2MA5A

Solution nmr structure of phd type zinc finger domain of lysine-specific demethylase 5b (plu-1/jarid1b) from homo sapiens, northeast structural genomics consortium (nesg) target hr7375c
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
61
structure length
61
Chain Sequence
SHMCPAVSCLQPEGDEVDWVQCDGSCNQWFHQVCVGVSPEMAEKEDYICVRCTVKDAPSRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Lysine-specific demethylase 5B
publication title Solution NMR structure of PHD type Zinc finger domain of Lysine-specific demethylase 5B (PLU-1/JARID1B) from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR7375C
rcsb
source organism Homo sapiens
total genus 11
structure length 61
sequence length 61
ec nomenclature ec 1.14.11.-:
pdb deposition date 2013-06-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2ma5A00
4B7YC 1N87A 5KH3A 2CSYA 2ECNA 4WA6A 4X3GA 2LGVA 5D1MB 3I2DA 5TRBA 3ZNIA 4C9ZA 5B8DA 2EODA 1G25A 2YQMA 1MM3A 1F62A 2ECWA 2KIZA 3N9MA 3QZVA 3M62A 4CCGX 4ZQLA 2VPGA 2G45A 2MIQA 4YC9A 3ZVYA 2LGLA 4CA1A 4IC2A 2VPDA 2FSAA 5G0FA 4W4UA 4S3OB 4IC3A 3N9PA 2Y1NA 1FP0A 1VFYA 3KNVA 1Z6UA 4WZ2A 3KV6A 1WILA 5TDWA 3FL2A 1VD4A 2YYRA 4I7CA 4YBSA 3VK6A 2ECJA 2VJFB 5AITA 1WEWA 4GNFA 4YADA 2LXHC 3PURA 3V43A 2M3HA 2G6QA 4AP4A 3O37A 2MD7B 2G43A 5FB0A 2H0DB 3N9NA 2QICA 4GNDA 5G05B 4NN2A 1VYXA 4O64A 2K4DA 5KH7A 2BAYA 3RPGB 4AUQB 5D1KB 3RPGC 1WENA 1WE9A 3PHDA 1U6GB 2C2LA 2UZGA 4LLBA 2VJFA 3M63A 3GV4A 5TABA 2YREA 4BBQA 2I50A 2KREA 4QF2A 1WIMA 2H0DA 3PUQA 5H1UA 4LK9A 2MNYA 2K16A 2KFTA 5EYAF 2JRJA 3RTRB 3SHBA 3HTKC 4FJCA 1X4UA 2LGGA 3LQJA 2OXQC 2KGGA 4I7DA 4PPEA 4GB0A 2CT2A 2JMDA 1WEEA 1WEQA 5B79A 5FERA 2Y1MA 5DKAA 2MA5A 4BHWA 5AIUA 2YSJA 4A49A 2YURA 5G04B 2ECGA 5LKTA 2LRIC 3LQIA 2LQ6A 2IDAA 5LKUA 2VJEB 5JG6A 1WFKA 2NAAA 2LXPC 3ZPV1 1X4IA 2L0BA 1X4JA 4S3OC 4TKPB 2VNFA 1WEUA 1CHCA 4ZDTA 2M6MA 4XI1A 2KGIA 1MM2A 1E4UA 2EA6A 2E6SA 2L5UA 4F52B 2LDRA 3O36A 1Z2QA 1FBVA 3L11A 4LKAA 2KU3A 4Q6FA 2K1JA 4I7BA 3ZPVE 3HCUA 2VJEA 5I3LA 4YATA 1IYMA 3MHSA 5DINA 4L58A 5FB1A 5B78A 4GNEA 3EB6A 2LGKA 2YUCA 1WEPA 1JM7B 1V87A 4FK5A 3SOXA 3U5NA 5FEYA 3O35A 2KYUA 4A0CD 3NG2A 5H1VA 1Z60A 2HYED 2HDPA 4LJNA 1LDJB 3EB5A 2KE1A 2ECTA 2AN6A 3ZTGA 2PUYA 1WEMA 5TBNA 4N3WA 2F6JA 2M85A 5LKZA 5LKXA 2KWOA 2L80A 2PNXA 5H9MA 4YABA 3SOWA 3ZYQA 4AYCB 2FUUA 5J3XA 2MUMA 4N4FA 2KWNA 1HYIA 4UP0A 3C6WA 2VP7A 3HCTA 3DQVR 1JM7A 1HYJA 4A4CA 2KWKA 2MD8C 4B86C 4R2YA 4V3KC 2QJ0A 2XEUA 2YHNA 2Y43A 2CSZA 3M99A 2JMIA 4YBMA 3N9QA 3U5OA 2LV9A 1WGMA 5B77A 5KH9A 2L75A 2F42A 2YW8A 1ZBDB 4R7EA 2YHOA 2MT5A 4AYCA 2YSMA 1WESA 4WZ0A 4LADB 4R8PK 4UI9B 2XB1A 2KWJA 2E6RA 5C11A 2YQLA 4QF3A 1JOCA 3T7LA 4AVXA 2DX8A 3ZVZB 4MVTA 3L1ZB 4GNGA 2D8SA 1T1HA 1K2FA 2ECIA 3IHPA 2YU4A 4P5OB 5H1TA 4FO9A 5C13A 1BORA 3DPLR 5TDRA 4ZUXU 3L1XA 3U5PA 3GL6A 2RI7A 2YT5A 3HCSA 2RSDA 2CKLB 3O70A 2K17A 2EGPA 1XWHA 2MA6A 3T6RA 2M1RA 2ZETC 2ECVA 3KQIA 4MSXA 3C5KA 2C2VS 1RMDA 4YAXA 3O33A 1WEOA 1DVPA 4PTBA 5D1LB 2KR4A 4L7XA 3N9OA 3ASLA 1WEVA 3LQHA 2LN0A 3SOUA 2L43A 4FIPA 2CKLA 5B75A 2MNZA 2QIZA 2F6NA 2VPEA 5B76A 3LRQA 2JMJA 3U5MA 2FUIA 4WZ3B 3MHHA 4V3LC 4UP5A 4YBTA 5LCWB 4A4BA 3N9LA 3KV5A 3O7AA 3O34A 1LDKC 2VPBA
chains in the Genus database with same CATH superfamily
4B7YC 1N87A 5KH3A 2CSYA 2P57A 2ECNA 3LVQE 4WA6A 4X3GA 2LGVA 5D1MB 3I2DA 5TRBA 3ZNIA 3Q1DA 5SVIA 4C9ZA 5B8DA 2EODA 1G25A 2CSVA 2YQMA 1MM3A 1F62A 2ECWA 2KIZA 3N9MA 2KKXA 3QZVA 3M62A 4CCGX 4ZQLA 2VPGA 2G45A 2MIQA 4YC9A 3ZVYA 2LGLA 4CA1A 3T9KA 4IC2A 3E2DA 2VPDA 2FSAA 5G0FA 4W4UA 2YVRA 2D8UA 4S3OB 4IC3A 3N9PA 2Y1NA 3FM8C 2IQJA 1FP0A 1VFYA 3KNVA 1Z6UA 4WZ2A 3KV6A 1WILA 5TDWA 3FL2A 1VD4A 2YYRA 4I7CA 4YBSA 3VK6A 2ECJA 2VJFB 5AITA 1WEWA 4GNFA 4YADA 2LXHC 2XOYA 3PURA 3V43A 2M3HA 2G6QA 4AP4A 2FD4A 3O37A 2MD7B 2G43A 2H0DB 5FB0A 3N9NA 2QICA 4GNDA 5G05B 2FFWA 4NN2A 1VYXA 4Z0OA 4O64A 3SUBA 2K4DA 5KH7A 2BAYA 3RPGB 4AUQB 5D1KB 3RPGC 1WENA 1WE9A 3PHDA 4OGCA 1U6GB 2E61A 1DCQA 2C2LA 2UZGA 4LLBA 4QQ4A 2VJFA 3LVRE 3M63A 3GV4A 5TABA 2YREA 5K3QA 4BBQA 2I50A 3PLWA 2KREA 4QF2A 1WIMA 2H0DA 3PUQA 5H1UA 4LK9A 2MNYA 2K16A 2KFTA 5EYAF 2JRJA 4Z0RA 3RTRB 3SHBA 3HTKC 4FJCA 1X4UA 2LGGA 3LQJA 2OXQC 2KGGA 2CRWA 4I7DA 4PPEA 4GB0A 2CT2A 2JMDA 1WEEA 1WEQA 5B79A 5FERA 2Y1MA 5DKAA 2MA5A 3DWDA 4BHWA 5AIUA 2YSJA 4A49A 3LJUX 2YURA 5G04B 2ECGA 5LKTA 2XOCA 2LRIC 3LQIA 2LQ6A 4H9DA 2IDAA 5LKUA 2VJEB 5JG6A 1WFKA 2NAAA 2LXPC 3ZPV1 1X4IA 2L0BA 2EXUA 1X4JA 4S3OC 4TKPB 2VNFA 1WEUA 1CHCA 4ZDTA 2M6MA 4XI1A 2KGIA 1MM2A 1E4UA 2EA6A 2E6SA 2L5UA 4F52B 2LDRA 3O36A 1Z2QA 1FBVA 3L11A 4LKAA 2KU3A 4Q6FA 2K1JA 4I7BA 3ZPVE 2B0OE 3HCUA 2VJEA 2M13A 5I3LA 5SVYA 4YATA 3M7KA 2L7PA 1IYMA 3MHSA 2CONA 5DINA 3O47A 3KDEC 4L58A 5FB1A 5B78A 4GNEA 3EB6A 2LGKA 2YUCA 1WEPA 1JM7B 1V87A 4FK5A 3SOXA 3U5NA 5FEYA 3O35A 2KYUA 4A0CD 3NG2A 5H1VA 1Z60A 2HYED 2HDPA 4LJNA 1LDJB 3EB5A 2KE1A 2ECTA 2AN6A 3ZTGA 2PUYA 1WEMA 5TBNA 4N3WA 2F6JA 2M85A 5LKZA 5LKXA 2KWOA 2L80A 2PNXA 5H9MA 4YABA 3SOWA 3ZYQA 4AYCB 2FUUA 2XOZA 5J3XA 2MUMA 4N4FA 2KWNA 1HYIA 4UP0A 3C6WA 3JUEA 2VP7A 3HCTA 3DQVR 1JM7A 1HYJA 4A4CA 2JM3A 2KWKA 2MD8C 3MDBC 4B86C 4R2YA 4V3KC 2QJ0A 2XEUA 2YHNA 2Y43A 2CSZA 3M99A 2JMIA 4YBMA 3N9QA 3U5OA 2DSMA 2LV9A 1WGMA 2KKYA 5B77A 5KH9A 2L75A 2F42A 2YW8A 1ZBDB 4R7EA 2YHOA 2MT5A 4AYCA 2YSMA 1WESA 2CRRA 2MKEA 4WZ0A 3FAOA 4LADB 4R8PK 4UI9B 2XB1A 3DDTA 2KWJA 2RR4A 2E6RA 5C11A 2YQLA 4QF3A 1JOCA 3T7LA 4AVXA 2DX8A 3ZVZB 4MVTA 3L1ZB 4GNGA 2D8SA 1T1HA 1K2FA 2ECIA 3IHPA 2YU4A 4P5OB 2JUNA 5H1TA 4FO9A 5C13A 2XP0A 1BORA 2OWAA 3DPLR 5TDRA 2DJAA 4ZUXU 3L1XA 4O62A 3U5PA 3GL6A 2RI7A 2YT5A 3HCSA 2RSDA 2CKLB 3O70A 2K17A 2EGPA 1XWHA 2MA6A 3LDYA 2LAUA 3T6RA 2M1RA 2ZETC 2ECVA 3KQIA 4MSXA 3C5KA 2C2VS 1RMDA 4YAXA 3O33A 4F1PA 1WEOA 1DVPA 4PTBA 4OGEA 5D1LB 2KR4A 4L7XA 3N9OA 3ASLA 1WEVA 3LQHA 2LN0A 3SOUA 2L43A 4FIPA 2EGMA 3FANA 2CKLA 3FJUB 2MNZA 5B75A 2QIZA 2F6NA 2VPEA 5SVIB 5B76A 3H7HA 3LRQA 2JMJA 5SVXA 1MBMA 3U5MA 2FUIA 3MHHA 4WZ3B 4V3LC 4UP5A 4YBTA 5LCWB 4A4BA 3N9LA 3KV5A 3O7AA 3O34A 3FEHA 1LDKC 2VPBA
chains in the Genus database with same CATH topology
4B7YC 1N87A 5KH3A 2CSYA 2ECNA 4WA6A 4X3GA 2LGVA 5D1MB 3I2DA 5TRBA 3ZNIA 4C9ZA 5B8DA 2EODA 1G25A 2YQMA 1MM3A 1F62A 2ECWA 2KIZA 3N9MA 3QZVA 3M62A 4CCGX 4ZQLA 2VPGA 2G45A 2MIQA 4YC9A 3ZVYA 2LGLA 4CA1A 4IC2A 2VPDA 2FSAA 5G0FA 4W4UA 4S3OB 4IC3A 3N9PA 2Y1NA 1FP0A 1VFYA 3KNVA 1Z6UA 4WZ2A 3KV6A 1WILA 5TDWA 3FL2A 1VD4A 2YYRA 4I7CA 4YBSA 3VK6A 2ECJA 2VJFB 5AITA 1WEWA 4GNFA 4YADA 2LXHC 3PURA 3V43A 2M3HA 2G6QA 4AP4A 3O37A 2MD7B 2G43A 5FB0A 2H0DB 3N9NA 2QICA 4GNDA 5G05B 4NN2A 1VYXA 4O64A 2K4DA 5KH7A 2BAYA 3RPGB 4AUQB 5D1KB 3RPGC 1WENA 1WE9A 3PHDA 1U6GB 2C2LA 2UZGA 4LLBA 2VJFA 3M63A 3GV4A 5TABA 2YREA 4BBQA 2I50A 2KREA 4QF2A 1WIMA 2H0DA 3PUQA 5H1UA 4LK9A 2MNYA 2K16A 2KFTA 5EYAF 2JRJA 3RTRB 3SHBA 3HTKC 4FJCA 1X4UA 2LGGA 3LQJA 2OXQC 2KGGA 4I7DA 4PPEA 4GB0A 2CT2A 2JMDA 1WEEA 1WEQA 5B79A 5FERA 2Y1MA 5DKAA 2MA5A 4BHWA 5AIUA 2YSJA 4A49A 2YURA 5G04B 2ECGA 5LKTA 2LRIC 3LQIA 2LQ6A 2IDAA 5LKUA 2VJEB 5JG6A 1WFKA 2NAAA 2LXPC 3ZPV1 1X4IA 2L0BA 1X4JA 4S3OC 4TKPB 2VNFA 1WEUA 1CHCA 4ZDTA 2M6MA 4XI1A 2KGIA 1MM2A 1E4UA 2EA6A 2E6SA 2L5UA 4F52B 2LDRA 3O36A 1Z2QA 1FBVA 3L11A 4LKAA 2KU3A 4Q6FA 2K1JA 4I7BA 3ZPVE 3HCUA 2VJEA 5I3LA 4YATA 1IYMA 3MHSA 5DINA 4L58A 5FB1A 5B78A 4GNEA 3EB6A 2LGKA 2YUCA 1WEPA 1JM7B 1V87A 4FK5A 3SOXA 3U5NA 5FEYA 3O35A 2KYUA 4A0CD 3NG2A 5H1VA 1Z60A 2HYED 2HDPA 4LJNA 1LDJB 3EB5A 2KE1A 2ECTA 2AN6A 3ZTGA 2PUYA 1WEMA 5TBNA 4N3WA 2F6JA 2M85A 5LKZA 5LKXA 2KWOA 2L80A 2PNXA 5H9MA 4YABA 3SOWA 3ZYQA 4AYCB 2FUUA 5J3XA 2MUMA 4N4FA 2KWNA 1HYIA 4UP0A 3C6WA 2VP7A 3HCTA 3DQVR 1JM7A 1HYJA 4A4CA 2KWKA 2MD8C 4B86C 4R2YA 4V3KC 2QJ0A 2XEUA 2YHNA 2Y43A 2CSZA 3M99A 2JMIA 4YBMA 3N9QA 3U5OA 2LV9A 1WGMA 5B77A 5KH9A 2L75A 2F42A 2YW8A 1ZBDB 4R7EA 2YHOA 2MT5A 4AYCA 2YSMA 1WESA 4WZ0A 4LADB 4R8PK 4UI9B 2XB1A 2KWJA 2E6RA 5C11A 2YQLA 4QF3A 1JOCA 3T7LA 4AVXA 2DX8A 3ZVZB 4MVTA 3L1ZB 4GNGA 2D8SA 1T1HA 1K2FA 2ECIA 3IHPA 2YU4A 4P5OB 5H1TA 4FO9A 5C13A 1BORA 3DPLR 5TDRA 4ZUXU 3L1XA 3U5PA 3GL6A 2RI7A 2YT5A 3HCSA 2RSDA 2CKLB 3O70A 2K17A 2EGPA 1XWHA 2MA6A 3T6RA 2M1RA 2ZETC 2ECVA 3KQIA 4MSXA 3C5KA 2C2VS 1RMDA 4YAXA 3O33A 1WEOA 1DVPA 4PTBA 5D1LB 2KR4A 4L7XA 3N9OA 3ASLA 1WEVA 3LQHA 2LN0A 3SOUA 2L43A 4FIPA 2CKLA 5B75A 2MNZA 2QIZA 2F6NA 2VPEA 5B76A 3LRQA 2JMJA 3U5MA 2FUIA 4WZ3B 3MHHA 4V3LC 4UP5A 4YBTA 5LCWB 4A4BA 3N9LA 3KV5A 3O7AA 3O34A 1LDKC 2VPBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B7Y C;  1N87 A;  5KH3 A;  2CSY A;  2ECN A;  4WA6 A;  4X3G A;  2LGV A;  5D1M B;  3I2D A;  5TRB A;  3ZNI A;  4C9Z A;  5B8D A;  2EOD A;  1G25 A;  2YQM A;  1MM3 A;  1F62 A;  2ECW A;  2KIZ A;  3N9M A;  3QZV A;  3M62 A;  4CCG X;  4ZQL A;  2VPG A;  2G45 A;  2MIQ A;  4YC9 A;  3ZVY A;  2LGL A;  4CA1 A;  4IC2 A;  2VPD A;  2FSA A;  5G0F A;  4W4U A;  4S3O B;  4IC3 A;  3N9P A;  2Y1N A;  1FP0 A;  1VFY A;  3KNV A;  1Z6U A;  4WZ2 A;  3KV6 A;  1WIL A;  5TDW A;  3FL2 A;  1VD4 A;  2YYR A;  4I7C A;  4YBS A;  3VK6 A;  2ECJ A;  2VJF B;  5AIT A;  1WEW A;  4GNF A;  4YAD A;  2LXH C;  3PUR A;  3V43 A;  2M3H A;  2G6Q A;  4AP4 A;  3O37 A;  2MD7 B;  2G43 A;  5FB0 A;  2H0D B;  3N9N A;  2QIC A;  4GND A;  5G05 B;  4NN2 A;  1VYX A;  4O64 A;  2K4D A;  5KH7 A;  2BAY A;  3RPG B;  4AUQ B;  5D1K B;  3RPG C;  1WEN A;  1WE9 A;  3PHD A;  1U6G B;  2C2L A;  2UZG A;  4LLB A;  2VJF A;  3M63 A;  3GV4 A;  5TAB A;  2YRE A;  4BBQ A;  2I50 A;  2KRE A;  4QF2 A;  1WIM A;  2H0D A;  3PUQ A;  5H1U A;  4LK9 A;  2MNY A;  2K16 A;  2KFT A;  5EYA F;  2JRJ A;  3RTR B;  3SHB A;  3HTK C;  4FJC A;  1X4U A;  2LGG A;  3LQJ A;  2OXQ C;  2KGG A;  4I7D A;  4PPE A;  4GB0 A;  2CT2 A;  2JMD A;  1WEE A;  1WEQ A;  5B79 A;  5FER A;  2Y1M A;  5DKA A;  2MA5 A;  4BHW A;  5AIU A;  2YSJ A;  4A49 A;  2YUR A;  5G04 B;  2ECG A;  5LKT A;  2LRI C;  3LQI A;  2LQ6 A;  2IDA A;  5LKU A;  2VJE B;  5JG6 A;  1WFK A;  2NAA A;  2LXP C;  3ZPV 1;  1X4I A;  2L0B A;  1X4J A;  4S3O C;  4TKP B;  2VNF A;  1WEU A;  1CHC A;  4ZDT A;  2M6M A;  4XI1 A;  2KGI A;  1MM2 A;  1E4U A;  2EA6 A;  2E6S A;  2L5U A;  4F52 B;  2LDR A;  3O36 A;  1Z2Q A;  1FBV A;  3L11 A;  4LKA A;  2KU3 A;  4Q6F A;  2K1J A;  4I7B A;  3ZPV E;  3HCU A;  2VJE A;  5I3L A;  4YAT A;  1IYM A;  3MHS A;  5DIN A;  4L58 A;  5FB1 A;  5B78 A;  4GNE A;  3EB6 A;  2LGK A;  2YUC A;  1WEP A;  1JM7 B;  1V87 A;  4FK5 A;  3SOX A;  3U5N A;  5FEY A;  3O35 A;  2KYU A;  4A0C D;  3NG2 A;  5H1V A;  1Z60 A;  2HYE D;  2HDP A;  4LJN A;  1LDJ B;  3EB5 A;  2KE1 A;  2ECT A;  2AN6 A;  3ZTG A;  2PUY A;  1WEM A;  5TBN A;  4N3W A;  2F6J A;  2M85 A;  5LKZ A;  5LKX A;  2KWO A;  2L80 A;  2PNX A;  5H9M A;  4YAB A;  3SOW A;  3ZYQ A;  4AYC B;  2FUU A;  5J3X A;  2MUM A;  4N4F A;  2KWN A;  1HYI A;  4UP0 A;  3C6W A;  2VP7 A;  3HCT A;  3DQV R;  1JM7 A;  1HYJ A;  4A4C A;  2KWK A;  2MD8 C;  4B86 C;  4R2Y A;  4V3K C;  2QJ0 A;  2XEU A;  2YHN A;  2Y43 A;  2CSZ A;  3M99 A;  2JMI A;  4YBM A;  3N9Q A;  3U5O A;  2LV9 A;  1WGM A;  5B77 A;  5KH9 A;  2L75 A;  2F42 A;  2YW8 A;  1ZBD B;  4R7E A;  2YHO A;  2MT5 A;  4AYC A;  2YSM A;  1WES A;  4WZ0 A;  4LAD B;  4R8P K;  4UI9 B;  2XB1 A;  2KWJ A;  2E6R A;  5C11 A;  2YQL A;  4QF3 A;  1JOC A;  3T7L A;  4AVX A;  2DX8 A;  3ZVZ B;  4MVT A;  3L1Z B;  4GNG A;  2D8S A;  1T1H A;  1K2F A;  2ECI A;  3IHP A;  2YU4 A;  4P5O B;  5H1T A;  4FO9 A;  5C13 A;  1BOR A;  3DPL R;  5TDR A;  4ZUX U;  3L1X A;  3U5P A;  3GL6 A;  2RI7 A;  2YT5 A;  3HCS A;  2RSD A;  2CKL B;  3O70 A;  2K17 A;  2EGP A;  1XWH A;  2MA6 A;  3T6R A;  2M1R A;  2ZET C;  2ECV A;  3KQI A;  4MSX A;  3C5K A;  2C2V S;  1RMD A;  4YAX A;  3O33 A;  1WEO A;  1DVP A;  4PTB A;  5D1L B;  2KR4 A;  4L7X A;  3N9O A;  3ASL A;  1WEV A;  3LQH A;  2LN0 A;  3SOU A;  2L43 A;  4FIP A;  2CKL A;  5B75 A;  2MNZ A;  2QIZ A;  2F6N A;  2VPE A;  5B76 A;  3LRQ A;  2JMJ A;  3U5M A;  2FUI A;  4WZ3 B;  3MHH A;  4V3L C;  4UP5 A;  4YBT A;  5LCW B;  4A4B A;  3N9L A;  3KV5 A;  3O7A A;  3O34 A;  1LDK C;  2VPB A; 
#chains in the Genus database with same CATH topology
 4B7Y C;  1N87 A;  5KH3 A;  2CSY A;  2P57 A;  2ECN A;  3LVQ E;  4WA6 A;  4X3G A;  2LGV A;  5D1M B;  3I2D A;  5TRB A;  3ZNI A;  3Q1D A;  5SVI A;  4C9Z A;  5B8D A;  2EOD A;  1G25 A;  2CSV A;  2YQM A;  1MM3 A;  1F62 A;  2ECW A;  2KIZ A;  3N9M A;  2KKX A;  3QZV A;  3M62 A;  4CCG X;  4ZQL A;  2VPG A;  2G45 A;  2MIQ A;  4YC9 A;  3ZVY A;  2LGL A;  4CA1 A;  3T9K A;  4IC2 A;  3E2D A;  2VPD A;  2FSA A;  5G0F A;  4W4U A;  2YVR A;  2D8U A;  4S3O B;  4IC3 A;  3N9P A;  2Y1N A;  3FM8 C;  2IQJ A;  1FP0 A;  1VFY A;  3KNV A;  1Z6U A;  4WZ2 A;  3KV6 A;  1WIL A;  5TDW A;  3FL2 A;  1VD4 A;  2YYR A;  4I7C A;  4YBS A;  3VK6 A;  2ECJ A;  2VJF B;  5AIT A;  1WEW A;  4GNF A;  4YAD A;  2LXH C;  2XOY A;  3PUR A;  3V43 A;  2M3H A;  2G6Q A;  4AP4 A;  2FD4 A;  3O37 A;  2MD7 B;  2G43 A;  2H0D B;  5FB0 A;  3N9N A;  2QIC A;  4GND A;  5G05 B;  2FFW A;  4NN2 A;  1VYX A;  4Z0O A;  4O64 A;  3SUB A;  2K4D A;  5KH7 A;  2BAY A;  3RPG B;  4AUQ B;  5D1K B;  3RPG C;  1WEN A;  1WE9 A;  3PHD A;  4OGC A;  1U6G B;  2E61 A;  1DCQ A;  2C2L A;  2UZG A;  4LLB A;  4QQ4 A;  2VJF A;  3LVR E;  3M63 A;  3GV4 A;  5TAB A;  2YRE A;  5K3Q A;  4BBQ A;  2I50 A;  3PLW A;  2KRE A;  4QF2 A;  1WIM A;  2H0D A;  3PUQ A;  5H1U A;  4LK9 A;  2MNY A;  2K16 A;  2KFT A;  5EYA F;  2JRJ A;  4Z0R A;  3RTR B;  3SHB A;  3HTK C;  4FJC A;  1X4U A;  2LGG A;  3LQJ A;  2OXQ C;  2KGG A;  2CRW A;  4I7D A;  4PPE A;  4GB0 A;  2CT2 A;  2JMD A;  1WEE A;  1WEQ A;  5B79 A;  5FER A;  2Y1M A;  5DKA A;  2MA5 A;  3DWD A;  4BHW A;  5AIU A;  2YSJ A;  4A49 A;  3LJU X;  2YUR A;  5G04 B;  2ECG A;  5LKT A;  2XOC A;  2LRI C;  3LQI A;  2LQ6 A;  4H9D A;  2IDA A;  5LKU A;  2VJE B;  5JG6 A;  1WFK A;  2NAA A;  2LXP C;  3ZPV 1;  1X4I A;  2L0B A;  2EXU A;  1X4J A;  4S3O C;  4TKP B;  2VNF A;  1WEU A;  1CHC A;  4ZDT A;  2M6M A;  4XI1 A;  2KGI A;  1MM2 A;  1E4U A;  2EA6 A;  2E6S A;  2L5U A;  4F52 B;  2LDR A;  3O36 A;  1Z2Q A;  1FBV A;  3L11 A;  4LKA A;  2KU3 A;  4Q6F A;  2K1J A;  4I7B A;  3ZPV E;  2B0O E;  3HCU A;  2VJE A;  2M13 A;  5I3L A;  5SVY A;  4YAT A;  3M7K A;  2L7P A;  1IYM A;  3MHS A;  2CON A;  5DIN A;  3O47 A;  3KDE C;  4L58 A;  5FB1 A;  5B78 A;  4GNE A;  3EB6 A;  2LGK A;  2YUC A;  1WEP A;  1JM7 B;  1V87 A;  4FK5 A;  3SOX A;  3U5N A;  5FEY A;  3O35 A;  2KYU A;  4A0C D;  3NG2 A;  5H1V A;  1Z60 A;  2HYE D;  2HDP A;  4LJN A;  1LDJ B;  3EB5 A;  2KE1 A;  2ECT A;  2AN6 A;  3ZTG A;  2PUY A;  1WEM A;  5TBN A;  4N3W A;  2F6J A;  2M85 A;  5LKZ A;  5LKX A;  2KWO A;  2L80 A;  2PNX A;  5H9M A;  4YAB A;  3SOW A;  3ZYQ A;  4AYC B;  2FUU A;  2XOZ A;  5J3X A;  2MUM A;  4N4F A;  2KWN A;  1HYI A;  4UP0 A;  3C6W A;  3JUE A;  2VP7 A;  3HCT A;  3DQV R;  1JM7 A;  1HYJ A;  4A4C A;  2JM3 A;  2KWK A;  2MD8 C;  3MDB C;  4B86 C;  4R2Y A;  4V3K C;  2QJ0 A;  2XEU A;  2YHN A;  2Y43 A;  2CSZ A;  3M99 A;  2JMI A;  4YBM A;  3N9Q A;  3U5O A;  2DSM A;  2LV9 A;  1WGM A;  2KKY A;  5B77 A;  5KH9 A;  2L75 A;  2F42 A;  2YW8 A;  1ZBD B;  4R7E A;  2YHO A;  2MT5 A;  4AYC A;  2YSM A;  1WES A;  2CRR A;  2MKE A;  4WZ0 A;  3FAO A;  4LAD B;  4R8P K;  4UI9 B;  2XB1 A;  3DDT A;  2KWJ A;  2RR4 A;  2E6R A;  5C11 A;  2YQL A;  4QF3 A;  1JOC A;  3T7L A;  4AVX A;  2DX8 A;  3ZVZ B;  4MVT A;  3L1Z B;  4GNG A;  2D8S A;  1T1H A;  1K2F A;  2ECI A;  3IHP A;  2YU4 A;  4P5O B;  2JUN A;  5H1T A;  4FO9 A;  5C13 A;  2XP0 A;  1BOR A;  2OWA A;  3DPL R;  5TDR A;  2DJA A;  4ZUX U;  3L1X A;  4O62 A;  3U5P A;  3GL6 A;  2RI7 A;  2YT5 A;  3HCS A;  2RSD A;  2CKL B;  3O70 A;  2K17 A;  2EGP A;  1XWH A;  2MA6 A;  3LDY A;  2LAU A;  3T6R A;  2M1R A;  2ZET C;  2ECV A;  3KQI A;  4MSX A;  3C5K A;  2C2V S;  1RMD A;  4YAX A;  3O33 A;  4F1P A;  1WEO A;  1DVP A;  4PTB A;  4OGE A;  5D1L B;  2KR4 A;  4L7X A;  3N9O A;  3ASL A;  1WEV A;  3LQH A;  2LN0 A;  3SOU A;  2L43 A;  4FIP A;  2EGM A;  3FAN A;  2CKL A;  3FJU B;  2MNZ A;  5B75 A;  2QIZ A;  2F6N A;  2VPE A;  5SVI B;  5B76 A;  3H7H A;  3LRQ A;  2JMJ A;  5SVX A;  1MBM A;  3U5M A;  2FUI A;  3MHH A;  4WZ3 B;  4V3L C;  4UP5 A;  4YBT A;  5LCW B;  4A4B A;  3N9L A;  3KV5 A;  3O7A A;  3O34 A;  3FEH A;  1LDK C;  2VPB A; 
#chains in the Genus database with same CATH homology
 4B7Y C;  1N87 A;  5KH3 A;  2CSY A;  2ECN A;  4WA6 A;  4X3G A;  2LGV A;  5D1M B;  3I2D A;  5TRB A;  3ZNI A;  4C9Z A;  5B8D A;  2EOD A;  1G25 A;  2YQM A;  1MM3 A;  1F62 A;  2ECW A;  2KIZ A;  3N9M A;  3QZV A;  3M62 A;  4CCG X;  4ZQL A;  2VPG A;  2G45 A;  2MIQ A;  4YC9 A;  3ZVY A;  2LGL A;  4CA1 A;  4IC2 A;  2VPD A;  2FSA A;  5G0F A;  4W4U A;  4S3O B;  4IC3 A;  3N9P A;  2Y1N A;  1FP0 A;  1VFY A;  3KNV A;  1Z6U A;  4WZ2 A;  3KV6 A;  1WIL A;  5TDW A;  3FL2 A;  1VD4 A;  2YYR A;  4I7C A;  4YBS A;  3VK6 A;  2ECJ A;  2VJF B;  5AIT A;  1WEW A;  4GNF A;  4YAD A;  2LXH C;  3PUR A;  3V43 A;  2M3H A;  2G6Q A;  4AP4 A;  3O37 A;  2MD7 B;  2G43 A;  5FB0 A;  2H0D B;  3N9N A;  2QIC A;  4GND A;  5G05 B;  4NN2 A;  1VYX A;  4O64 A;  2K4D A;  5KH7 A;  2BAY A;  3RPG B;  4AUQ B;  5D1K B;  3RPG C;  1WEN A;  1WE9 A;  3PHD A;  1U6G B;  2C2L A;  2UZG A;  4LLB A;  2VJF A;  3M63 A;  3GV4 A;  5TAB A;  2YRE A;  4BBQ A;  2I50 A;  2KRE A;  4QF2 A;  1WIM A;  2H0D A;  3PUQ A;  5H1U A;  4LK9 A;  2MNY A;  2K16 A;  2KFT A;  5EYA F;  2JRJ A;  3RTR B;  3SHB A;  3HTK C;  4FJC A;  1X4U A;  2LGG A;  3LQJ A;  2OXQ C;  2KGG A;  4I7D A;  4PPE A;  4GB0 A;  2CT2 A;  2JMD A;  1WEE A;  1WEQ A;  5B79 A;  5FER A;  2Y1M A;  5DKA A;  2MA5 A;  4BHW A;  5AIU A;  2YSJ A;  4A49 A;  2YUR A;  5G04 B;  2ECG A;  5LKT A;  2LRI C;  3LQI A;  2LQ6 A;  2IDA A;  5LKU A;  2VJE B;  5JG6 A;  1WFK A;  2NAA A;  2LXP C;  3ZPV 1;  1X4I A;  2L0B A;  1X4J A;  4S3O C;  4TKP B;  2VNF A;  1WEU A;  1CHC A;  4ZDT A;  2M6M A;  4XI1 A;  2KGI A;  1MM2 A;  1E4U A;  2EA6 A;  2E6S A;  2L5U A;  4F52 B;  2LDR A;  3O36 A;  1Z2Q A;  1FBV A;  3L11 A;  4LKA A;  2KU3 A;  4Q6F A;  2K1J A;  4I7B A;  3ZPV E;  3HCU A;  2VJE A;  5I3L A;  4YAT A;  1IYM A;  3MHS A;  5DIN A;  4L58 A;  5FB1 A;  5B78 A;  4GNE A;  3EB6 A;  2LGK A;  2YUC A;  1WEP A;  1JM7 B;  1V87 A;  4FK5 A;  3SOX A;  3U5N A;  5FEY A;  3O35 A;  2KYU A;  4A0C D;  3NG2 A;  5H1V A;  1Z60 A;  2HYE D;  2HDP A;  4LJN A;  1LDJ B;  3EB5 A;  2KE1 A;  2ECT A;  2AN6 A;  3ZTG A;  2PUY A;  1WEM A;  5TBN A;  4N3W A;  2F6J A;  2M85 A;  5LKZ A;  5LKX A;  2KWO A;  2L80 A;  2PNX A;  5H9M A;  4YAB A;  3SOW A;  3ZYQ A;  4AYC B;  2FUU A;  5J3X A;  2MUM A;  4N4F A;  2KWN A;  1HYI A;  4UP0 A;  3C6W A;  2VP7 A;  3HCT A;  3DQV R;  1JM7 A;  1HYJ A;  4A4C A;  2KWK A;  2MD8 C;  4B86 C;  4R2Y A;  4V3K C;  2QJ0 A;  2XEU A;  2YHN A;  2Y43 A;  2CSZ A;  3M99 A;  2JMI A;  4YBM A;  3N9Q A;  3U5O A;  2LV9 A;  1WGM A;  5B77 A;  5KH9 A;  2L75 A;  2F42 A;  2YW8 A;  1ZBD B;  4R7E A;  2YHO A;  2MT5 A;  4AYC A;  2YSM A;  1WES A;  4WZ0 A;  4LAD B;  4R8P K;  4UI9 B;  2XB1 A;  2KWJ A;  2E6R A;  5C11 A;  2YQL A;  4QF3 A;  1JOC A;  3T7L A;  4AVX A;  2DX8 A;  3ZVZ B;  4MVT A;  3L1Z B;  4GNG A;  2D8S A;  1T1H A;  1K2F A;  2ECI A;  3IHP A;  2YU4 A;  4P5O B;  5H1T A;  4FO9 A;  5C13 A;  1BOR A;  3DPL R;  5TDR A;  4ZUX U;  3L1X A;  3U5P A;  3GL6 A;  2RI7 A;  2YT5 A;  3HCS A;  2RSD A;  2CKL B;  3O70 A;  2K17 A;  2EGP A;  1XWH A;  2MA6 A;  3T6R A;  2M1R A;  2ZET C;  2ECV A;  3KQI A;  4MSX A;  3C5K A;  2C2V S;  1RMD A;  4YAX A;  3O33 A;  1WEO A;  1DVP A;  4PTB A;  5D1L B;  2KR4 A;  4L7X A;  3N9O A;  3ASL A;  1WEV A;  3LQH A;  2LN0 A;  3SOU A;  2L43 A;  4FIP A;  2CKL A;  5B75 A;  2MNZ A;  2QIZ A;  2F6N A;  2VPE A;  5B76 A;  3LRQ A;  2JMJ A;  3U5M A;  2FUI A;  4WZ3 B;  3MHH A;  4V3L C;  4UP5 A;  4YBT A;  5LCW B;  4A4B A;  3N9L A;  3KV5 A;  3O7A A;  3O34 A;  1LDK C;  2VPB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...