2MA5A

Solution nmr structure of phd type zinc finger domain of lysine-specific demethylase 5b (plu-1/jarid1b) from homo sapiens, northeast structural genomics consortium (nesg) target hr7375c
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
61
structure length
61
Chain Sequence
b'SHMCPAVSCLQPEGDEVDWVQCDGSCNQWFHQVCVGVSPEMAEKEDYICVRCTVKDAPSRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysine-specific demethylase 5B
publication title Solution NMR structure of PHD type Zinc finger domain of Lysine-specific demethylase 5B (PLU-1/JARID1B) from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR7375C
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 11
structure length 61
sequence length 61
ec nomenclature ec 1.14.11.-:
pdb deposition date 2013-06-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2ma5A00
4WZ0A 5DINA 1FBVA 5I3LA 1E4UA 3LQJA 2F6JA 2Y1NA 2LGLA 2M6MA 3HCUA 3PHDA 2YQLA 4MSXA 2LGKA 4W4UA 2G45A 3N9NA 2MD8C 3N9LA 4LK9A 4AUQB 1T1HA 3SOXA 2KWKA 2C2LA 1U6GB 2LDRA 3RTRB 5TBNA 2HDPA 1VYXA 1WENA 3ASLA 2H0DB 2M1RA 3MHHA 4LKAA 3HCTA 2VJFB 3RPGB 3N9MA 3HTKC 1LDJB 4AYCA 4I7CA 2UZGA 2VJEA 4ZUXU 3NG2A 1VD4A 2FSAA 4MVTA 2K1JA 4A0CD 2KGGA 2KYUA 2YURA 3RPGC 4YADA 4FK5A 3C5KA 2C2VS 2CKLB 2LN0A 5AITA 2YHNA 3HCSA 5TRBA 2L0BA 1WESA 2L43A 5D1KB 5KH7A 3FL2A 4YBSA 3EB5A 3IHPA 2LXHC 2VP7A 2YREA 3T6RA 4C9ZA 1HYIA 4IC2A 1JM7A 5KH9A 1XWHA 4P5OB 5LKZA 2CSZA 3U5MA 5H1VA 2JMDA 5G04B 4BBQA 4V3KC 2EA6A 4WZ2A 2NAAA 2CSYA 4AYCB 2VJEB 2VNFA 2VPDA 2MD7B 5JG6A 2VPEA 4YATA 3ZPV1 2G6QA 2VPGA 1HYJA 2KIZA 4A49A 1X4JA 2LGVA 4FIPA 2KWJA 2YQMA 2MT5A 4PPEA 2D8SA 2YUCA 1WEMA 5B8DA 1WEUA 4LADB 2L80A 5H1TA 4GNDA 1JOCA 4CCGX 2MA5A 1WEVA 5D1MB 3SOUA 1WEEA 4LLBA 2FUIA 4S3OB 2YHOA 3N9QA 4AVXA 3QZVA 3M63A 2AN6A 1JM7B 2PUYA 4S3OC 3KQIA 2F6NA 1WEOA 4UI9B 5B78A 4CA1A 4QF2A 2I50A 2MIQA 3SHBA 2ECTA 2JMJA 3U5PA 5AIUA 4L58A 4L7XA 1Z2QA 3O34A 3C6WA 2Y43A 4GNEA 2QJ0A 2IDAA 5B75A 4A4CA 1K2FA 2K17A 3MHSA 5C13A 3U5NA 1Z6UA 2G43A 3O70A 2LRIC 4O64A 4R8PK 2KREA 4B7YC 5C11A 2ECWA 2KFTA 1WE9A 2JMIA 2EODA 1WFKA 5TDWA 2L75A 4V3LC 3DQVR 3LQIA 4WZ3B 2OXQC 2YW8A 3O7AA 2YSMA 3DPLR 4YBTA 3LQHA 2KWNA 3L11A 1X4IA 1N87A 5DKAA 4GNGA 4IC3A 3T7LA 2H0DA 4R2YA 4ZQLA 2KGIA 2QIZA 2DX8A 4UP5A 4F52B 3U5OA 1F62A 3L1XA 2KE1A 2ECNA 3O35A 5FB1A 2ZETC 1WGMA 1MM2A 4ZDTA 1X4UA 2E6SA 2BAYA 2MA6A 3ZPVE 4N4FA 5LKUA 2YSJA 1DVPA 1G25A 4A4BA 4I7BA 4Q6FA 3SOWA 2ECJA 2VPBA 5H9MA 2HYED 2MUMA 2K4DA 4YAXA 1WEQA 5FB0A 3VK6A 1Z60A 2Y1MA 4FJCA 2LXPC 2QICA 4N3WA 4I7DA 3N9OA 4BHWA 4LJNA 4GB0A 5D1LB 4YABA 4AP4A 4X3GA 2RSDA 1WEWA 2XB1A 5EYAF 4WA6A 1WILA 4UP0A 4PTBA 3I2DA 5LCWB 3GV4A 2MNZA 2XEUA 5B79A 5LKXA 3GL6A 2LQ6A 3O36A 1WEPA 2YT5A 5TABA 4NN2A 3ZTGA 3L1ZB 5FERA 5G05B 3KV6A 4FO9A 2K16A 5FEYA 1LDKC 3LRQA 5H1UA 3N9PA 2MNYA 5B77A 3KV5A 5TDRA 3PUQA 2E6RA 5B76A 4XI1A 3ZVZB 2YU4A 3V43A 2L5UA 2FUUA 2KU3A 1CHCA 2PNXA 2RI7A 1MM3A 2F42A 2YYRA 2CT2A 4YBMA 3ZVYA 1IYMA 3KNVA 2M85A 2VJFA 1RMDA 1WIMA 2ECIA 1ZBDB 1FP0A 2JRJA 5G0FA 3ZYQA 4B86C 2LV9A 1VFYA 4QF3A 3ZNIA 5LKTA 2KWOA 5KH3A 2ECGA 4TKPB 4GNFA 2KR4A 3M62A 3PURA 3EB6A 2LGGA 4YC9A 4R7EA 5J3XA 2CKLA 1BORA 2ECVA 3O37A 2EGPA 2M3HA 3O33A 1V87A 3M99A
chains in the Genus database with same CATH superfamily
2M13A 4WZ0A 1FBVA 5DINA 5I3LA 1E4UA 3LQJA 2F6JA 2Y1NA 2LGLA 4Z0OA 2M6MA 3HCUA 3PHDA 2YQLA 4MSXA 2LGKA 4W4UA 2G45A 3N9NA 2MD8C 2E61A 3N9LA 4LK9A 4AUQB 1T1HA 3SOXA 2XP0A 2DSMA 2KWKA 2C2LA 1U6GB 2LDRA 3RTRB 2EXUA 5TBNA 2HDPA 1VYXA 3LVQE 1WENA 3ASLA 2FD4A 2H0DB 2M1RA 3MHHA 4Z0RA 4LKAA 2XOZA 3HCTA 2VJFB 3RPGB 3N9MA 3DDTA 3HTKC 1LDJB 4AYCA 4I7CA 2UZGA 2VJEA 4F1PA 2JM3A 4ZUXU 3NG2A 1VD4A 2FSAA 4MVTA 2CRWA 2K1JA 4A0CD 2KGGA 2KYUA 2YURA 2KKYA 3RPGC 4YADA 4FK5A 3C5KA 2C2VS 2CKLB 5SVXA 2LN0A 5AITA 2YHNA 3HCSA 5TRBA 2L0BA 1WESA 2L43A 5D1KB 5KH7A 3FL2A 4YBSA 3EB5A 2MKEA 3FEHA 3IHPA 2LXHC 2VP7A 2YREA 3T6RA 4C9ZA 1HYIA 4IC2A 4O62A 1JM7A 5KH9A 4P5OB 1XWHA 1MBMA 2XOCA 5LKZA 2CSZA 3LVRE 3U5MA 5H1VA 2JMDA 5G04B 4BBQA 4V3KC 2EA6A 4WZ2A 2NAAA 3H7HA 2CSYA 4AYCB 2VJEB 2VNFA 2VPDA 2MD7B 5JG6A 2VPEA 4YATA 3ZPV1 3JUEA 2G6QA 2VPGA 1HYJA 2KIZA 4A49A 1X4JA 2LGVA 4FIPA 2KWJA 3LDYA 2YQMA 2MT5A 5K3QA 4PPEA 2EGMA 2D8SA 2LAUA 2YUCA 1WEMA 5B8DA 1WEUA 4LADB 2L80A 3T9KA 4GNDA 5H1TA 1JOCA 4CCGX 2MA5A 1WEVA 5D1MB 3DWDA 3SOUA 1WEEA 4LLBA 2FUIA 4S3OB 2YHOA 3N9QA 4AVXA 3QZVA 3M63A 2AN6A 1JM7B 2PUYA 4S3OC 3FAOA 3KQIA 2F6NA 1WEOA 4UI9B 5B78A 4CA1A 4QF2A 2I50A 2MIQA 3SHBA 4OGEA 2ECTA 2JMJA 3U5PA 4H9DA 5AIUA 4L58A 4L7XA 1Z2QA 3O34A 3C6WA 2Y43A 4GNEA 2QJ0A 2DJAA 2IDAA 5B75A 4A4CA 1K2FA 2K17A 3FJUB 3O47A 3MHSA 5C13A 3U5NA 1Z6UA 2G43A 3LJUX 3O70A 2LRIC 4O64A 4R8PK 2KREA 2B0OE 4B7YC 5C11A 2ECWA 2KFTA 1WE9A 2JMIA 2EODA 1WFKA 5TDWA 2L75A 4V3LC 3DQVR 3LQIA 4WZ3B 2OXQC 2YW8A 3O7AA 2YSMA 3DPLR 4YBTA 3LQHA 2KWNA 3L11A 1X4IA 1N87A 5DKAA 4GNGA 1DCQA 4IC3A 3T7LA 2JUNA 2H0DA 4R2YA 4ZQLA 2KGIA 2QIZA 2DX8A 4UP5A 4F52B 3U5OA 1F62A 3L1XA 2KE1A 2ECNA 2CRRA 3O35A 5FB1A 2ZETC 1WGMA 2P57A 2YVRA 1MM2A 4ZDTA 1X4UA 2E6SA 2BAYA 2MA6A 3ZPVE 3M7KA 4N4FA 5LKUA 2YSJA 1DVPA 1G25A 4A4BA 4I7BA 4Q6FA 3SOWA 2ECJA 2VPBA 5H9MA 2HYED 2MUMA 2K4DA 4YAXA 1WEQA 5FB0A 3VK6A 1Z60A 2Y1MA 4FJCA 2LXPC 2QICA 4N3WA 4I7DA 3N9OA 4BHWA 3MDBC 4LJNA 4GB0A 5D1LB 4YABA 4AP4A 4X3GA 2RSDA 1WEWA 2XB1A 5EYAF 4WA6A 1WILA 4UP0A 4PTBA 3I2DA 2IQJA 5LCWB 3GV4A 2MNZA 2XEUA 5B79A 5SVIA 5LKXA 3GL6A 2LQ6A 3O36A 1WEPA 2YT5A 5TABA 2XOYA 4NN2A 3ZTGA 3L1ZB 5FERA 4QQ4A 3Q1DA 5G05B 3KV6A 4FO9A 2K16A 5FEYA 3SUBA 1LDKC 3LRQA 5H1UA 3N9PA 2MNYA 5B77A 3KDEC 3KV5A 5TDRA 3FM8C 2D8UA 5SVYA 3PUQA 2E6RA 5B76A 4XI1A 2L7PA 3ZVZB 2YU4A 3E2DA 3V43A 3FANA 2L5UA 2FUUA 2KU3A 1CHCA 2PNXA 2RI7A 1MM3A 2F42A 2YYRA 2CT2A 4YBMA 2CONA 3PLWA 3ZVYA 1IYMA 3KNVA 2M85A 2VJFA 1RMDA 1WIMA 2ECIA 1ZBDB 1FP0A 2JRJA 5G0FA 3ZYQA 4B86C 2LV9A 1VFYA 2CSVA 4QF3A 3ZNIA 5LKTA 2KWOA 5KH3A 2ECGA 4TKPB 4GNFA 5SVIB 2KR4A 3M62A 3PURA 3EB6A 2FFWA 2LGGA 4YC9A 4R7EA 2OWAA 2KKXA 4OGCA 5J3XA 2CKLA 1BORA 2ECVA 3O37A 2EGPA 2M3HA 3O33A 1V87A 2RR4A 3M99A
chains in the Genus database with same CATH topology
4WZ0A 5DINA 1FBVA 5I3LA 1E4UA 3LQJA 2F6JA 2Y1NA 2LGLA 2M6MA 3HCUA 3PHDA 2YQLA 4MSXA 2LGKA 4W4UA 2G45A 3N9NA 2MD8C 3N9LA 4LK9A 4AUQB 1T1HA 3SOXA 2KWKA 2C2LA 1U6GB 2LDRA 3RTRB 5TBNA 2HDPA 1VYXA 1WENA 3ASLA 2H0DB 2M1RA 3MHHA 4LKAA 3HCTA 2VJFB 3RPGB 3N9MA 3HTKC 1LDJB 4AYCA 4I7CA 2UZGA 2VJEA 4ZUXU 3NG2A 1VD4A 2FSAA 4MVTA 2K1JA 4A0CD 2KGGA 2KYUA 2YURA 3RPGC 4YADA 4FK5A 3C5KA 2C2VS 2CKLB 2LN0A 5AITA 2YHNA 3HCSA 5TRBA 2L0BA 1WESA 2L43A 5D1KB 5KH7A 3FL2A 4YBSA 3EB5A 3IHPA 2LXHC 2VP7A 2YREA 3T6RA 4C9ZA 1HYIA 4IC2A 1JM7A 5KH9A 1XWHA 4P5OB 5LKZA 2CSZA 3U5MA 5H1VA 2JMDA 5G04B 4BBQA 4V3KC 2EA6A 4WZ2A 2NAAA 2CSYA 4AYCB 2VJEB 2VNFA 2VPDA 2MD7B 5JG6A 2VPEA 4YATA 3ZPV1 2G6QA 2VPGA 1HYJA 2KIZA 4A49A 1X4JA 2LGVA 4FIPA 2KWJA 2YQMA 2MT5A 4PPEA 2D8SA 2YUCA 1WEMA 5B8DA 1WEUA 4LADB 2L80A 5H1TA 4GNDA 1JOCA 4CCGX 2MA5A 1WEVA 5D1MB 3SOUA 1WEEA 4LLBA 2FUIA 4S3OB 2YHOA 3N9QA 4AVXA 3QZVA 3M63A 2AN6A 1JM7B 2PUYA 4S3OC 3KQIA 2F6NA 1WEOA 4UI9B 5B78A 4CA1A 4QF2A 2I50A 2MIQA 3SHBA 2ECTA 2JMJA 3U5PA 5AIUA 4L58A 4L7XA 1Z2QA 3O34A 3C6WA 2Y43A 4GNEA 2QJ0A 2IDAA 5B75A 4A4CA 1K2FA 2K17A 3MHSA 5C13A 3U5NA 1Z6UA 2G43A 3O70A 2LRIC 4O64A 4R8PK 2KREA 4B7YC 5C11A 2ECWA 2KFTA 1WE9A 2JMIA 2EODA 1WFKA 5TDWA 2L75A 4V3LC 3DQVR 3LQIA 4WZ3B 2OXQC 2YW8A 3O7AA 2YSMA 3DPLR 4YBTA 3LQHA 2KWNA 3L11A 1X4IA 1N87A 5DKAA 4GNGA 4IC3A 3T7LA 2H0DA 4R2YA 4ZQLA 2KGIA 2QIZA 2DX8A 4UP5A 4F52B 3U5OA 1F62A 3L1XA 2KE1A 2ECNA 3O35A 5FB1A 2ZETC 1WGMA 1MM2A 4ZDTA 1X4UA 2E6SA 2BAYA 2MA6A 3ZPVE 4N4FA 5LKUA 2YSJA 1DVPA 1G25A 4A4BA 4I7BA 4Q6FA 3SOWA 2ECJA 2VPBA 5H9MA 2HYED 2MUMA 2K4DA 4YAXA 1WEQA 5FB0A 3VK6A 1Z60A 2Y1MA 4FJCA 2LXPC 2QICA 4N3WA 4I7DA 3N9OA 4BHWA 4LJNA 4GB0A 5D1LB 4YABA 4AP4A 4X3GA 2RSDA 1WEWA 2XB1A 5EYAF 4WA6A 1WILA 4UP0A 4PTBA 3I2DA 5LCWB 3GV4A 2MNZA 2XEUA 5B79A 5LKXA 3GL6A 2LQ6A 3O36A 1WEPA 2YT5A 5TABA 4NN2A 3ZTGA 3L1ZB 5FERA 5G05B 3KV6A 4FO9A 2K16A 5FEYA 1LDKC 3LRQA 5H1UA 3N9PA 2MNYA 5B77A 3KV5A 5TDRA 3PUQA 2E6RA 5B76A 4XI1A 3ZVZB 2YU4A 3V43A 2L5UA 2FUUA 2KU3A 1CHCA 2PNXA 2RI7A 1MM3A 2F42A 2YYRA 2CT2A 4YBMA 3ZVYA 1IYMA 3KNVA 2M85A 2VJFA 1RMDA 1WIMA 2ECIA 1ZBDB 1FP0A 2JRJA 5G0FA 3ZYQA 4B86C 2LV9A 1VFYA 4QF3A 3ZNIA 5LKTA 2KWOA 5KH3A 2ECGA 4TKPB 4GNFA 2KR4A 3M62A 3PURA 3EB6A 2LGGA 4YC9A 4R7EA 5J3XA 2CKLA 1BORA 2ECVA 3O37A 2EGPA 2M3HA 3O33A 1V87A 3M99A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WZ0 A;  5DIN A;  1FBV A;  5I3L A;  1E4U A;  3LQJ A;  2F6J A;  2Y1N A;  2LGL A;  2M6M A;  3HCU A;  3PHD A;  2YQL A;  4MSX A;  2LGK A;  4W4U A;  2G45 A;  3N9N A;  2MD8 C;  3N9L A;  4LK9 A;  4AUQ B;  1T1H A;  3SOX A;  2KWK A;  2C2L A;  1U6G B;  2LDR A;  3RTR B;  5TBN A;  2HDP A;  1VYX A;  1WEN A;  3ASL A;  2H0D B;  2M1R A;  3MHH A;  4LKA A;  3HCT A;  2VJF B;  3RPG B;  3N9M A;  3HTK C;  1LDJ B;  4AYC A;  4I7C A;  2UZG A;  2VJE A;  4ZUX U;  3NG2 A;  1VD4 A;  2FSA A;  4MVT A;  2K1J A;  4A0C D;  2KGG A;  2KYU A;  2YUR A;  3RPG C;  4YAD A;  4FK5 A;  3C5K A;  2C2V S;  2CKL B;  2LN0 A;  5AIT A;  2YHN A;  3HCS A;  5TRB A;  2L0B A;  1WES A;  2L43 A;  5D1K B;  5KH7 A;  3FL2 A;  4YBS A;  3EB5 A;  3IHP A;  2LXH C;  2VP7 A;  2YRE A;  3T6R A;  4C9Z A;  1HYI A;  4IC2 A;  1JM7 A;  5KH9 A;  1XWH A;  4P5O B;  5LKZ A;  2CSZ A;  3U5M A;  5H1V A;  2JMD A;  5G04 B;  4BBQ A;  4V3K C;  2EA6 A;  4WZ2 A;  2NAA A;  2CSY A;  4AYC B;  2VJE B;  2VNF A;  2VPD A;  2MD7 B;  5JG6 A;  2VPE A;  4YAT A;  3ZPV 1;  2G6Q A;  2VPG A;  1HYJ A;  2KIZ A;  4A49 A;  1X4J A;  2LGV A;  4FIP A;  2KWJ A;  2YQM A;  2MT5 A;  4PPE A;  2D8S A;  2YUC A;  1WEM A;  5B8D A;  1WEU A;  4LAD B;  2L80 A;  5H1T A;  4GND A;  1JOC A;  4CCG X;  2MA5 A;  1WEV A;  5D1M B;  3SOU A;  1WEE A;  4LLB A;  2FUI A;  4S3O B;  2YHO A;  3N9Q A;  4AVX A;  3QZV A;  3M63 A;  2AN6 A;  1JM7 B;  2PUY A;  4S3O C;  3KQI A;  2F6N A;  1WEO A;  4UI9 B;  5B78 A;  4CA1 A;  4QF2 A;  2I50 A;  2MIQ A;  3SHB A;  2ECT A;  2JMJ A;  3U5P A;  5AIU A;  4L58 A;  4L7X A;  1Z2Q A;  3O34 A;  3C6W A;  2Y43 A;  4GNE A;  2QJ0 A;  2IDA A;  5B75 A;  4A4C A;  1K2F A;  2K17 A;  3MHS A;  5C13 A;  3U5N A;  1Z6U A;  2G43 A;  3O70 A;  2LRI C;  4O64 A;  4R8P K;  2KRE A;  4B7Y C;  5C11 A;  2ECW A;  2KFT A;  1WE9 A;  2JMI A;  2EOD A;  1WFK A;  5TDW A;  2L75 A;  4V3L C;  3DQV R;  3LQI A;  4WZ3 B;  2OXQ C;  2YW8 A;  3O7A A;  2YSM A;  3DPL R;  4YBT A;  3LQH A;  2KWN A;  3L11 A;  1X4I A;  1N87 A;  5DKA A;  4GNG A;  4IC3 A;  3T7L A;  2H0D A;  4R2Y A;  4ZQL A;  2KGI A;  2QIZ A;  2DX8 A;  4UP5 A;  4F52 B;  3U5O A;  1F62 A;  3L1X A;  2KE1 A;  2ECN A;  3O35 A;  5FB1 A;  2ZET C;  1WGM A;  1MM2 A;  4ZDT A;  1X4U A;  2E6S A;  2BAY A;  2MA6 A;  3ZPV E;  4N4F A;  5LKU A;  2YSJ A;  1DVP A;  1G25 A;  4A4B A;  4I7B A;  4Q6F A;  3SOW A;  2ECJ A;  2VPB A;  5H9M A;  2HYE D;  2MUM A;  2K4D A;  4YAX A;  1WEQ A;  5FB0 A;  3VK6 A;  1Z60 A;  2Y1M A;  4FJC A;  2LXP C;  2QIC A;  4N3W A;  4I7D A;  3N9O A;  4BHW A;  4LJN A;  4GB0 A;  5D1L B;  4YAB A;  4AP4 A;  4X3G A;  2RSD A;  1WEW A;  2XB1 A;  5EYA F;  4WA6 A;  1WIL A;  4UP0 A;  4PTB A;  3I2D A;  5LCW B;  3GV4 A;  2MNZ A;  2XEU A;  5B79 A;  5LKX A;  3GL6 A;  2LQ6 A;  3O36 A;  1WEP A;  2YT5 A;  5TAB A;  4NN2 A;  3ZTG A;  3L1Z B;  5FER A;  5G05 B;  3KV6 A;  4FO9 A;  2K16 A;  5FEY A;  1LDK C;  3LRQ A;  5H1U A;  3N9P A;  2MNY A;  5B77 A;  3KV5 A;  5TDR A;  3PUQ A;  2E6R A;  5B76 A;  4XI1 A;  3ZVZ B;  2YU4 A;  3V43 A;  2L5U A;  2FUU A;  2KU3 A;  1CHC A;  2PNX A;  2RI7 A;  1MM3 A;  2F42 A;  2YYR A;  2CT2 A;  4YBM A;  3ZVY A;  1IYM A;  3KNV A;  2M85 A;  2VJF A;  1RMD A;  1WIM A;  2ECI A;  1ZBD B;  1FP0 A;  2JRJ A;  5G0F A;  3ZYQ A;  4B86 C;  2LV9 A;  1VFY A;  4QF3 A;  3ZNI A;  5LKT A;  2KWO A;  5KH3 A;  2ECG A;  4TKP B;  4GNF A;  2KR4 A;  3M62 A;  3PUR A;  3EB6 A;  2LGG A;  4YC9 A;  4R7E A;  5J3X A;  2CKL A;  1BOR A;  2ECV A;  3O37 A;  2EGP A;  2M3H A;  3O33 A;  1V87 A;  3M99 A; 
#chains in the Genus database with same CATH topology
 2M13 A;  4WZ0 A;  1FBV A;  5DIN A;  5I3L A;  1E4U A;  3LQJ A;  2F6J A;  2Y1N A;  2LGL A;  4Z0O A;  2M6M A;  3HCU A;  3PHD A;  2YQL A;  4MSX A;  2LGK A;  4W4U A;  2G45 A;  3N9N A;  2MD8 C;  2E61 A;  3N9L A;  4LK9 A;  4AUQ B;  1T1H A;  3SOX A;  2XP0 A;  2DSM A;  2KWK A;  2C2L A;  1U6G B;  2LDR A;  3RTR B;  2EXU A;  5TBN A;  2HDP A;  1VYX A;  3LVQ E;  1WEN A;  3ASL A;  2FD4 A;  2H0D B;  2M1R A;  3MHH A;  4Z0R A;  4LKA A;  2XOZ A;  3HCT A;  2VJF B;  3RPG B;  3N9M A;  3DDT A;  3HTK C;  1LDJ B;  4AYC A;  4I7C A;  2UZG A;  2VJE A;  4F1P A;  2JM3 A;  4ZUX U;  3NG2 A;  1VD4 A;  2FSA A;  4MVT A;  2CRW A;  2K1J A;  4A0C D;  2KGG A;  2KYU A;  2YUR A;  2KKY A;  3RPG C;  4YAD A;  4FK5 A;  3C5K A;  2C2V S;  2CKL B;  5SVX A;  2LN0 A;  5AIT A;  2YHN A;  3HCS A;  5TRB A;  2L0B A;  1WES A;  2L43 A;  5D1K B;  5KH7 A;  3FL2 A;  4YBS A;  3EB5 A;  2MKE A;  3FEH A;  3IHP A;  2LXH C;  2VP7 A;  2YRE A;  3T6R A;  4C9Z A;  1HYI A;  4IC2 A;  4O62 A;  1JM7 A;  5KH9 A;  4P5O B;  1XWH A;  1MBM A;  2XOC A;  5LKZ A;  2CSZ A;  3LVR E;  3U5M A;  5H1V A;  2JMD A;  5G04 B;  4BBQ A;  4V3K C;  2EA6 A;  4WZ2 A;  2NAA A;  3H7H A;  2CSY A;  4AYC B;  2VJE B;  2VNF A;  2VPD A;  2MD7 B;  5JG6 A;  2VPE A;  4YAT A;  3ZPV 1;  3JUE A;  2G6Q A;  2VPG A;  1HYJ A;  2KIZ A;  4A49 A;  1X4J A;  2LGV A;  4FIP A;  2KWJ A;  3LDY A;  2YQM A;  2MT5 A;  5K3Q A;  4PPE A;  2EGM A;  2D8S A;  2LAU A;  2YUC A;  1WEM A;  5B8D A;  1WEU A;  4LAD B;  2L80 A;  3T9K A;  4GND A;  5H1T A;  1JOC A;  4CCG X;  2MA5 A;  1WEV A;  5D1M B;  3DWD A;  3SOU A;  1WEE A;  4LLB A;  2FUI A;  4S3O B;  2YHO A;  3N9Q A;  4AVX A;  3QZV A;  3M63 A;  2AN6 A;  1JM7 B;  2PUY A;  4S3O C;  3FAO A;  3KQI A;  2F6N A;  1WEO A;  4UI9 B;  5B78 A;  4CA1 A;  4QF2 A;  2I50 A;  2MIQ A;  3SHB A;  4OGE A;  2ECT A;  2JMJ A;  3U5P A;  4H9D A;  5AIU A;  4L58 A;  4L7X A;  1Z2Q A;  3O34 A;  3C6W A;  2Y43 A;  4GNE A;  2QJ0 A;  2DJA A;  2IDA A;  5B75 A;  4A4C A;  1K2F A;  2K17 A;  3FJU B;  3O47 A;  3MHS A;  5C13 A;  3U5N A;  1Z6U A;  2G43 A;  3LJU X;  3O70 A;  2LRI C;  4O64 A;  4R8P K;  2KRE A;  2B0O E;  4B7Y C;  5C11 A;  2ECW A;  2KFT A;  1WE9 A;  2JMI A;  2EOD A;  1WFK A;  5TDW A;  2L75 A;  4V3L C;  3DQV R;  3LQI A;  4WZ3 B;  2OXQ C;  2YW8 A;  3O7A A;  2YSM A;  3DPL R;  4YBT A;  3LQH A;  2KWN A;  3L11 A;  1X4I A;  1N87 A;  5DKA A;  4GNG A;  1DCQ A;  4IC3 A;  3T7L A;  2JUN A;  2H0D A;  4R2Y A;  4ZQL A;  2KGI A;  2QIZ A;  2DX8 A;  4UP5 A;  4F52 B;  3U5O A;  1F62 A;  3L1X A;  2KE1 A;  2ECN A;  2CRR A;  3O35 A;  5FB1 A;  2ZET C;  1WGM A;  2P57 A;  2YVR A;  1MM2 A;  4ZDT A;  1X4U A;  2E6S A;  2BAY A;  2MA6 A;  3ZPV E;  3M7K A;  4N4F A;  5LKU A;  2YSJ A;  1DVP A;  1G25 A;  4A4B A;  4I7B A;  4Q6F A;  3SOW A;  2ECJ A;  2VPB A;  5H9M A;  2HYE D;  2MUM A;  2K4D A;  4YAX A;  1WEQ A;  5FB0 A;  3VK6 A;  1Z60 A;  2Y1M A;  4FJC A;  2LXP C;  2QIC A;  4N3W A;  4I7D A;  3N9O A;  4BHW A;  3MDB C;  4LJN A;  4GB0 A;  5D1L B;  4YAB A;  4AP4 A;  4X3G A;  2RSD A;  1WEW A;  2XB1 A;  5EYA F;  4WA6 A;  1WIL A;  4UP0 A;  4PTB A;  3I2D A;  2IQJ A;  5LCW B;  3GV4 A;  2MNZ A;  2XEU A;  5B79 A;  5SVI A;  5LKX A;  3GL6 A;  2LQ6 A;  3O36 A;  1WEP A;  2YT5 A;  5TAB A;  2XOY A;  4NN2 A;  3ZTG A;  3L1Z B;  5FER A;  4QQ4 A;  3Q1D A;  5G05 B;  3KV6 A;  4FO9 A;  2K16 A;  5FEY A;  3SUB A;  1LDK C;  3LRQ A;  5H1U A;  3N9P A;  2MNY A;  5B77 A;  3KDE C;  3KV5 A;  5TDR A;  3FM8 C;  2D8U A;  5SVY A;  3PUQ A;  2E6R A;  5B76 A;  4XI1 A;  2L7P A;  3ZVZ B;  2YU4 A;  3E2D A;  3V43 A;  3FAN A;  2L5U A;  2FUU A;  2KU3 A;  1CHC A;  2PNX A;  2RI7 A;  1MM3 A;  2F42 A;  2YYR A;  2CT2 A;  4YBM A;  2CON A;  3PLW A;  3ZVY A;  1IYM A;  3KNV A;  2M85 A;  2VJF A;  1RMD A;  1WIM A;  2ECI A;  1ZBD B;  1FP0 A;  2JRJ A;  5G0F A;  3ZYQ A;  4B86 C;  2LV9 A;  1VFY A;  2CSV A;  4QF3 A;  3ZNI A;  5LKT A;  2KWO A;  5KH3 A;  2ECG A;  4TKP B;  4GNF A;  5SVI B;  2KR4 A;  3M62 A;  3PUR A;  3EB6 A;  2FFW A;  2LGG A;  4YC9 A;  4R7E A;  2OWA A;  2KKX A;  4OGC A;  5J3X A;  2CKL A;  1BOR A;  2ECV A;  3O37 A;  2EGP A;  2M3H A;  3O33 A;  1V87 A;  2RR4 A;  3M99 A; 
#chains in the Genus database with same CATH homology
 4WZ0 A;  5DIN A;  1FBV A;  5I3L A;  1E4U A;  3LQJ A;  2F6J A;  2Y1N A;  2LGL A;  2M6M A;  3HCU A;  3PHD A;  2YQL A;  4MSX A;  2LGK A;  4W4U A;  2G45 A;  3N9N A;  2MD8 C;  3N9L A;  4LK9 A;  4AUQ B;  1T1H A;  3SOX A;  2KWK A;  2C2L A;  1U6G B;  2LDR A;  3RTR B;  5TBN A;  2HDP A;  1VYX A;  1WEN A;  3ASL A;  2H0D B;  2M1R A;  3MHH A;  4LKA A;  3HCT A;  2VJF B;  3RPG B;  3N9M A;  3HTK C;  1LDJ B;  4AYC A;  4I7C A;  2UZG A;  2VJE A;  4ZUX U;  3NG2 A;  1VD4 A;  2FSA A;  4MVT A;  2K1J A;  4A0C D;  2KGG A;  2KYU A;  2YUR A;  3RPG C;  4YAD A;  4FK5 A;  3C5K A;  2C2V S;  2CKL B;  2LN0 A;  5AIT A;  2YHN A;  3HCS A;  5TRB A;  2L0B A;  1WES A;  2L43 A;  5D1K B;  5KH7 A;  3FL2 A;  4YBS A;  3EB5 A;  3IHP A;  2LXH C;  2VP7 A;  2YRE A;  3T6R A;  4C9Z A;  1HYI A;  4IC2 A;  1JM7 A;  5KH9 A;  1XWH A;  4P5O B;  5LKZ A;  2CSZ A;  3U5M A;  5H1V A;  2JMD A;  5G04 B;  4BBQ A;  4V3K C;  2EA6 A;  4WZ2 A;  2NAA A;  2CSY A;  4AYC B;  2VJE B;  2VNF A;  2VPD A;  2MD7 B;  5JG6 A;  2VPE A;  4YAT A;  3ZPV 1;  2G6Q A;  2VPG A;  1HYJ A;  2KIZ A;  4A49 A;  1X4J A;  2LGV A;  4FIP A;  2KWJ A;  2YQM A;  2MT5 A;  4PPE A;  2D8S A;  2YUC A;  1WEM A;  5B8D A;  1WEU A;  4LAD B;  2L80 A;  5H1T A;  4GND A;  1JOC A;  4CCG X;  2MA5 A;  1WEV A;  5D1M B;  3SOU A;  1WEE A;  4LLB A;  2FUI A;  4S3O B;  2YHO A;  3N9Q A;  4AVX A;  3QZV A;  3M63 A;  2AN6 A;  1JM7 B;  2PUY A;  4S3O C;  3KQI A;  2F6N A;  1WEO A;  4UI9 B;  5B78 A;  4CA1 A;  4QF2 A;  2I50 A;  2MIQ A;  3SHB A;  2ECT A;  2JMJ A;  3U5P A;  5AIU A;  4L58 A;  4L7X A;  1Z2Q A;  3O34 A;  3C6W A;  2Y43 A;  4GNE A;  2QJ0 A;  2IDA A;  5B75 A;  4A4C A;  1K2F A;  2K17 A;  3MHS A;  5C13 A;  3U5N A;  1Z6U A;  2G43 A;  3O70 A;  2LRI C;  4O64 A;  4R8P K;  2KRE A;  4B7Y C;  5C11 A;  2ECW A;  2KFT A;  1WE9 A;  2JMI A;  2EOD A;  1WFK A;  5TDW A;  2L75 A;  4V3L C;  3DQV R;  3LQI A;  4WZ3 B;  2OXQ C;  2YW8 A;  3O7A A;  2YSM A;  3DPL R;  4YBT A;  3LQH A;  2KWN A;  3L11 A;  1X4I A;  1N87 A;  5DKA A;  4GNG A;  4IC3 A;  3T7L A;  2H0D A;  4R2Y A;  4ZQL A;  2KGI A;  2QIZ A;  2DX8 A;  4UP5 A;  4F52 B;  3U5O A;  1F62 A;  3L1X A;  2KE1 A;  2ECN A;  3O35 A;  5FB1 A;  2ZET C;  1WGM A;  1MM2 A;  4ZDT A;  1X4U A;  2E6S A;  2BAY A;  2MA6 A;  3ZPV E;  4N4F A;  5LKU A;  2YSJ A;  1DVP A;  1G25 A;  4A4B A;  4I7B A;  4Q6F A;  3SOW A;  2ECJ A;  2VPB A;  5H9M A;  2HYE D;  2MUM A;  2K4D A;  4YAX A;  1WEQ A;  5FB0 A;  3VK6 A;  1Z60 A;  2Y1M A;  4FJC A;  2LXP C;  2QIC A;  4N3W A;  4I7D A;  3N9O A;  4BHW A;  4LJN A;  4GB0 A;  5D1L B;  4YAB A;  4AP4 A;  4X3G A;  2RSD A;  1WEW A;  2XB1 A;  5EYA F;  4WA6 A;  1WIL A;  4UP0 A;  4PTB A;  3I2D A;  5LCW B;  3GV4 A;  2MNZ A;  2XEU A;  5B79 A;  5LKX A;  3GL6 A;  2LQ6 A;  3O36 A;  1WEP A;  2YT5 A;  5TAB A;  4NN2 A;  3ZTG A;  3L1Z B;  5FER A;  5G05 B;  3KV6 A;  4FO9 A;  2K16 A;  5FEY A;  1LDK C;  3LRQ A;  5H1U A;  3N9P A;  2MNY A;  5B77 A;  3KV5 A;  5TDR A;  3PUQ A;  2E6R A;  5B76 A;  4XI1 A;  3ZVZ B;  2YU4 A;  3V43 A;  2L5U A;  2FUU A;  2KU3 A;  1CHC A;  2PNX A;  2RI7 A;  1MM3 A;  2F42 A;  2YYR A;  2CT2 A;  4YBM A;  3ZVY A;  1IYM A;  3KNV A;  2M85 A;  2VJF A;  1RMD A;  1WIM A;  2ECI A;  1ZBD B;  1FP0 A;  2JRJ A;  5G0F A;  3ZYQ A;  4B86 C;  2LV9 A;  1VFY A;  4QF3 A;  3ZNI A;  5LKT A;  2KWO A;  5KH3 A;  2ECG A;  4TKP B;  4GNF A;  2KR4 A;  3M62 A;  3PUR A;  3EB6 A;  2LGG A;  4YC9 A;  4R7E A;  5J3X A;  2CKL A;  1BOR A;  2ECV A;  3O37 A;  2EGP A;  2M3H A;  3O33 A;  1V87 A;  3M99 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...