 5FERA 4A4CA 3ZVYA 4I7BA 5I3LA 3ZPVE 5LKZA 2UZGA 3PURA 5LKXA 2KYUA 5B78A 2M6MA 1E4UA 2KIZA 4A0CD 3FL2A 2G6QA 2KWKA 2LGLA 2JRJA 3O37A 2YHNA 1WENA 2LDRA 4FO9A 4AUQB 4YBSA 2YSMA 2ECJA 2RSDA 4P5OB 1LDJB 2H0DB 5D1KB 2KWNA 2YYRA 3HCSA 3U5MA 1XWHA 2ECIA 3O33A 3L1XA 3LQJA 2MNYA 1BORA 5EYAF 3PUQA 2QICA 1X4IA 4FIPA 4GB0A 3HCTA 2EGPA 2LRIC 3MHHA 4F52B 1WE9A 2LQ6A 3O7AA 1VFYA 3N9NA 1LDKC 1Z60A 2JMJA 2D8SA 5LCWB 3HTKC 4IC2A 2QIZA 2YQMA 3LQHA 5AITA 5DINA 2VNFA 5H1TA 3M63A 3EB5A 2LGVA 2L43A 4YBMA 4LK9A 5G04B 2CKLA 1U6GB 2F6JA 1JM7A 4XI1A 4Q6FA 4O64A 4R8PK 2XB1A 2K17A 5FB1A 1WEVA 4ZQLA 4QF3A 1WESA 3O36A 2KR4A 4WZ2A 5TRBA 4GNFA 2LGKA 5B75A 1VYXA 3DPLR 2VJEB 2C2VS 3T7LA 1X4UA 1Z6UA 2CSZA 2Y1MA 2VPGA 4YADA 3N9PA 2MNZA 2M1RA 2BAYA 5TDRA 3VK6A 2JMIA 2PUYA 3I2DA 1X4JA 5TDWA 3EB6A 2EA6A 2Y1NA 5TBNA 3RTRB 2L75A 5TABA 2KREA 2YURA 2YREA 2JMDA 2ECVA 4TKPB 3LQIA 1Z2QA 2VP7A 2ECTA 2LV9A 1N87A 3KV6A 4C9ZA 4AYCA 2OXQC 2G43A 5KH7A 2LGGA 4MVTA 4NN2A 4UI9B 2MD8C 3RPGB 5C11A 1WILA 1JOCA 1WEWA 4R2YA 2FUUA 4UP5A 4A4BA 2YU4A 3ZYQA 1MM3A 2L80A 4MSXA 4LADB 4N4FA 1FP0A 2FUIA 2CSYA 5H1UA 3M62A 3SHBA 1RMDA 4I7DA 4LJNA 1V87A 3LRQA 2KWOA 1WEMA 2G45A 3N9QA 2VJFA 2QJ0A 4V3KC 4WZ0A 2VJEA 5H1VA 2MT5A 4S3OB 1VD4A 3C5KA 5B8DA 4S3OC 1HYJA 1G25A 1WEPA 2ZETC 2VPEA 2MIQA 2YHOA 2VPDA 1CHCA 1ZBDB 3O35A 4FK5A 2KGGA 2CKLB 4GNDA 3L1ZB 2KGIA 2PNXA 3O34A 2ECWA 1MM2A 2RI7A 3HCUA 4X3GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DVP A;  1K2F A;  4YAB A;  4FJC A;  4AVX A;  3SOW A;  2C2L A;  5FEY A;  2YW8 A;  5DKA A;  4YAX A;  2HYE D;  3SOX A;  5LKU A;  3MHS A;  2H0D A;  3IHP A;  3SOU A;  2K1J A;  5B77 A;  1F62 A;  2EOD A;  3NG2 A;  1WEE A;  2I50 A;  4PPE A;  2NAA A;  5H9M A;  3U5O A;  2M3H A;  4CCG X;  4LLB A;  4B86 C;  2YSJ A;  4WZ3 B;  1IYM A;  4BBQ A;  5J3X A;  4A49 A;  5D1M B;  1WEU A;  5B79 A;  4WA6 A;  2VPB A;  4GNG A;  2KWJ A;  3ZVZ B;  3O70 A;  3RPG C;  3ASL A;  4YC9 A;  5KH3 A;  4L58 A;  3PHD A;  2L5U A;  2CT2 A;  3N9M A;  4AP4 A;  5LKT A;  4IC3 A;  2IDA A;  5KH9 A;  4ZUX U;  5D1L B;  5AIU A;  2K16 A;  2LXP C;  2XEU A;  2Y43 A;  4AYC B;  2AN6 A;  1WFK A;  2KU3 A;  5JG6 A;  3KNV A;  4R7E A;  3U5P A;  1WEQ A;  3N9O A;  5C13 A;  3U5N A;  5FB0 A;  2MA5 A;  2ECN A;  4I7C A;  4BHW A;  4N3W A;  1WGM A;  1WEO A;  4W4U A;  4YBT A;  2MUM A;  4LKA A;  5B76 A;  2YQL A;  4PTB A;  2ECG A;  4YAT A;  4QF2 A;  3ZNI A;  2L0B A;  3M99 A;  1HYI A;  3DQV R;  2LXH C;  4ZDT A;  3ZPV 1;  2E6S A;  4CA1 A;  4GNE A;  2LN0 A;  1T1H A;  1FBV A;  2KE1 A;  2VJF B;  3V43 A;  1JM7 B;  4UP0 A;  5G05 B;  2KFT A;  2E6R A;  2HDP A;  2YUC A;  2DX8 A;  3QZV A;  3GL6 A;  2MD7 B;  3ZTG A;  5G0F A;  2F42 A;  2K4D A;  3C6W A;  1WIM A;  2FSA A;  2M85 A;  2MA6 A;  4B7Y C;  4L7X A;  2F6N A;  3N9L A;  2YT5 A;  3KQI A;  3L11 A;  4V3L C;  3KV5 A;  3T6R A;  3GV4 A;  5FER A;  4A4C A;  3ZVY A;  4I7B A;  5I3L A;  3ZPV E;  5LKZ A;  2UZG A;  3PUR A;  5LKX A;  2KYU A;  5B78 A;  2M6M A;  1E4U A;  2KIZ A;  4A0C D;  3FL2 A;  2G6Q A;  2KWK A;  2LGL A;  2JRJ A;  3O37 A;  2YHN A;  1WEN A;  2LDR A;  4FO9 A;  4AUQ B;  4YBS A;  2YSM A;  2ECJ A;  2RSD A;  4P5O B;  1LDJ B;  2H0D B;  5D1K B;  2KWN A;  2YYR A;  3HCS A;  3U5M A;  1XWH A;  2ECI A;  3O33 A;  3L1X A;  3LQJ A;  2MNY A;  1BOR A;  5EYA F;  3PUQ A;  2QIC A;  1X4I A;  4FIP A;  4GB0 A;  3HCT A;  2EGP A;  2LRI C;  3MHH A;  4F52 B;  1WE9 A;  2LQ6 A;  3O7A A;  1VFY A;  3N9N A;  1LDK C;  1Z60 A;  2JMJ A;  2D8S A;  5LCW B;  3HTK C;  4IC2 A;  2QIZ A;  2YQM A;  3LQH A;  5AIT A;  5DIN A;  2VNF A;  5H1T A;  3M63 A;  3EB5 A;  2LGV A;  2L43 A;  4YBM A;  4LK9 A;  5G04 B;  2CKL A;  1U6G B;  2F6J A;  1JM7 A;  4XI1 A;  4Q6F A;  4O64 A;  4R8P K;  2XB1 A;  2K17 A;  5FB1 A;  1WEV A;  4ZQL A;  4QF3 A;  1WES A;  3O36 A;  2KR4 A;  4WZ2 A;  5TRB A;  4GNF A;  2LGK A;  5B75 A;  1VYX A;  3DPL R;  2VJE B;  2C2V S;  3T7L A;  1X4U A;  1Z6U A;  2CSZ A;  2Y1M A;  2VPG A;  4YAD A;  3N9P A;  2MNZ A;  2M1R A;  2BAY A;  5TDR A;  3VK6 A;  2JMI A;  2PUY A;  3I2D A;  1X4J A;  5TDW A;  3EB6 A;  2EA6 A;  2Y1N A;  5TBN A;  3RTR B;  2L75 A;  5TAB A;  2KRE A;  2YUR A;  2YRE A;  2JMD A;  2ECV A;  4TKP B;  3LQI A;  1Z2Q A;  2VP7 A;  2ECT A;  2LV9 A;  1N87 A;  3KV6 A;  4C9Z A;  4AYC A;  2OXQ C;  2G43 A;  5KH7 A;  2LGG A;  4MVT A;  4NN2 A;  4UI9 B;  2MD8 C;  3RPG B;  5C11 A;  1WIL A;  1JOC A;  1WEW A;  4R2Y A;  2FUU A;  4UP5 A;  4A4B A;  2YU4 A;  3ZYQ A;  1MM3 A;  2L80 A;  4MSX A;  4LAD B;  4N4F A;  1FP0 A;  2FUI A;  2CSY A;  5H1U A;  3M62 A;  3SHB A;  1RMD A;  4I7D A;  4LJN A;  1V87 A;  3LRQ A;  2KWO A;  1WEM A;  2G45 A;  3N9Q A;  2VJF A;  2QJ0 A;  4V3K C;  4WZ0 A;  2VJE A;  5H1V A;  2MT5 A;  4S3O B;  1VD4 A;  3C5K A;  5B8D A;  4S3O C;  1HYJ A;  1G25 A;  1WEP A;  2ZET C;  2VPE A;  2MIQ A;  2YHO A;  2VPD A;  1CHC A;  1ZBD B;  3O35 A;  4FK5 A;  2KGG A;  2CKL B;  4GND A;  3L1Z B;  2KGI A;  2PNX A;  3O34 A;  2ECW A;  1MM2 A;  2RI7 A;  3HCU A;  4X3G A; 
#chains in the Genus database with same CATH topology
 1DVP A;  3FM8 C;  1K2F A;  4YAB A;  4FJC A;  4AVX A;  3SOW A;  2C2L A;  5FEY A;  2YW8 A;  5DKA A;  4YAX A;  2HYE D;  3SOX A;  3PLW A;  5LKU A;  3MHS A;  2FFW A;  2H0D A;  5SVI A;  3IHP A;  3SOU A;  2K1J A;  5B77 A;  1F62 A;  2EOD A;  3NG2 A;  1WEE A;  2XOY A;  2I50 A;  4PPE A;  2NAA A;  5H9M A;  3U5O A;  2M3H A;  4CCG X;  4LLB A;  4B86 C;  2YSJ A;  4WZ3 B;  1IYM A;  4BBQ A;  4F1P A;  1DCQ A;  5J3X A;  3T9K A;  4A49 A;  5D1M B;  1WEU A;  5B79 A;  4WA6 A;  2VPB A;  4GNG A;  2KWJ A;  3ZVZ B;  3O70 A;  3RPG C;  4Z0R A;  3ASL A;  4YC9 A;  5KH3 A;  4L58 A;  3PHD A;  2L5U A;  2CT2 A;  3N9M A;  4AP4 A;  5LKT A;  4IC3 A;  2IDA A;  5KH9 A;  4ZUX U;  5D1L B;  5AIU A;  2K16 A;  2LXP C;  2XEU A;  2Y43 A;  4AYC B;  3SUB A;  4QQ4 A;  2AN6 A;  1WFK A;  2KU3 A;  5JG6 A;  3KNV A;  4R7E A;  2M13 A;  2YVR A;  3U5P A;  1WEQ A;  3N9O A;  5C13 A;  3M7K A;  3U5N A;  5FB0 A;  2MA5 A;  2ECN A;  4I7C A;  3DDT A;  4BHW A;  4N3W A;  1WGM A;  1WEO A;  4W4U A;  4YBT A;  2MUM A;  4LKA A;  5B76 A;  2YQL A;  4PTB A;  2ECG A;  2EGM A;  3E2D A;  4YAT A;  4QF2 A;  3ZNI A;  2L0B A;  3M99 A;  1HYI A;  3DQV R;  2LXH C;  4ZDT A;  3ZPV 1;  3DWD A;  2E6S A;  4CA1 A;  4GNE A;  2LN0 A;  1T1H A;  1FBV A;  2KE1 A;  2VJF B;  3V43 A;  1JM7 B;  4UP0 A;  5G05 B;  2P57 A;  2KFT A;  2E6R A;  2HDP A;  2YUC A;  2DX8 A;  2FD4 A;  3QZV A;  3GL6 A;  2MD7 B;  3ZTG A;  4Z0O A;  5G0F A;  2F42 A;  2K4D A;  3C6W A;  1WIM A;  2FSA A;  2M85 A;  2MA6 A;  4B7Y C;  4L7X A;  2F6N A;  2OWA A;  3N9L A;  2YT5 A;  3KQI A;  3L11 A;  2XOZ A;  4V3L C;  3KV5 A;  3T6R A;  3GV4 A;  5FER A;  4A4C A;  3ZVY A;  4I7B A;  5I3L A;  2E61 A;  3ZPV E;  3Q1D A;  5LKZ A;  2UZG A;  3PUR A;  5LKX A;  2KYU A;  3O47 A;  5B78 A;  2M6M A;  1E4U A;  2KIZ A;  4A0C D;  3FL2 A;  2G6Q A;  2KWK A;  2LGL A;  2JRJ A;  3O37 A;  2YHN A;  1WEN A;  2LDR A;  4FO9 A;  4AUQ B;  4YBS A;  2YSM A;  3MDB C;  2ECJ A;  2RSD A;  4P5O B;  1LDJ B;  2H0D B;  5SVX A;  5D1K B;  3JUE A;  2KWN A;  3LVR E;  2YYR A;  3HCS A;  3U5M A;  1XWH A;  2ECI A;  3O33 A;  3L1X A;  3LQJ A;  2MNY A;  1BOR A;  5EYA F;  3PUQ A;  2QIC A;  3KDE C;  1X4I A;  4FIP A;  2RR4 A;  4GB0 A;  3HCT A;  2EGP A;  2LRI C;  3LVQ E;  2CRR A;  3MHH A;  3LJU X;  4F52 B;  1WE9 A;  2LQ6 A;  3O7A A;  2CSV A;  1VFY A;  3N9N A;  4O62 A;  3FJU B;  1MBM A;  1LDK C;  1Z60 A;  2KKY A;  2JMJ A;  2D8S A;  5LCW B;  3HTK C;  4IC2 A;  2QIZ A;  2YQM A;  3LQH A;  5AIT A;  5DIN A;  2VNF A;  2JM3 A;  5H1T A;  3M63 A;  3EB5 A;  2LGV A;  2L43 A;  4YBM A;  4LK9 A;  5G04 B;  2CKL A;  1U6G B;  2F6J A;  1JM7 A;  4XI1 A;  4Q6F A;  4O64 A;  4R8P K;  2XB1 A;  3FAN A;  2K17 A;  5FB1 A;  1WEV A;  4ZQL A;  4QF3 A;  1WES A;  3O36 A;  2KR4 A;  4WZ2 A;  4GNF A;  5TRB A;  2LGK A;  5B75 A;  1VYX A;  3DPL R;  2KKX A;  2VJE B;  2C2V S;  3T7L A;  2B0O E;  1X4U A;  1Z6U A;  2CSZ A;  2Y1M A;  2VPG A;  4YAD A;  3FEH A;  2CRW A;  3N9P A;  2MNZ A;  2M1R A;  2BAY A;  5TDR A;  5K3Q A;  2DSM A;  3VK6 A;  2JMI A;  2PUY A;  3I2D A;  1X4J A;  2EXU A;  3H7H A;  5TDW A;  2CON A;  3FAO A;  3EB6 A;  2EA6 A;  2Y1N A;  5TBN A;  3RTR B;  2L75 A;  5TAB A;  2KRE A;  2YUR A;  2YRE A;  2JMD A;  2ECV A;  4TKP B;  3LQI A;  1Z2Q A;  2VP7 A;  2ECT A;  2LV9 A;  1N87 A;  2MKE A;  3KV6 A;  4C9Z A;  4AYC A;  2OXQ C;  5SVI B;  2G43 A;  5KH7 A;  2LGG A;  4MVT A;  4NN2 A;  4UI9 B;  2MD8 C;  3RPG B;  5C11 A;  1WIL A;  1JOC A;  1WEW A;  3LDY A;  4R2Y A;  2JUN A;  2FUU A;  2XOC A;  4UP5 A;  4A4B A;  2YU4 A;  3ZYQ A;  1MM3 A;  2L80 A;  4MSX A;  4LAD B;  4N4F A;  1FP0 A;  2FUI A;  2CSY A;  5H1U A;  2D8U A;  3M62 A;  3SHB A;  1RMD A;  4I7D A;  4LJN A;  5SVY A;  1V87 A;  3LRQ A;  4H9D A;  4OGC A;  2DJA A;  2KWO A;  1WEM A;  2G45 A;  3N9Q A;  2VJF A;  4OGE A;  2XP0 A;  2QJ0 A;  4V3K C;  4WZ0 A;  2VJE A;  5H1V A;  2MT5 A;  4S3O B;  1VD4 A;  3C5K A;  5B8D A;  4S3O C;  1HYJ A;  2LAU A;  1G25 A;  1WEP A;  2ZET C;  2VPE A;  2MIQ A;  2YHO A;  2VPD A;  1CHC A;  2L7P A;  1ZBD B;  3O35 A;  4FK5 A;  2KGG A;  2CKL B;  4GND A;  3L1Z B;  2KGI A;  2PNX A;  2IQJ A;  3O34 A;  2ECW A;  1MM2 A;  2RI7 A;  3HCU A;  4X3G A; 
#chains in the Genus database with same CATH homology
 1DVP A;  1K2F A;  4YAB A;  4FJC A;  4AVX A;  3SOW A;  2C2L A;  5FEY A;  2YW8 A;  5DKA A;  4YAX A;  2HYE D;  3SOX A;  5LKU A;  3MHS A;  2H0D A;  3IHP A;  3SOU A;  2K1J A;  5B77 A;  1F62 A;  2EOD A;  3NG2 A;  1WEE A;  2I50 A;  4PPE A;  2NAA A;  5H9M A;  3U5O A;  2M3H A;  4CCG X;  4LLB A;  4B86 C;  2YSJ A;  4WZ3 B;  1IYM A;  4BBQ A;  5J3X A;  4A49 A;  5D1M B;  1WEU A;  5B79 A;  4WA6 A;  2VPB A;  4GNG A;  2KWJ A;  3ZVZ B;  3O70 A;  3RPG C;  3ASL A;  4YC9 A;  5KH3 A;  4L58 A;  3PHD A;  2L5U A;  2CT2 A;  3N9M A;  4AP4 A;  5LKT A;  4IC3 A;  2IDA A;  5KH9 A;  4ZUX U;  5D1L B;  5AIU A;  2K16 A;  2LXP C;  2XEU A;  2Y43 A;  4AYC B;  2AN6 A;  1WFK A;  2KU3 A;  5JG6 A;  3KNV A;  4R7E A;  3U5P A;  1WEQ A;  3N9O A;  5C13 A;  3U5N A;  5FB0 A;  2MA5 A;  2ECN A;  4I7C A;  4BHW A;  4N3W A;  1WGM A;  1WEO A;  4W4U A;  4YBT A;  2MUM A;  4LKA A;  5B76 A;  2YQL A;  4PTB A;  2ECG A;  4YAT A;  4QF2 A;  3ZNI A;  2L0B A;  3M99 A;  1HYI A;  3DQV R;  2LXH C;  4ZDT A;  3ZPV 1;  2E6S A;  4CA1 A;  4GNE A;  2LN0 A;  1T1H A;  1FBV A;  2KE1 A;  2VJF B;  3V43 A;  1JM7 B;  4UP0 A;  5G05 B;  2KFT A;  2E6R A;  2HDP A;  2YUC A;  2DX8 A;  3QZV A;  3GL6 A;  2MD7 B;  3ZTG A;  5G0F A;  2F42 A;  2K4D A;  3C6W A;  1WIM A;  2FSA A;  2M85 A;  2MA6 A;  4B7Y C;  4L7X A;  2F6N A;  3N9L A;  2YT5 A;  3KQI A;  3L11 A;  4V3L C;  3KV5 A;  3T6R A;  3GV4 A;  5FER A;  4A4C A;  3ZVY A;  4I7B A;  5I3L A;  3ZPV E;  5LKZ A;  2UZG A;  3PUR A;  5LKX A;  2KYU A;  5B78 A;  2M6M A;  1E4U A;  2KIZ A;  4A0C D;  3FL2 A;  2G6Q A;  2KWK A;  2LGL A;  2JRJ A;  3O37 A;  2YHN A;  1WEN A;  2LDR A;  4FO9 A;  4AUQ B;  4YBS A;  2YSM A;  2ECJ A;  2RSD A;  4P5O B;  1LDJ B;  2H0D B;  5D1K B;  2KWN A;  2YYR A;  3HCS A;  3U5M A;  1XWH A;  2ECI A;  3O33 A;  3L1X A;  3LQJ A;  2MNY A;  1BOR A;  5EYA F;  3PUQ A;  2QIC A;  1X4I A;  4FIP A;  4GB0 A;  3HCT A;  2EGP A;  2LRI C;  3MHH A;  4F52 B;  1WE9 A;  2LQ6 A;  3O7A A;  1VFY A;  3N9N A;  1LDK C;  1Z60 A;  2JMJ A;  2D8S A;  5LCW B;  3HTK C;  4IC2 A;  2QIZ A;  2YQM A;  3LQH A;  5AIT A;  5DIN A;  2VNF A;  5H1T A;  3M63 A;  3EB5 A;  2LGV A;  2L43 A;  4YBM A;  4LK9 A;  5G04 B;  2CKL A;  1U6G B;  2F6J A;  1JM7 A;  4XI1 A;  4Q6F A;  4O64 A;  4R8P K;  2XB1 A;  2K17 A;  5FB1 A;  1WEV A;  4ZQL A;  4QF3 A;  1WES A;  3O36 A;  2KR4 A;  4WZ2 A;  5TRB A;  4GNF A;  2LGK A;  5B75 A;  1VYX A;  3DPL R;  2VJE B;  2C2V S;  3T7L A;  1X4U A;  1Z6U A;  2CSZ A;  2Y1M A;  2VPG A;  4YAD A;  3N9P A;  2MNZ A;  2M1R A;  2BAY A;  5TDR A;  3VK6 A;  2JMI A;  2PUY A;  3I2D A;  1X4J A;  5TDW A;  3EB6 A;  2EA6 A;  2Y1N A;  5TBN A;  3RTR B;  2L75 A;  5TAB A;  2KRE A;  2YUR A;  2YRE A;  2JMD A;  2ECV A;  4TKP B;  3LQI A;  1Z2Q A;  2VP7 A;  2ECT A;  2LV9 A;  1N87 A;  3KV6 A;  4C9Z A;  4AYC A;  2OXQ C;  2G43 A;  5KH7 A;  2LGG A;  4MVT A;  4NN2 A;  4UI9 B;  2MD8 C;  3RPG B;  5C11 A;  1WIL A;  1JOC A;  1WEW A;  4R2Y A;  2FUU A;  4UP5 A;  4A4B A;  2YU4 A;  3ZYQ A;  1MM3 A;  2L80 A;  4MSX A;  4LAD B;  4N4F A;  1FP0 A;  2FUI A;  2CSY A;  5H1U A;  3M62 A;  3SHB A;  1RMD A;  4I7D A;  4LJN A;  1V87 A;  3LRQ A;  2KWO A;  1WEM A;  2G45 A;  3N9Q A;  2VJF A;  2QJ0 A;  4V3K C;  4WZ0 A;  2VJE A;  5H1V A;  2MT5 A;  4S3O B;  1VD4 A;  3C5K A;  5B8D A;  4S3O C;  1HYJ A;  1G25 A;  1WEP A;  2ZET C;  2VPE A;  2MIQ A;  2YHO A;  2VPD A;  1CHC A;  1ZBD B;  3O35 A;  4FK5 A;  2KGG A;  2CKL B;  4GND A;  3L1Z B;  2KGI A;  2PNX A;  3O34 A;  2ECW A;  1MM2 A;  2RI7 A;  3HCU A;  4X3G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...