2MA5A

Solution nmr structure of phd type zinc finger domain of lysine-specific demethylase 5b (plu-1/jarid1b) from homo sapiens, northeast structural genomics consortium (nesg) target hr7375c
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
61
structure length
61
Chain Sequence
SHMCPAVSCLQPEGDEVDWVQCDGSCNQWFHQVCVGVSPEMAEKEDYICVRCTVKDAPSRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of PHD type Zinc finger domain of Lysine-specific demethylase 5B (PLU-1/JARID1B) from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR7375C
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Lysine-specific demethylase 5B
total genus 11
structure length 61
sequence length 61
ec nomenclature ec 1.14.11.-:
pdb deposition date 2013-06-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2ma5A00
2KE1A 4GNDA 2Y1NA 3O35A 1WEQA 3SOWA 4AUQB 2KR4A 3C5KA 2KWKA 2EODA 2VJFA 2L75A 5JG6A 2LGKA 2G45A 3FL2A 4AVXA 4UP5A 2PNXA 5TRBA 5B77A 2KREA 1HYIA 2YHNA 3ASLA 3U5MA 1WFKA 1HYJA 3ZTGA 1Z2QA 4N3WA 4IC2A 2H0DA 2VJEB 3M63A 2XB1A 4FJCA 3RPGC 1IYMA 2ECGA 4YADA 2ECVA 4L58A 2KWNA 3N9NA 1Z6UA 1JOCA 2K1JA 1CHCA 3GV4A 2YUCA 3EB5A 2NAAA 5G0FA 4GB0A 4LK9A 4A4BA 4CCGX 3U5PA 3GL6A 5B76A 3IHPA 3KNVA 5LKXA 1BORA 1WEPA 3V43A 4YBMA 3C6WA 2L43A 5DINA 4YBTA 3T6RA 1WENA 2LXHC 3M62A 1VD4A 4CA1A 4C9ZA 2YQLA 2Y43A 3O33A 5H1VA 4A4CA 3RTRB 1RMDA 2DX8A 4F52B 1WEVA 4X3GA 2PUYA 2LRIC 2QICA 3ZPVE 3PURA 3LQJA 2RSDA 3O36A 2CKLB 2JMJA 4A0CD 5H1UA 3MHHA 2H0DB 2VJEA 3U5OA 2VNFA 1MM3A 2MD8C 3M99A 3I2DA 2M3HA 2CT2A 2YQMA 4I7BA 2VP7A 3L1XA 4V3LC 1MM2A 2LXPC 4LKAA 2KWJA 4LLBA 1DVPA 2LGGA 4YATA 2JMDA 2KU3A 4Q6FA 2EGPA 5I3LA 3ZYQA 3LRQA 2MT5A 1WEEA 4NN2A 4UI9B 1T1HA 4YABA 2FSAA 2MIQA 1X4UA 4L7XA 4AYCB 2LGVA 2I50A 4QF3A 2CSZA 2CKLA 4LADB 1U6GB 2E6RA 5LKTA 2C2VS 5C11A 3L11A 4XI1A 4B7YC 4I7CA 2JRJA 5FEYA 5AIUA 5EYAF 1Z60A 2LGLA 5FERA 2HYED 2MNZA 1X4IA 2RI7A 5D1LB 3ZVYA 4ZDTA 2LV9A 2UZGA 5LKZA 3SOXA 4N4FA 2M85A 2G43A 1WEMA 1ZBDB 4P5OB 4B86C 1N87A 2LN0A 2JMIA 2QIZA 4WZ0A 4BBQA 2YHOA 2LDRA 2K16A 2VPGA 4FIPA 5FB1A 5B78A 4WZ3B 2M6MA 5AITA 2HDPA 2E6SA 4R2YA 2VJFB 3DPLR 4A49A 4FK5A 3O37A 4YBSA 1X4JA 2VPBA 2F6NA 4BHWA 2LQ6A 3U5NA 4AYCA 2CSYA 2G6QA 1F62A 2ECTA 5FB0A 1JM7A 4ZUXU 4FO9A 2YREA 3O34A 3O70A 2YURA 3SHBA 1XWHA 3DQVR 4UP0A 3N9QA 2IDAA 5TABA 2YT5A 3KV5A 2MA5A 3N9PA 2MD7B 3O7AA 4V3KC 4MVTA 4GNFA 4WZ2A 4R8PK 2D8SA 2KWOA 5J3XA 2YSMA 3ZNIA 3L1ZB 2ECIA 2YYRA 3T7LA 2YSJA 3N9LA 2VPDA 2ECNA 4QF2A 5B75A 5H9MA 4GNEA 4MSXA 4IC3A 2C2LA 3N9MA 3LQHA 5TDWA 5D1KB 1WILA 4TKPB 1VFYA 3LQIA 2KGGA 2KFTA 2K4DA 2KYUA 2FUIA 1WE9A 4R7EA 2L5UA 2K17A 1V87A 2F6JA 2YW8A 1WESA 3HCSA 4WA6A 5TDRA 5KH7A 2Y1MA 1G25A 2AN6A 3HCUA 1WEOA 2L0BA 5G04B 1K2FA 3PUQA 3NG2A 4S3OB 4YAXA 1JM7B 5C13A 2KIZA 1E4UA 2OXQC 1FBVA 3PHDA 5B79A 2KGIA 3N9OA 1LDKC 2F42A 5LCWB 2L80A 4AP4A 1WIMA 3VK6A 4LJNA 1VYXA 5H1TA 4O64A 2BAYA 2FUUA 4YC9A 2YU4A 1FP0A 2QJ0A 3KQIA 4ZQLA 3SOUA 3RPGB 2ECJA 2VPEA 5KH3A 3KV6A 1WEWA 5G05B 3EB6A 5D1MB 3ZPV1 5TBNA 5DKAA 1LDJB 2EA6A 3HTKC 3ZVZB 2MNYA 4GNGA 4PPEA 3QZVA 1WEUA 5LKUA 5B8DA 2M1RA 3MHSA 2MA6A 3HCTA 2ECWA 4S3OC 5KH9A 2ZETC 2XEUA 2MUMA 1WGMA 4PTBA 4I7DA 4W4UA
chains in the Genus database with same CATH superfamily
2KE1A 3FANA 3T9KA 4GNDA 2Y1NA 3O35A 1WEQA 3SOWA 4AUQB 4Z0RA 2KR4A 3C5KA 2KWKA 2EODA 3DWDA 2VJFA 2L75A 5JG6A 2LGKA 2G45A 2L7PA 3FL2A 4AVXA 4UP5A 2KKYA 2PNXA 5TRBA 5B77A 2KREA 1HYIA 4O62A 2JM3A 2YHNA 3DDTA 3ASLA 3U5MA 1WFKA 1HYJA 3ZTGA 1Z2QA 4N3WA 2CRRA 4IC2A 2H0DA 2VJEB 3M63A 2XB1A 4FJCA 3RPGC 1IYMA 2ECGA 3LDYA 4YADA 2ECVA 4L58A 2KWNA 3N9NA 1Z6UA 1JOCA 2K1JA 1CHCA 3GV4A 2YUCA 3EB5A 2NAAA 5G0FA 4GB0A 4LK9A 4A4BA 4CCGX 3M7KA 2FFWA 3U5PA 3GL6A 5B76A 3IHPA 3KNVA 5LKXA 1BORA 1WEPA 3V43A 4YBMA 3FEHA 2XOZA 3C6WA 2L43A 3Q1DA 5DINA 4YBTA 3T6RA 1WENA 2LXHC 3M62A 1VD4A 5SVYA 4CA1A 4C9ZA 2YQLA 2Y43A 3O33A 5H1VA 4A4CA 3RTRB 1RMDA 2DX8A 4F52B 1WEVA 4X3GA 2EGMA 2FD4A 2PUYA 2LRIC 2QICA 3ZPVE 3PURA 3LQJA 2RSDA 3O36A 2CKLB 2JMJA 4A0CD 5H1UA 2EXUA 3MHHA 2H0DB 2VJEA 3U5OA 2VNFA 1MM3A 2MD8C 2JUNA 3M99A 3I2DA 2M3HA 2CT2A 4QQ4A 2YQMA 4I7BA 2VP7A 2B0OE 2YVRA 3L1XA 4V3LC 1MM2A 2LXPC 4LKAA 3MDBC 5SVIA 2KWJA 4LLBA 1DVPA 2LGGA 2E61A 2IQJA 4YATA 2JMDA 2KU3A 4Q6FA 4H9DA 2EGPA 5I3LA 3ZYQA 3LRQA 2MT5A 1WEEA 4NN2A 4UI9B 1T1HA 4YABA 2FSAA 4OGEA 2MIQA 1X4UA 4L7XA 4AYCB 2LGVA 1MBMA 2I50A 4QF3A 2CSZA 2CKLA 4LADB 2DSMA 1U6GB 2E6RA 5LKTA 2C2VS 5C11A 3L11A 4XI1A 4B7YC 4I7CA 2JRJA 2XOCA 5FEYA 5AIUA 5EYAF 1Z60A 2LGLA 5FERA 2HYED 2MNZA 1X4IA 2RI7A 5D1LB 4OGCA 3ZVYA 4ZDTA 2LV9A 2UZGA 5LKZA 3SOXA 4N4FA 2M85A 2G43A 1WEMA 5SVIB 1ZBDB 2CSVA 4P5OB 4B86C 1N87A 2P57A 2LN0A 2JMIA 2QIZA 4WZ0A 4BBQA 2YHOA 2LDRA 2K16A 2VPGA 4FIPA 5FB1A 3O47A 3JUEA 5B78A 4WZ3B 2CONA 2M6MA 5AITA 2HDPA 2E6SA 4R2YA 2VJFB 3DPLR 4A49A 4FK5A 2DJAA 3O37A 4YBSA 5SVXA 1X4JA 2VPBA 2F6NA 4BHWA 2LQ6A 3U5NA 4AYCA 2CSYA 2G6QA 1F62A 2ECTA 5FB0A 1JM7A 4ZUXU 4FO9A 2YREA 3O34A 3O70A 2YURA 3SHBA 1XWHA 3DQVR 4UP0A 3N9QA 2IDAA 3H7HA 2YT5A 5TABA 3KV5A 2MA5A 3N9PA 1DCQA 2MD7B 3O7AA 4V3KC 4MVTA 4GNFA 4WZ2A 4R8PK 2D8SA 2KWOA 5J3XA 2YSMA 3ZNIA 3L1ZB 2ECIA 2YYRA 3T7LA 2YSJA 3N9LA 4QF2A 2VPDA 2ECNA 3PLWA 5H9MA 4GNEA 5B75A 4MSXA 4IC3A 2C2LA 3N9MA 3LQHA 2CRWA 5TDWA 3FM8C 5D1KB 1WILA 4TKPB 1VFYA 2XOYA 3LQIA 2KGGA 2KFTA 2K4DA 2KYUA 2FUIA 1WE9A 4R7EA 2OWAA 2L5UA 3E2DA 2K17A 1V87A 2F6JA 2YW8A 1WESA 3HCSA 4WA6A 5TDRA 5KH7A 4F1PA 2Y1MA 1G25A 2AN6A 3HCUA 1WEOA 2L0BA 5G04B 1K2FA 3PUQA 3NG2A 4S3OB 4YAXA 1JM7B 5C13A 2KIZA 1E4UA 2OXQC 1FBVA 3LJUX 3PHDA 2M13A 5B79A 2KGIA 3N9OA 1LDKC 2F42A 5LCWB 2L80A 4AP4A 1WIMA 3VK6A 4LJNA 2KKXA 1VYXA 5H1TA 5K3QA 4O64A 2BAYA 2FUUA 4YC9A 2YU4A 2D8UA 1FP0A 3SUBA 2QJ0A 3KQIA 4ZQLA 3SOUA 3RPGB 2ECJA 2VPEA 5KH3A 3KV6A 1WEWA 2LAUA 3KDEC 5G05B 3EB6A 5D1MB 3ZPV1 5TBNA 5DKAA 3FJUB 1LDJB 2MKEA 2EA6A 3HTKC 3ZVZB 2MNYA 4GNGA 3FAOA 4PPEA 3QZVA 1WEUA 5LKUA 5B8DA 3LVRE 2M1RA 3MHSA 2MA6A 3HCTA 2ECWA 4S3OC 3LVQE 4Z0OA 2RR4A 5KH9A 2XP0A 2ZETC 2XEUA 2MUMA 1WGMA 4PTBA 4I7DA 4W4UA
chains in the Genus database with same CATH topology
2KE1A 4GNDA 2Y1NA 3O35A 1WEQA 3SOWA 4AUQB 2KR4A 3C5KA 2KWKA 2EODA 2VJFA 2L75A 5JG6A 2LGKA 2G45A 3FL2A 4AVXA 4UP5A 2PNXA 5TRBA 5B77A 2KREA 1HYIA 2YHNA 3ASLA 3U5MA 1WFKA 1HYJA 3ZTGA 1Z2QA 4N3WA 4IC2A 2H0DA 2VJEB 3M63A 2XB1A 4FJCA 3RPGC 1IYMA 2ECGA 4YADA 2ECVA 4L58A 2KWNA 3N9NA 1Z6UA 1JOCA 2K1JA 1CHCA 3GV4A 2YUCA 3EB5A 2NAAA 5G0FA 4GB0A 4LK9A 4A4BA 4CCGX 3U5PA 3GL6A 5B76A 3IHPA 3KNVA 5LKXA 1BORA 1WEPA 3V43A 4YBMA 3C6WA 2L43A 5DINA 4YBTA 3T6RA 1WENA 2LXHC 3M62A 1VD4A 4CA1A 4C9ZA 2YQLA 2Y43A 3O33A 5H1VA 4A4CA 3RTRB 1RMDA 2DX8A 4F52B 1WEVA 4X3GA 2PUYA 2LRIC 2QICA 3ZPVE 3PURA 3LQJA 2RSDA 3O36A 2CKLB 2JMJA 4A0CD 5H1UA 3MHHA 2H0DB 2VJEA 3U5OA 2VNFA 1MM3A 2MD8C 3M99A 3I2DA 2M3HA 2CT2A 2YQMA 4I7BA 2VP7A 3L1XA 4V3LC 1MM2A 2LXPC 4LKAA 2KWJA 4LLBA 1DVPA 2LGGA 4YATA 2JMDA 2KU3A 4Q6FA 2EGPA 5I3LA 3ZYQA 3LRQA 2MT5A 1WEEA 4NN2A 4UI9B 1T1HA 4YABA 2FSAA 2MIQA 1X4UA 4L7XA 4AYCB 2LGVA 2I50A 4QF3A 2CSZA 2CKLA 4LADB 1U6GB 2E6RA 5LKTA 2C2VS 5C11A 3L11A 4XI1A 4B7YC 4I7CA 2JRJA 5FEYA 5AIUA 5EYAF 1Z60A 2LGLA 5FERA 2HYED 2MNZA 1X4IA 2RI7A 5D1LB 3ZVYA 4ZDTA 2LV9A 2UZGA 5LKZA 3SOXA 4N4FA 2M85A 2G43A 1WEMA 1ZBDB 4P5OB 4B86C 1N87A 2LN0A 2JMIA 2QIZA 4WZ0A 4BBQA 2YHOA 2LDRA 2K16A 2VPGA 4FIPA 5FB1A 5B78A 4WZ3B 2M6MA 5AITA 2HDPA 2E6SA 4R2YA 2VJFB 3DPLR 4A49A 4FK5A 3O37A 4YBSA 1X4JA 2VPBA 2F6NA 4BHWA 2LQ6A 3U5NA 4AYCA 2CSYA 2G6QA 1F62A 2ECTA 5FB0A 1JM7A 4ZUXU 4FO9A 2YREA 3O34A 3O70A 2YURA 3SHBA 1XWHA 3DQVR 4UP0A 3N9QA 2IDAA 5TABA 2YT5A 3KV5A 2MA5A 3N9PA 2MD7B 3O7AA 4V3KC 4MVTA 4GNFA 4WZ2A 4R8PK 2D8SA 2KWOA 5J3XA 2YSMA 3ZNIA 3L1ZB 2ECIA 2YYRA 3T7LA 2YSJA 3N9LA 2VPDA 2ECNA 4QF2A 5B75A 5H9MA 4GNEA 4MSXA 4IC3A 2C2LA 3N9MA 3LQHA 5TDWA 5D1KB 1WILA 4TKPB 1VFYA 3LQIA 2KGGA 2KFTA 2K4DA 2KYUA 2FUIA 1WE9A 4R7EA 2L5UA 2K17A 1V87A 2F6JA 2YW8A 1WESA 3HCSA 4WA6A 5TDRA 5KH7A 2Y1MA 1G25A 2AN6A 3HCUA 1WEOA 2L0BA 5G04B 1K2FA 3PUQA 3NG2A 4S3OB 4YAXA 1JM7B 5C13A 2KIZA 1E4UA 2OXQC 1FBVA 3PHDA 5B79A 2KGIA 3N9OA 1LDKC 2F42A 5LCWB 2L80A 4AP4A 1WIMA 3VK6A 4LJNA 1VYXA 5H1TA 4O64A 2BAYA 2FUUA 4YC9A 2YU4A 1FP0A 2QJ0A 3KQIA 4ZQLA 3SOUA 3RPGB 2ECJA 2VPEA 5KH3A 3KV6A 1WEWA 5G05B 3EB6A 5D1MB 3ZPV1 5TBNA 5DKAA 1LDJB 2EA6A 3HTKC 3ZVZB 2MNYA 4GNGA 4PPEA 3QZVA 1WEUA 5LKUA 5B8DA 2M1RA 3MHSA 2MA6A 3HCTA 2ECWA 4S3OC 5KH9A 2ZETC 2XEUA 2MUMA 1WGMA 4PTBA 4I7DA 4W4UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KE1 A;  4GND A;  2Y1N A;  3O35 A;  1WEQ A;  3SOW A;  4AUQ B;  2KR4 A;  3C5K A;  2KWK A;  2EOD A;  2VJF A;  2L75 A;  5JG6 A;  2LGK A;  2G45 A;  3FL2 A;  4AVX A;  4UP5 A;  2PNX A;  5TRB A;  5B77 A;  2KRE A;  1HYI A;  2YHN A;  3ASL A;  3U5M A;  1WFK A;  1HYJ A;  3ZTG A;  1Z2Q A;  4N3W A;  4IC2 A;  2H0D A;  2VJE B;  3M63 A;  2XB1 A;  4FJC A;  3RPG C;  1IYM A;  2ECG A;  4YAD A;  2ECV A;  4L58 A;  2KWN A;  3N9N A;  1Z6U A;  1JOC A;  2K1J A;  1CHC A;  3GV4 A;  2YUC A;  3EB5 A;  2NAA A;  5G0F A;  4GB0 A;  4LK9 A;  4A4B A;  4CCG X;  3U5P A;  3GL6 A;  5B76 A;  3IHP A;  3KNV A;  5LKX A;  1BOR A;  1WEP A;  3V43 A;  4YBM A;  3C6W A;  2L43 A;  5DIN A;  4YBT A;  3T6R A;  1WEN A;  2LXH C;  3M62 A;  1VD4 A;  4CA1 A;  4C9Z A;  2YQL A;  2Y43 A;  3O33 A;  5H1V A;  4A4C A;  3RTR B;  1RMD A;  2DX8 A;  4F52 B;  1WEV A;  4X3G A;  2PUY A;  2LRI C;  2QIC A;  3ZPV E;  3PUR A;  3LQJ A;  2RSD A;  3O36 A;  2CKL B;  2JMJ A;  4A0C D;  5H1U A;  3MHH A;  2H0D B;  2VJE A;  3U5O A;  2VNF A;  1MM3 A;  2MD8 C;  3M99 A;  3I2D A;  2M3H A;  2CT2 A;  2YQM A;  4I7B A;  2VP7 A;  3L1X A;  4V3L C;  1MM2 A;  2LXP C;  4LKA A;  2KWJ A;  4LLB A;  1DVP A;  2LGG A;  4YAT A;  2JMD A;  2KU3 A;  4Q6F A;  2EGP A;  5I3L A;  3ZYQ A;  3LRQ A;  2MT5 A;  1WEE A;  4NN2 A;  4UI9 B;  1T1H A;  4YAB A;  2FSA A;  2MIQ A;  1X4U A;  4L7X A;  4AYC B;  2LGV A;  2I50 A;  4QF3 A;  2CSZ A;  2CKL A;  4LAD B;  1U6G B;  2E6R A;  5LKT A;  2C2V S;  5C11 A;  3L11 A;  4XI1 A;  4B7Y C;  4I7C A;  2JRJ A;  5FEY A;  5AIU A;  5EYA F;  1Z60 A;  2LGL A;  5FER A;  2HYE D;  2MNZ A;  1X4I A;  2RI7 A;  5D1L B;  3ZVY A;  4ZDT A;  2LV9 A;  2UZG A;  5LKZ A;  3SOX A;  4N4F A;  2M85 A;  2G43 A;  1WEM A;  1ZBD B;  4P5O B;  4B86 C;  1N87 A;  2LN0 A;  2JMI A;  2QIZ A;  4WZ0 A;  4BBQ A;  2YHO A;  2LDR A;  2K16 A;  2VPG A;  4FIP A;  5FB1 A;  5B78 A;  4WZ3 B;  2M6M A;  5AIT A;  2HDP A;  2E6S A;  4R2Y A;  2VJF B;  3DPL R;  4A49 A;  4FK5 A;  3O37 A;  4YBS A;  1X4J A;  2VPB A;  2F6N A;  4BHW A;  2LQ6 A;  3U5N A;  4AYC A;  2CSY A;  2G6Q A;  1F62 A;  2ECT A;  5FB0 A;  1JM7 A;  4ZUX U;  4FO9 A;  2YRE A;  3O34 A;  3O70 A;  2YUR A;  3SHB A;  1XWH A;  3DQV R;  4UP0 A;  3N9Q A;  2IDA A;  5TAB A;  2YT5 A;  3KV5 A;  2MA5 A;  3N9P A;  2MD7 B;  3O7A A;  4V3K C;  4MVT A;  4GNF A;  4WZ2 A;  4R8P K;  2D8S A;  2KWO A;  5J3X A;  2YSM A;  3ZNI A;  3L1Z B;  2ECI A;  2YYR A;  3T7L A;  2YSJ A;  3N9L A;  2VPD A;  2ECN A;  4QF2 A;  5B75 A;  5H9M A;  4GNE A;  4MSX A;  4IC3 A;  2C2L A;  3N9M A;  3LQH A;  5TDW A;  5D1K B;  1WIL A;  4TKP B;  1VFY A;  3LQI A;  2KGG A;  2KFT A;  2K4D A;  2KYU A;  2FUI A;  1WE9 A;  4R7E A;  2L5U A;  2K17 A;  1V87 A;  2F6J A;  2YW8 A;  1WES A;  3HCS A;  4WA6 A;  5TDR A;  5KH7 A;  2Y1M A;  1G25 A;  2AN6 A;  3HCU A;  1WEO A;  2L0B A;  5G04 B;  1K2F A;  3PUQ A;  3NG2 A;  4S3O B;  4YAX A;  1JM7 B;  5C13 A;  2KIZ A;  1E4U A;  2OXQ C;  1FBV A;  3PHD A;  5B79 A;  2KGI A;  3N9O A;  1LDK C;  2F42 A;  5LCW B;  2L80 A;  4AP4 A;  1WIM A;  3VK6 A;  4LJN A;  1VYX A;  5H1T A;  4O64 A;  2BAY A;  2FUU A;  4YC9 A;  2YU4 A;  1FP0 A;  2QJ0 A;  3KQI A;  4ZQL A;  3SOU A;  3RPG B;  2ECJ A;  2VPE A;  5KH3 A;  3KV6 A;  1WEW A;  5G05 B;  3EB6 A;  5D1M B;  3ZPV 1;  5TBN A;  5DKA A;  1LDJ B;  2EA6 A;  3HTK C;  3ZVZ B;  2MNY A;  4GNG A;  4PPE A;  3QZV A;  1WEU A;  5LKU A;  5B8D A;  2M1R A;  3MHS A;  2MA6 A;  3HCT A;  2ECW A;  4S3O C;  5KH9 A;  2ZET C;  2XEU A;  2MUM A;  1WGM A;  4PTB A;  4I7D A;  4W4U A; 
#chains in the Genus database with same CATH topology
 2KE1 A;  3FAN A;  3T9K A;  4GND A;  2Y1N A;  3O35 A;  1WEQ A;  3SOW A;  4AUQ B;  4Z0R A;  2KR4 A;  3C5K A;  2KWK A;  2EOD A;  3DWD A;  2VJF A;  2L75 A;  5JG6 A;  2LGK A;  2G45 A;  2L7P A;  3FL2 A;  4AVX A;  4UP5 A;  2KKY A;  2PNX A;  5TRB A;  5B77 A;  2KRE A;  1HYI A;  4O62 A;  2JM3 A;  2YHN A;  3DDT A;  3ASL A;  3U5M A;  1WFK A;  1HYJ A;  3ZTG A;  1Z2Q A;  4N3W A;  2CRR A;  4IC2 A;  2H0D A;  2VJE B;  3M63 A;  2XB1 A;  4FJC A;  3RPG C;  1IYM A;  2ECG A;  3LDY A;  4YAD A;  2ECV A;  4L58 A;  2KWN A;  3N9N A;  1Z6U A;  1JOC A;  2K1J A;  1CHC A;  3GV4 A;  2YUC A;  3EB5 A;  2NAA A;  5G0F A;  4GB0 A;  4LK9 A;  4A4B A;  4CCG X;  3M7K A;  2FFW A;  3U5P A;  3GL6 A;  5B76 A;  3IHP A;  3KNV A;  5LKX A;  1BOR A;  1WEP A;  3V43 A;  4YBM A;  3FEH A;  2XOZ A;  3C6W A;  2L43 A;  3Q1D A;  5DIN A;  4YBT A;  3T6R A;  1WEN A;  2LXH C;  3M62 A;  1VD4 A;  5SVY A;  4CA1 A;  4C9Z A;  2YQL A;  2Y43 A;  3O33 A;  5H1V A;  4A4C A;  3RTR B;  1RMD A;  2DX8 A;  4F52 B;  1WEV A;  4X3G A;  2EGM A;  2FD4 A;  2PUY A;  2LRI C;  2QIC A;  3ZPV E;  3PUR A;  3LQJ A;  2RSD A;  3O36 A;  2CKL B;  2JMJ A;  4A0C D;  5H1U A;  2EXU A;  3MHH A;  2H0D B;  2VJE A;  3U5O A;  2VNF A;  1MM3 A;  2MD8 C;  2JUN A;  3M99 A;  3I2D A;  2M3H A;  2CT2 A;  4QQ4 A;  2YQM A;  4I7B A;  2VP7 A;  2B0O E;  2YVR A;  3L1X A;  4V3L C;  1MM2 A;  2LXP C;  4LKA A;  3MDB C;  5SVI A;  2KWJ A;  4LLB A;  1DVP A;  2LGG A;  2E61 A;  2IQJ A;  4YAT A;  2JMD A;  2KU3 A;  4Q6F A;  4H9D A;  2EGP A;  5I3L A;  3ZYQ A;  3LRQ A;  2MT5 A;  1WEE A;  4NN2 A;  4UI9 B;  1T1H A;  4YAB A;  2FSA A;  4OGE A;  2MIQ A;  1X4U A;  4L7X A;  4AYC B;  2LGV A;  1MBM A;  2I50 A;  4QF3 A;  2CSZ A;  2CKL A;  4LAD B;  2DSM A;  1U6G B;  2E6R A;  5LKT A;  2C2V S;  5C11 A;  3L11 A;  4XI1 A;  4B7Y C;  4I7C A;  2JRJ A;  2XOC A;  5FEY A;  5AIU A;  5EYA F;  1Z60 A;  2LGL A;  5FER A;  2HYE D;  2MNZ A;  1X4I A;  2RI7 A;  5D1L B;  4OGC A;  3ZVY A;  4ZDT A;  2LV9 A;  2UZG A;  5LKZ A;  3SOX A;  4N4F A;  2M85 A;  2G43 A;  1WEM A;  5SVI B;  1ZBD B;  2CSV A;  4P5O B;  4B86 C;  1N87 A;  2P57 A;  2LN0 A;  2JMI A;  2QIZ A;  4WZ0 A;  4BBQ A;  2YHO A;  2LDR A;  2K16 A;  2VPG A;  4FIP A;  5FB1 A;  3O47 A;  3JUE A;  5B78 A;  4WZ3 B;  2CON A;  2M6M A;  5AIT A;  2HDP A;  2E6S A;  4R2Y A;  2VJF B;  3DPL R;  4A49 A;  4FK5 A;  2DJA A;  3O37 A;  4YBS A;  5SVX A;  1X4J A;  2VPB A;  2F6N A;  4BHW A;  2LQ6 A;  3U5N A;  4AYC A;  2CSY A;  2G6Q A;  1F62 A;  2ECT A;  5FB0 A;  1JM7 A;  4ZUX U;  4FO9 A;  2YRE A;  3O34 A;  3O70 A;  2YUR A;  3SHB A;  1XWH A;  3DQV R;  4UP0 A;  3N9Q A;  2IDA A;  3H7H A;  2YT5 A;  5TAB A;  3KV5 A;  2MA5 A;  3N9P A;  1DCQ A;  2MD7 B;  3O7A A;  4V3K C;  4MVT A;  4GNF A;  4WZ2 A;  4R8P K;  2D8S A;  2KWO A;  5J3X A;  2YSM A;  3ZNI A;  3L1Z B;  2ECI A;  2YYR A;  3T7L A;  2YSJ A;  3N9L A;  4QF2 A;  2VPD A;  2ECN A;  3PLW A;  5H9M A;  4GNE A;  5B75 A;  4MSX A;  4IC3 A;  2C2L A;  3N9M A;  3LQH A;  2CRW A;  5TDW A;  3FM8 C;  5D1K B;  1WIL A;  4TKP B;  1VFY A;  2XOY A;  3LQI A;  2KGG A;  2KFT A;  2K4D A;  2KYU A;  2FUI A;  1WE9 A;  4R7E A;  2OWA A;  2L5U A;  3E2D A;  2K17 A;  1V87 A;  2F6J A;  2YW8 A;  1WES A;  3HCS A;  4WA6 A;  5TDR A;  5KH7 A;  4F1P A;  2Y1M A;  1G25 A;  2AN6 A;  3HCU A;  1WEO A;  2L0B A;  5G04 B;  1K2F A;  3PUQ A;  3NG2 A;  4S3O B;  4YAX A;  1JM7 B;  5C13 A;  2KIZ A;  1E4U A;  2OXQ C;  1FBV A;  3LJU X;  3PHD A;  2M13 A;  5B79 A;  2KGI A;  3N9O A;  1LDK C;  2F42 A;  5LCW B;  2L80 A;  4AP4 A;  1WIM A;  3VK6 A;  4LJN A;  2KKX A;  1VYX A;  5H1T A;  5K3Q A;  4O64 A;  2BAY A;  2FUU A;  4YC9 A;  2YU4 A;  2D8U A;  1FP0 A;  3SUB A;  2QJ0 A;  3KQI A;  4ZQL A;  3SOU A;  3RPG B;  2ECJ A;  2VPE A;  5KH3 A;  3KV6 A;  1WEW A;  2LAU A;  3KDE C;  5G05 B;  3EB6 A;  5D1M B;  3ZPV 1;  5TBN A;  5DKA A;  3FJU B;  1LDJ B;  2MKE A;  2EA6 A;  3HTK C;  3ZVZ B;  2MNY A;  4GNG A;  3FAO A;  4PPE A;  3QZV A;  1WEU A;  5LKU A;  5B8D A;  3LVR E;  2M1R A;  3MHS A;  2MA6 A;  3HCT A;  2ECW A;  4S3O C;  3LVQ E;  4Z0O A;  2RR4 A;  5KH9 A;  2XP0 A;  2ZET C;  2XEU A;  2MUM A;  1WGM A;  4PTB A;  4I7D A;  4W4U A; 
#chains in the Genus database with same CATH homology
 2KE1 A;  4GND A;  2Y1N A;  3O35 A;  1WEQ A;  3SOW A;  4AUQ B;  2KR4 A;  3C5K A;  2KWK A;  2EOD A;  2VJF A;  2L75 A;  5JG6 A;  2LGK A;  2G45 A;  3FL2 A;  4AVX A;  4UP5 A;  2PNX A;  5TRB A;  5B77 A;  2KRE A;  1HYI A;  2YHN A;  3ASL A;  3U5M A;  1WFK A;  1HYJ A;  3ZTG A;  1Z2Q A;  4N3W A;  4IC2 A;  2H0D A;  2VJE B;  3M63 A;  2XB1 A;  4FJC A;  3RPG C;  1IYM A;  2ECG A;  4YAD A;  2ECV A;  4L58 A;  2KWN A;  3N9N A;  1Z6U A;  1JOC A;  2K1J A;  1CHC A;  3GV4 A;  2YUC A;  3EB5 A;  2NAA A;  5G0F A;  4GB0 A;  4LK9 A;  4A4B A;  4CCG X;  3U5P A;  3GL6 A;  5B76 A;  3IHP A;  3KNV A;  5LKX A;  1BOR A;  1WEP A;  3V43 A;  4YBM A;  3C6W A;  2L43 A;  5DIN A;  4YBT A;  3T6R A;  1WEN A;  2LXH C;  3M62 A;  1VD4 A;  4CA1 A;  4C9Z A;  2YQL A;  2Y43 A;  3O33 A;  5H1V A;  4A4C A;  3RTR B;  1RMD A;  2DX8 A;  4F52 B;  1WEV A;  4X3G A;  2PUY A;  2LRI C;  2QIC A;  3ZPV E;  3PUR A;  3LQJ A;  2RSD A;  3O36 A;  2CKL B;  2JMJ A;  4A0C D;  5H1U A;  3MHH A;  2H0D B;  2VJE A;  3U5O A;  2VNF A;  1MM3 A;  2MD8 C;  3M99 A;  3I2D A;  2M3H A;  2CT2 A;  2YQM A;  4I7B A;  2VP7 A;  3L1X A;  4V3L C;  1MM2 A;  2LXP C;  4LKA A;  2KWJ A;  4LLB A;  1DVP A;  2LGG A;  4YAT A;  2JMD A;  2KU3 A;  4Q6F A;  2EGP A;  5I3L A;  3ZYQ A;  3LRQ A;  2MT5 A;  1WEE A;  4NN2 A;  4UI9 B;  1T1H A;  4YAB A;  2FSA A;  2MIQ A;  1X4U A;  4L7X A;  4AYC B;  2LGV A;  2I50 A;  4QF3 A;  2CSZ A;  2CKL A;  4LAD B;  1U6G B;  2E6R A;  5LKT A;  2C2V S;  5C11 A;  3L11 A;  4XI1 A;  4B7Y C;  4I7C A;  2JRJ A;  5FEY A;  5AIU A;  5EYA F;  1Z60 A;  2LGL A;  5FER A;  2HYE D;  2MNZ A;  1X4I A;  2RI7 A;  5D1L B;  3ZVY A;  4ZDT A;  2LV9 A;  2UZG A;  5LKZ A;  3SOX A;  4N4F A;  2M85 A;  2G43 A;  1WEM A;  1ZBD B;  4P5O B;  4B86 C;  1N87 A;  2LN0 A;  2JMI A;  2QIZ A;  4WZ0 A;  4BBQ A;  2YHO A;  2LDR A;  2K16 A;  2VPG A;  4FIP A;  5FB1 A;  5B78 A;  4WZ3 B;  2M6M A;  5AIT A;  2HDP A;  2E6S A;  4R2Y A;  2VJF B;  3DPL R;  4A49 A;  4FK5 A;  3O37 A;  4YBS A;  1X4J A;  2VPB A;  2F6N A;  4BHW A;  2LQ6 A;  3U5N A;  4AYC A;  2CSY A;  2G6Q A;  1F62 A;  2ECT A;  5FB0 A;  1JM7 A;  4ZUX U;  4FO9 A;  2YRE A;  3O34 A;  3O70 A;  2YUR A;  3SHB A;  1XWH A;  3DQV R;  4UP0 A;  3N9Q A;  2IDA A;  5TAB A;  2YT5 A;  3KV5 A;  2MA5 A;  3N9P A;  2MD7 B;  3O7A A;  4V3K C;  4MVT A;  4GNF A;  4WZ2 A;  4R8P K;  2D8S A;  2KWO A;  5J3X A;  2YSM A;  3ZNI A;  3L1Z B;  2ECI A;  2YYR A;  3T7L A;  2YSJ A;  3N9L A;  2VPD A;  2ECN A;  4QF2 A;  5B75 A;  5H9M A;  4GNE A;  4MSX A;  4IC3 A;  2C2L A;  3N9M A;  3LQH A;  5TDW A;  5D1K B;  1WIL A;  4TKP B;  1VFY A;  3LQI A;  2KGG A;  2KFT A;  2K4D A;  2KYU A;  2FUI A;  1WE9 A;  4R7E A;  2L5U A;  2K17 A;  1V87 A;  2F6J A;  2YW8 A;  1WES A;  3HCS A;  4WA6 A;  5TDR A;  5KH7 A;  2Y1M A;  1G25 A;  2AN6 A;  3HCU A;  1WEO A;  2L0B A;  5G04 B;  1K2F A;  3PUQ A;  3NG2 A;  4S3O B;  4YAX A;  1JM7 B;  5C13 A;  2KIZ A;  1E4U A;  2OXQ C;  1FBV A;  3PHD A;  5B79 A;  2KGI A;  3N9O A;  1LDK C;  2F42 A;  5LCW B;  2L80 A;  4AP4 A;  1WIM A;  3VK6 A;  4LJN A;  1VYX A;  5H1T A;  4O64 A;  2BAY A;  2FUU A;  4YC9 A;  2YU4 A;  1FP0 A;  2QJ0 A;  3KQI A;  4ZQL A;  3SOU A;  3RPG B;  2ECJ A;  2VPE A;  5KH3 A;  3KV6 A;  1WEW A;  5G05 B;  3EB6 A;  5D1M B;  3ZPV 1;  5TBN A;  5DKA A;  1LDJ B;  2EA6 A;  3HTK C;  3ZVZ B;  2MNY A;  4GNG A;  4PPE A;  3QZV A;  1WEU A;  5LKU A;  5B8D A;  2M1R A;  3MHS A;  2MA6 A;  3HCT A;  2ECW A;  4S3O C;  5KH9 A;  2ZET C;  2XEU A;  2MUM A;  1WGM A;  4PTB A;  4I7D A;  4W4U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...