2MA5A

Solution nmr structure of phd type zinc finger domain of lysine-specific demethylase 5b (plu-1/jarid1b) from homo sapiens, northeast structural genomics consortium (nesg) target hr7375c
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
61
structure length
61
Chain Sequence
SHMCPAVSCLQPEGDEVDWVQCDGSCNQWFHQVCVGVSPEMAEKEDYICVRCTVKDAPSRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of PHD type Zinc finger domain of Lysine-specific demethylase 5B (PLU-1/JARID1B) from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR7375C
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Lysine-specific demethylase 5B
total genus 11
structure length 61
sequence length 61
ec nomenclature ec 1.14.11.-:
pdb deposition date 2013-06-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2ma5A00
5TDRA 2F6NA 3N9PA 5AIUA 5G04B 3ZNIA 5B78A 1WEOA 5G05B 3DPLR 2MT5A 4QF2A 2M6MA 2HDPA 1ZBDB 2QICA 4R2YA 1HYJA 3M99A 2VPGA 3T6RA 5LKXA 2YQMA 2CT2A 4WZ0A 2XEUA 3N9OA 4V3LC 2KFTA 4GNGA 1WEPA 1FBVA 5TABA 4LKAA 4I7DA 3O7AA 3ZYQA 2K16A 3O70A 3FL2A 4IC2A 2E6RA 2KE1A 2CKLA 2G45A 4IC3A 2ECIA 2UZGA 5B8DA 4AVXA 4L58A 1FP0A 2ECWA 4YAXA 2PNXA 2MA6A 2KR4A 4C9ZA 2JMIA 2H0DB 4S3OC 1CHCA 4AUQB 1WIMA 3ZPV1 5I3LA 2LQ6A 2ECVA 3O35A 2VPEA 3C5KA 5KH9A 2Y1NA 4YBTA 5C13A 1HYIA 3N9MA 4GNDA 4AYCA 2LGLA 2YREA 3KV5A 4R7EA 5LCWB 3SOXA 5B77A 2VNFA 4WZ3B 3IHPA 2JMDA 3PURA 5FB1A 3ZVYA 5D1KB 2YSJA 1BORA 2VPBA 2G43A 1WEVA 3O33A 2K17A 2VJFA 1E4UA 2L0BA 4BBQA 2CKLB 4L7XA 3MHHA 3ASLA 3C6WA 4FIPA 2QJ0A 4S3OB 2YHOA 2CSZA 2VJFB 3M63A 4NN2A 3PUQA 1G25A 3LRQA 4MSXA 5EYAF 4GB0A 1VFYA 2M1RA 1F62A 4R8PK 2K1JA 3DQVR 2E6SA 3GV4A 3O36A 4I7CA 4ZQLA 4A4BA 4AP4A 5AITA 2JRJA 1WEUA 2YHNA 5D1LB 2VPDA 5B76A 1WEMA 5H1VA 2YYRA 3LQHA 4N4FA 2LDRA 4LLBA 4N3WA 2LRIC 5JG6A 5H9MA 3KQIA 5KH3A 3O37A 3QZVA 1X4UA 4QF3A 4A0CD 5FEYA 3U5MA 4UP5A 2ECTA 1K2FA 3VK6A 5KH7A 5TDWA 5C11A 2KU3A 2Y1MA 2MD7B 1Z60A 5TBNA 2RI7A 2C2VS 3GL6A 5LKZA 3L11A 4YABA 2D8SA 1V87A 4PTBA 4GNFA 2LV9A 3SHBA 3M62A 2F6JA 5FB0A 2KWJA 2KREA 4FK5A 2VP7A 2FUIA 3N9LA 2Y43A 2BAYA 1VD4A 3L1ZB 2MIQA 1WEEA 3EB5A 1WEQA 1N87A 2YW8A 3O34A 2EA6A 2ZETC 2KIZA 4LK9A 3ZPVE 1WILA 2KWKA 1VYXA 2FUUA 2LGKA 2YSMA 2KWNA 1X4JA 4X3GA 4B86C 2RSDA 2LXPC 2M85A 4XI1A 1XWHA 5DINA 3KV6A 4LADB 2H0DA 5LKTA 1MM2A 2MUMA 3T7LA 1LDJB 2CSYA 5B75A 2XB1A 4UI9B 2KGIA 1JOCA 4GNEA 2ECJA 2L75A 1DVPA 4P5OB 5B79A 3SOUA 1WFKA 2I50A 1WEWA 2YT5A 2LGVA 3RPGB 1LDKC 1WESA 2DX8A 3N9NA 2G6QA 4B7YC 2ECGA 1RMDA 4Q6FA 2HYED 4YATA 3SOWA 2VJEB 2QIZA 3HTKC 2KYUA 4CA1A 3U5OA 4I7BA 5DKAA 2L80A 2PUYA 2EODA 2KWOA 1WGMA 5TRBA 3U5NA 2F42A 4O64A 5FERA 4F52B 4UP0A 4TKPB 2LN0A 3LQIA 2FSAA 5D1MB 1JM7A 4LJNA 4YC9A 3EB6A 3HCTA 3N9QA 5LKUA 2K4DA 2YQLA 3PHDA 2LGGA 1Z2QA 2MNZA 2MNYA 2YURA 2L43A 3HCUA 4V3KC 4FJCA 5J3XA 2YUCA 3RTRB 5H1UA 4YBSA 3MHSA 1X4IA 3ZTGA 2MA5A 4CCGX 3U5PA 5G0FA 4A4CA 1Z6UA 2JMJA 5H1TA 3L1XA 4BHWA 4A49A 4MVTA 3RPGC 4WA6A 4PPEA 3KNVA 4YADA 4ZDTA 2L5UA 3HCSA 2ECNA 2OXQC 4WZ2A 4ZUXU 3LQJA 2C2LA 3I2DA 1U6GB 2M3HA 2YU4A 2IDAA 1MM3A 3ZVZB 2MD8C 1T1HA 1WE9A 2KGGA 1IYMA 4W4UA 2AN6A 4FO9A 2NAAA 3V43A 4YBMA 2LXHC 1JM7B 4AYCB 3NG2A 1WENA 2EGPA 2VJEA
chains in the Genus database with same CATH superfamily
5TDRA 2F6NA 3N9PA 5AIUA 5G04B 3ZNIA 5B78A 1WEOA 5G05B 3DPLR 2MT5A 4QF2A 2M6MA 1MBMA 2HDPA 1ZBDB 2QICA 4R2YA 1HYJA 3M99A 2VPGA 3T6RA 5LKXA 2YQMA 2CT2A 4WZ0A 2XEUA 3N9OA 4V3LC 2KFTA 4GNGA 1WEPA 1FBVA 5TABA 4LKAA 4I7DA 3O7AA 3ZYQA 2K16A 3O70A 3FL2A 4IC2A 2E6RA 2KKXA 2KE1A 2CKLA 2G45A 4IC3A 2JM3A 2ECIA 2UZGA 5B8DA 3M7KA 4AVXA 4L58A 1FP0A 2ECWA 4YAXA 2PNXA 2MA6A 2KR4A 4C9ZA 2JMIA 2H0DB 4S3OC 1CHCA 4AUQB 1WIMA 3ZPV1 5I3LA 2LQ6A 2ECVA 3O35A 2VPEA 3C5KA 5KH9A 2Y1NA 3T9KA 4YBTA 5C13A 1HYIA 3JUEA 3N9MA 4GNDA 4AYCA 2P57A 2LGLA 2YREA 2YVRA 3KV5A 4R7EA 5LCWB 3SOXA 5B77A 2VNFA 4WZ3B 3PLWA 3IHPA 2JMDA 3PURA 5FB1A 3SUBA 3ZVYA 5D1KB 2YSJA 3LDYA 2EXUA 1BORA 2VPBA 5SVYA 2G43A 1WEVA 3O33A 2D8UA 2K17A 4O62A 2VJFA 2EGMA 1E4UA 5SVIB 2L0BA 4BBQA 4F1PA 2CKLB 4L7XA 3MHHA 1DCQA 3ASLA 3C6WA 4FIPA 2QJ0A 4S3OB 2YHOA 5SVXA 2CSZA 2VJFB 3M63A 4NN2A 3PUQA 1G25A 3LRQA 4MSXA 5EYAF 2DJAA 4GB0A 1VFYA 2M1RA 3DDTA 4Z0OA 1F62A 2XOZA 4R8PK 2DSMA 2K1JA 3DQVR 2E6SA 3GV4A 4ZQLA 3O36A 4I7CA 4A4BA 4AP4A 5AITA 2JRJA 2M13A 1WEUA 2YHNA 5D1LB 2RR4A 2VPDA 5B76A 1WEMA 5H1VA 2YYRA 3LQHA 4N4FA 4OGCA 2LDRA 2CSVA 4LLBA 2FFWA 3O47A 4N3WA 2LRIC 3LVRE 5JG6A 5H9MA 3KQIA 5KH3A 3O37A 3QZVA 1X4UA 4QF3A 4A0CD 5FEYA 3E2DA 3U5MA 4UP5A 2ECTA 3KDEC 1K2FA 3VK6A 5KH7A 5TDWA 5C11A 5SVIA 2KU3A 2Y1MA 2MD7B 1Z60A 5TBNA 3H7HA 2E61A 2RI7A 2C2VS 2CONA 3GL6A 2CRWA 5LKZA 3L11A 4QQ4A 4YABA 2D8SA 1V87A 4PTBA 4GNFA 2LV9A 3FJUB 3SHBA 3M62A 2F6JA 5FB0A 2KWJA 2KREA 4FK5A 2VP7A 2FUIA 3N9LA 2Y43A 4OGEA 2BAYA 1VD4A 3L1ZB 2MIQA 2XOCA 1WEEA 3EB5A 1WEQA 1N87A 2YW8A 3O34A 2EA6A 2ZETC 2KIZA 4LK9A 3ZPVE 1WILA 2KWKA 1VYXA 3LJUX 2FUUA 2LGKA 2YSMA 2KWNA 1X4JA 3FEHA 3FANA 4X3GA 2XP0A 4B86C 2CRRA 2RSDA 2LXPC 2M85A 2IQJA 1XWHA 4XI1A 5DINA 3KV6A 4LADB 2H0DA 5LKTA 1MM2A 2MUMA 3T7LA 1LDJB 3LVQE 2CSYA 5B75A 2LAUA 2XB1A 4UI9B 2KGIA 3FAOA 1JOCA 4GNEA 2ECJA 2L75A 1DVPA 4P5OB 3Q1DA 5B79A 3SOUA 1WFKA 2I50A 1WEWA 2YT5A 2LGVA 3RPGB 1LDKC 1WESA 2DX8A 3N9NA 2G6QA 4B7YC 5K3QA 2ECGA 1RMDA 2XOYA 4Q6FA 2HYED 4YATA 3SOWA 2VJEB 2QIZA 3DWDA 2JUNA 4Z0RA 3HTKC 2KYUA 4CA1A 3U5OA 4I7BA 5DKAA 2L80A 2PUYA 2EODA 2FD4A 2KWOA 1WGMA 5TRBA 3U5NA 2F42A 4O64A 5FERA 4F52B 4UP0A 4TKPB 2LN0A 2B0OE 3LQIA 2FSAA 5D1MB 1JM7A 4LJNA 4YC9A 3EB6A 3HCTA 3N9QA 5LKUA 2K4DA 2YQLA 3PHDA 2L7PA 2LGGA 1Z2QA 2MNZA 3FM8C 2MNYA 2YURA 2L43A 3HCUA 4V3KC 4FJCA 5J3XA 2YUCA 3RTRB 5H1UA 4YBSA 3MHSA 1X4IA 3ZTGA 2MA5A 4CCGX 3U5PA 4H9DA 5G0FA 4A4CA 1Z6UA 2JMJA 5H1TA 3L1XA 4BHWA 4A49A 4MVTA 3RPGC 4WA6A 4PPEA 3KNVA 4YADA 4ZDTA 2L5UA 3HCSA 2ECNA 2OXQC 4WZ2A 4ZUXU 3LQJA 2C2LA 2MKEA 3I2DA 2OWAA 1U6GB 2M3HA 2YU4A 2IDAA 1MM3A 3ZVZB 3MDBC 2MD8C 1T1HA 1WE9A 2KGGA 1IYMA 4W4UA 2AN6A 4FO9A 2NAAA 3V43A 4YBMA 2LXHC 1JM7B 4AYCB 3NG2A 1WENA 2KKYA 2EGPA 2VJEA
chains in the Genus database with same CATH topology
5TDRA 2F6NA 3N9PA 5AIUA 5G04B 3ZNIA 5B78A 1WEOA 5G05B 3DPLR 2MT5A 4QF2A 2M6MA 2HDPA 1ZBDB 2QICA 4R2YA 1HYJA 3M99A 2VPGA 3T6RA 5LKXA 2YQMA 2CT2A 4WZ0A 2XEUA 3N9OA 4V3LC 2KFTA 4GNGA 1WEPA 1FBVA 5TABA 4LKAA 4I7DA 3O7AA 3ZYQA 2K16A 3O70A 3FL2A 4IC2A 2E6RA 2KE1A 2CKLA 2G45A 4IC3A 2ECIA 2UZGA 5B8DA 4AVXA 4L58A 1FP0A 2ECWA 4YAXA 2PNXA 2MA6A 2KR4A 4C9ZA 2JMIA 2H0DB 4S3OC 1CHCA 4AUQB 1WIMA 3ZPV1 5I3LA 2LQ6A 2ECVA 3O35A 2VPEA 3C5KA 5KH9A 2Y1NA 4YBTA 5C13A 1HYIA 3N9MA 4GNDA 4AYCA 2LGLA 2YREA 3KV5A 4R7EA 5LCWB 3SOXA 5B77A 2VNFA 4WZ3B 3IHPA 2JMDA 3PURA 5FB1A 3ZVYA 5D1KB 2YSJA 1BORA 2VPBA 2G43A 1WEVA 3O33A 2K17A 2VJFA 1E4UA 2L0BA 4BBQA 2CKLB 4L7XA 3MHHA 3ASLA 3C6WA 4FIPA 2QJ0A 4S3OB 2YHOA 2CSZA 2VJFB 3M63A 4NN2A 3PUQA 1G25A 3LRQA 4MSXA 5EYAF 4GB0A 1VFYA 2M1RA 1F62A 4R8PK 2K1JA 3DQVR 2E6SA 3GV4A 3O36A 4I7CA 4ZQLA 4A4BA 4AP4A 5AITA 2JRJA 1WEUA 2YHNA 5D1LB 2VPDA 5B76A 1WEMA 5H1VA 2YYRA 3LQHA 4N4FA 2LDRA 4LLBA 4N3WA 2LRIC 5JG6A 5H9MA 3KQIA 5KH3A 3O37A 3QZVA 1X4UA 4QF3A 4A0CD 5FEYA 3U5MA 4UP5A 2ECTA 1K2FA 3VK6A 5KH7A 5TDWA 5C11A 2KU3A 2Y1MA 2MD7B 1Z60A 5TBNA 2RI7A 2C2VS 3GL6A 5LKZA 3L11A 4YABA 2D8SA 1V87A 4PTBA 4GNFA 2LV9A 3SHBA 3M62A 2F6JA 5FB0A 2KWJA 2KREA 4FK5A 2VP7A 2FUIA 3N9LA 2Y43A 2BAYA 1VD4A 3L1ZB 2MIQA 1WEEA 3EB5A 1WEQA 1N87A 2YW8A 3O34A 2EA6A 2ZETC 2KIZA 4LK9A 3ZPVE 1WILA 2KWKA 1VYXA 2FUUA 2LGKA 2YSMA 2KWNA 1X4JA 4X3GA 4B86C 2RSDA 2LXPC 2M85A 4XI1A 1XWHA 5DINA 3KV6A 4LADB 2H0DA 5LKTA 1MM2A 2MUMA 3T7LA 1LDJB 2CSYA 5B75A 2XB1A 4UI9B 2KGIA 1JOCA 4GNEA 2ECJA 2L75A 1DVPA 4P5OB 5B79A 3SOUA 1WFKA 2I50A 1WEWA 2YT5A 2LGVA 3RPGB 1LDKC 1WESA 2DX8A 3N9NA 2G6QA 4B7YC 2ECGA 1RMDA 4Q6FA 2HYED 4YATA 3SOWA 2VJEB 2QIZA 3HTKC 2KYUA 4CA1A 3U5OA 4I7BA 5DKAA 2L80A 2PUYA 2EODA 2KWOA 1WGMA 5TRBA 3U5NA 2F42A 4O64A 5FERA 4F52B 4UP0A 4TKPB 2LN0A 3LQIA 2FSAA 5D1MB 1JM7A 4LJNA 4YC9A 3EB6A 3HCTA 3N9QA 5LKUA 2K4DA 2YQLA 3PHDA 2LGGA 1Z2QA 2MNZA 2MNYA 2YURA 2L43A 3HCUA 4V3KC 4FJCA 5J3XA 2YUCA 3RTRB 5H1UA 4YBSA 3MHSA 1X4IA 3ZTGA 2MA5A 4CCGX 3U5PA 5G0FA 4A4CA 1Z6UA 2JMJA 5H1TA 3L1XA 4BHWA 4A49A 4MVTA 3RPGC 4WA6A 4PPEA 3KNVA 4YADA 4ZDTA 2L5UA 3HCSA 2ECNA 2OXQC 4WZ2A 4ZUXU 3LQJA 2C2LA 3I2DA 1U6GB 2M3HA 2YU4A 2IDAA 1MM3A 3ZVZB 2MD8C 1T1HA 1WE9A 2KGGA 1IYMA 4W4UA 2AN6A 4FO9A 2NAAA 3V43A 4YBMA 2LXHC 1JM7B 4AYCB 3NG2A 1WENA 2EGPA 2VJEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TDR A;  2F6N A;  3N9P A;  5AIU A;  5G04 B;  3ZNI A;  5B78 A;  1WEO A;  5G05 B;  3DPL R;  2MT5 A;  4QF2 A;  2M6M A;  2HDP A;  1ZBD B;  2QIC A;  4R2Y A;  1HYJ A;  3M99 A;  2VPG A;  3T6R A;  5LKX A;  2YQM A;  2CT2 A;  4WZ0 A;  2XEU A;  3N9O A;  4V3L C;  2KFT A;  4GNG A;  1WEP A;  1FBV A;  5TAB A;  4LKA A;  4I7D A;  3O7A A;  3ZYQ A;  2K16 A;  3O70 A;  3FL2 A;  4IC2 A;  2E6R A;  2KE1 A;  2CKL A;  2G45 A;  4IC3 A;  2ECI A;  2UZG A;  5B8D A;  4AVX A;  4L58 A;  1FP0 A;  2ECW A;  4YAX A;  2PNX A;  2MA6 A;  2KR4 A;  4C9Z A;  2JMI A;  2H0D B;  4S3O C;  1CHC A;  4AUQ B;  1WIM A;  3ZPV 1;  5I3L A;  2LQ6 A;  2ECV A;  3O35 A;  2VPE A;  3C5K A;  5KH9 A;  2Y1N A;  4YBT A;  5C13 A;  1HYI A;  3N9M A;  4GND A;  4AYC A;  2LGL A;  2YRE A;  3KV5 A;  4R7E A;  5LCW B;  3SOX A;  5B77 A;  2VNF A;  4WZ3 B;  3IHP A;  2JMD A;  3PUR A;  5FB1 A;  3ZVY A;  5D1K B;  2YSJ A;  1BOR A;  2VPB A;  2G43 A;  1WEV A;  3O33 A;  2K17 A;  2VJF A;  1E4U A;  2L0B A;  4BBQ A;  2CKL B;  4L7X A;  3MHH A;  3ASL A;  3C6W A;  4FIP A;  2QJ0 A;  4S3O B;  2YHO A;  2CSZ A;  2VJF B;  3M63 A;  4NN2 A;  3PUQ A;  1G25 A;  3LRQ A;  4MSX A;  5EYA F;  4GB0 A;  1VFY A;  2M1R A;  1F62 A;  4R8P K;  2K1J A;  3DQV R;  2E6S A;  3GV4 A;  3O36 A;  4I7C A;  4ZQL A;  4A4B A;  4AP4 A;  5AIT A;  2JRJ A;  1WEU A;  2YHN A;  5D1L B;  2VPD A;  5B76 A;  1WEM A;  5H1V A;  2YYR A;  3LQH A;  4N4F A;  2LDR A;  4LLB A;  4N3W A;  2LRI C;  5JG6 A;  5H9M A;  3KQI A;  5KH3 A;  3O37 A;  3QZV A;  1X4U A;  4QF3 A;  4A0C D;  5FEY A;  3U5M A;  4UP5 A;  2ECT A;  1K2F A;  3VK6 A;  5KH7 A;  5TDW A;  5C11 A;  2KU3 A;  2Y1M A;  2MD7 B;  1Z60 A;  5TBN A;  2RI7 A;  2C2V S;  3GL6 A;  5LKZ A;  3L11 A;  4YAB A;  2D8S A;  1V87 A;  4PTB A;  4GNF A;  2LV9 A;  3SHB A;  3M62 A;  2F6J A;  5FB0 A;  2KWJ A;  2KRE A;  4FK5 A;  2VP7 A;  2FUI A;  3N9L A;  2Y43 A;  2BAY A;  1VD4 A;  3L1Z B;  2MIQ A;  1WEE A;  3EB5 A;  1WEQ A;  1N87 A;  2YW8 A;  3O34 A;  2EA6 A;  2ZET C;  2KIZ A;  4LK9 A;  3ZPV E;  1WIL A;  2KWK A;  1VYX A;  2FUU A;  2LGK A;  2YSM A;  2KWN A;  1X4J A;  4X3G A;  4B86 C;  2RSD A;  2LXP C;  2M85 A;  4XI1 A;  1XWH A;  5DIN A;  3KV6 A;  4LAD B;  2H0D A;  5LKT A;  1MM2 A;  2MUM A;  3T7L A;  1LDJ B;  2CSY A;  5B75 A;  2XB1 A;  4UI9 B;  2KGI A;  1JOC A;  4GNE A;  2ECJ A;  2L75 A;  1DVP A;  4P5O B;  5B79 A;  3SOU A;  1WFK A;  2I50 A;  1WEW A;  2YT5 A;  2LGV A;  3RPG B;  1LDK C;  1WES A;  2DX8 A;  3N9N A;  2G6Q A;  4B7Y C;  2ECG A;  1RMD A;  4Q6F A;  2HYE D;  4YAT A;  3SOW A;  2VJE B;  2QIZ A;  3HTK C;  2KYU A;  4CA1 A;  3U5O A;  4I7B A;  5DKA A;  2L80 A;  2PUY A;  2EOD A;  2KWO A;  1WGM A;  5TRB A;  3U5N A;  2F42 A;  4O64 A;  5FER A;  4F52 B;  4UP0 A;  4TKP B;  2LN0 A;  3LQI A;  2FSA A;  5D1M B;  1JM7 A;  4LJN A;  4YC9 A;  3EB6 A;  3HCT A;  3N9Q A;  5LKU A;  2K4D A;  2YQL A;  3PHD A;  2LGG A;  1Z2Q A;  2MNZ A;  2MNY A;  2YUR A;  2L43 A;  3HCU A;  4V3K C;  4FJC A;  5J3X A;  2YUC A;  3RTR B;  5H1U A;  4YBS A;  3MHS A;  1X4I A;  3ZTG A;  2MA5 A;  4CCG X;  3U5P A;  5G0F A;  4A4C A;  1Z6U A;  2JMJ A;  5H1T A;  3L1X A;  4BHW A;  4A49 A;  4MVT A;  3RPG C;  4WA6 A;  4PPE A;  3KNV A;  4YAD A;  4ZDT A;  2L5U A;  3HCS A;  2ECN A;  2OXQ C;  4WZ2 A;  4ZUX U;  3LQJ A;  2C2L A;  3I2D A;  1U6G B;  2M3H A;  2YU4 A;  2IDA A;  1MM3 A;  3ZVZ B;  2MD8 C;  1T1H A;  1WE9 A;  2KGG A;  1IYM A;  4W4U A;  2AN6 A;  4FO9 A;  2NAA A;  3V43 A;  4YBM A;  2LXH C;  1JM7 B;  4AYC B;  3NG2 A;  1WEN A;  2EGP A;  2VJE A; 
#chains in the Genus database with same CATH topology
 5TDR A;  2F6N A;  3N9P A;  5AIU A;  5G04 B;  3ZNI A;  5B78 A;  1WEO A;  5G05 B;  3DPL R;  2MT5 A;  4QF2 A;  2M6M A;  1MBM A;  2HDP A;  1ZBD B;  2QIC A;  4R2Y A;  1HYJ A;  3M99 A;  2VPG A;  3T6R A;  5LKX A;  2YQM A;  2CT2 A;  4WZ0 A;  2XEU A;  3N9O A;  4V3L C;  2KFT A;  4GNG A;  1WEP A;  1FBV A;  5TAB A;  4LKA A;  4I7D A;  3O7A A;  3ZYQ A;  2K16 A;  3O70 A;  3FL2 A;  4IC2 A;  2E6R A;  2KKX A;  2KE1 A;  2CKL A;  2G45 A;  4IC3 A;  2JM3 A;  2ECI A;  2UZG A;  5B8D A;  3M7K A;  4AVX A;  4L58 A;  1FP0 A;  2ECW A;  4YAX A;  2PNX A;  2MA6 A;  2KR4 A;  4C9Z A;  2JMI A;  2H0D B;  4S3O C;  1CHC A;  4AUQ B;  1WIM A;  3ZPV 1;  5I3L A;  2LQ6 A;  2ECV A;  3O35 A;  2VPE A;  3C5K A;  5KH9 A;  2Y1N A;  3T9K A;  4YBT A;  5C13 A;  1HYI A;  3JUE A;  3N9M A;  4GND A;  4AYC A;  2P57 A;  2LGL A;  2YRE A;  2YVR A;  3KV5 A;  4R7E A;  5LCW B;  3SOX A;  5B77 A;  2VNF A;  4WZ3 B;  3PLW A;  3IHP A;  2JMD A;  3PUR A;  5FB1 A;  3SUB A;  3ZVY A;  5D1K B;  2YSJ A;  3LDY A;  2EXU A;  1BOR A;  2VPB A;  5SVY A;  2G43 A;  1WEV A;  3O33 A;  2D8U A;  2K17 A;  4O62 A;  2VJF A;  2EGM A;  1E4U A;  5SVI B;  2L0B A;  4BBQ A;  4F1P A;  2CKL B;  4L7X A;  3MHH A;  1DCQ A;  3ASL A;  3C6W A;  4FIP A;  2QJ0 A;  4S3O B;  2YHO A;  5SVX A;  2CSZ A;  2VJF B;  3M63 A;  4NN2 A;  3PUQ A;  1G25 A;  3LRQ A;  4MSX A;  5EYA F;  2DJA A;  4GB0 A;  1VFY A;  2M1R A;  3DDT A;  4Z0O A;  1F62 A;  2XOZ A;  4R8P K;  2DSM A;  2K1J A;  3DQV R;  2E6S A;  3GV4 A;  4ZQL A;  3O36 A;  4I7C A;  4A4B A;  4AP4 A;  5AIT A;  2JRJ A;  2M13 A;  1WEU A;  2YHN A;  5D1L B;  2RR4 A;  2VPD A;  5B76 A;  1WEM A;  5H1V A;  2YYR A;  3LQH A;  4N4F A;  4OGC A;  2LDR A;  2CSV A;  4LLB A;  2FFW A;  3O47 A;  4N3W A;  2LRI C;  3LVR E;  5JG6 A;  5H9M A;  3KQI A;  5KH3 A;  3O37 A;  3QZV A;  1X4U A;  4QF3 A;  4A0C D;  5FEY A;  3E2D A;  3U5M A;  4UP5 A;  2ECT A;  3KDE C;  1K2F A;  3VK6 A;  5KH7 A;  5TDW A;  5C11 A;  5SVI A;  2KU3 A;  2Y1M A;  2MD7 B;  1Z60 A;  5TBN A;  3H7H A;  2E61 A;  2RI7 A;  2C2V S;  2CON A;  3GL6 A;  2CRW A;  5LKZ A;  3L11 A;  4QQ4 A;  4YAB A;  2D8S A;  1V87 A;  4PTB A;  4GNF A;  2LV9 A;  3FJU B;  3SHB A;  3M62 A;  2F6J A;  5FB0 A;  2KWJ A;  2KRE A;  4FK5 A;  2VP7 A;  2FUI A;  3N9L A;  2Y43 A;  4OGE A;  2BAY A;  1VD4 A;  3L1Z B;  2MIQ A;  2XOC A;  1WEE A;  3EB5 A;  1WEQ A;  1N87 A;  2YW8 A;  3O34 A;  2EA6 A;  2ZET C;  2KIZ A;  4LK9 A;  3ZPV E;  1WIL A;  2KWK A;  1VYX A;  3LJU X;  2FUU A;  2LGK A;  2YSM A;  2KWN A;  1X4J A;  3FEH A;  3FAN A;  4X3G A;  2XP0 A;  4B86 C;  2CRR A;  2RSD A;  2LXP C;  2M85 A;  2IQJ A;  1XWH A;  4XI1 A;  5DIN A;  3KV6 A;  4LAD B;  2H0D A;  5LKT A;  1MM2 A;  2MUM A;  3T7L A;  1LDJ B;  3LVQ E;  2CSY A;  5B75 A;  2LAU A;  2XB1 A;  4UI9 B;  2KGI A;  3FAO A;  1JOC A;  4GNE A;  2ECJ A;  2L75 A;  1DVP A;  4P5O B;  3Q1D A;  5B79 A;  3SOU A;  1WFK A;  2I50 A;  1WEW A;  2YT5 A;  2LGV A;  3RPG B;  1LDK C;  1WES A;  2DX8 A;  3N9N A;  2G6Q A;  4B7Y C;  5K3Q A;  2ECG A;  1RMD A;  2XOY A;  4Q6F A;  2HYE D;  4YAT A;  3SOW A;  2VJE B;  2QIZ A;  3DWD A;  2JUN A;  4Z0R A;  3HTK C;  2KYU A;  4CA1 A;  3U5O A;  4I7B A;  5DKA A;  2L80 A;  2PUY A;  2EOD A;  2FD4 A;  2KWO A;  1WGM A;  5TRB A;  3U5N A;  2F42 A;  4O64 A;  5FER A;  4F52 B;  4UP0 A;  4TKP B;  2LN0 A;  2B0O E;  3LQI A;  2FSA A;  5D1M B;  1JM7 A;  4LJN A;  4YC9 A;  3EB6 A;  3HCT A;  3N9Q A;  5LKU A;  2K4D A;  2YQL A;  3PHD A;  2L7P A;  2LGG A;  1Z2Q A;  2MNZ A;  3FM8 C;  2MNY A;  2YUR A;  2L43 A;  3HCU A;  4V3K C;  4FJC A;  5J3X A;  2YUC A;  3RTR B;  5H1U A;  4YBS A;  3MHS A;  1X4I A;  3ZTG A;  2MA5 A;  4CCG X;  3U5P A;  4H9D A;  5G0F A;  4A4C A;  1Z6U A;  2JMJ A;  5H1T A;  3L1X A;  4BHW A;  4A49 A;  4MVT A;  3RPG C;  4WA6 A;  4PPE A;  3KNV A;  4YAD A;  4ZDT A;  2L5U A;  3HCS A;  2ECN A;  2OXQ C;  4WZ2 A;  4ZUX U;  3LQJ A;  2C2L A;  2MKE A;  3I2D A;  2OWA A;  1U6G B;  2M3H A;  2YU4 A;  2IDA A;  1MM3 A;  3ZVZ B;  3MDB C;  2MD8 C;  1T1H A;  1WE9 A;  2KGG A;  1IYM A;  4W4U A;  2AN6 A;  4FO9 A;  2NAA A;  3V43 A;  4YBM A;  2LXH C;  1JM7 B;  4AYC B;  3NG2 A;  1WEN A;  2KKY A;  2EGP A;  2VJE A; 
#chains in the Genus database with same CATH homology
 5TDR A;  2F6N A;  3N9P A;  5AIU A;  5G04 B;  3ZNI A;  5B78 A;  1WEO A;  5G05 B;  3DPL R;  2MT5 A;  4QF2 A;  2M6M A;  2HDP A;  1ZBD B;  2QIC A;  4R2Y A;  1HYJ A;  3M99 A;  2VPG A;  3T6R A;  5LKX A;  2YQM A;  2CT2 A;  4WZ0 A;  2XEU A;  3N9O A;  4V3L C;  2KFT A;  4GNG A;  1WEP A;  1FBV A;  5TAB A;  4LKA A;  4I7D A;  3O7A A;  3ZYQ A;  2K16 A;  3O70 A;  3FL2 A;  4IC2 A;  2E6R A;  2KE1 A;  2CKL A;  2G45 A;  4IC3 A;  2ECI A;  2UZG A;  5B8D A;  4AVX A;  4L58 A;  1FP0 A;  2ECW A;  4YAX A;  2PNX A;  2MA6 A;  2KR4 A;  4C9Z A;  2JMI A;  2H0D B;  4S3O C;  1CHC A;  4AUQ B;  1WIM A;  3ZPV 1;  5I3L A;  2LQ6 A;  2ECV A;  3O35 A;  2VPE A;  3C5K A;  5KH9 A;  2Y1N A;  4YBT A;  5C13 A;  1HYI A;  3N9M A;  4GND A;  4AYC A;  2LGL A;  2YRE A;  3KV5 A;  4R7E A;  5LCW B;  3SOX A;  5B77 A;  2VNF A;  4WZ3 B;  3IHP A;  2JMD A;  3PUR A;  5FB1 A;  3ZVY A;  5D1K B;  2YSJ A;  1BOR A;  2VPB A;  2G43 A;  1WEV A;  3O33 A;  2K17 A;  2VJF A;  1E4U A;  2L0B A;  4BBQ A;  2CKL B;  4L7X A;  3MHH A;  3ASL A;  3C6W A;  4FIP A;  2QJ0 A;  4S3O B;  2YHO A;  2CSZ A;  2VJF B;  3M63 A;  4NN2 A;  3PUQ A;  1G25 A;  3LRQ A;  4MSX A;  5EYA F;  4GB0 A;  1VFY A;  2M1R A;  1F62 A;  4R8P K;  2K1J A;  3DQV R;  2E6S A;  3GV4 A;  3O36 A;  4I7C A;  4ZQL A;  4A4B A;  4AP4 A;  5AIT A;  2JRJ A;  1WEU A;  2YHN A;  5D1L B;  2VPD A;  5B76 A;  1WEM A;  5H1V A;  2YYR A;  3LQH A;  4N4F A;  2LDR A;  4LLB A;  4N3W A;  2LRI C;  5JG6 A;  5H9M A;  3KQI A;  5KH3 A;  3O37 A;  3QZV A;  1X4U A;  4QF3 A;  4A0C D;  5FEY A;  3U5M A;  4UP5 A;  2ECT A;  1K2F A;  3VK6 A;  5KH7 A;  5TDW A;  5C11 A;  2KU3 A;  2Y1M A;  2MD7 B;  1Z60 A;  5TBN A;  2RI7 A;  2C2V S;  3GL6 A;  5LKZ A;  3L11 A;  4YAB A;  2D8S A;  1V87 A;  4PTB A;  4GNF A;  2LV9 A;  3SHB A;  3M62 A;  2F6J A;  5FB0 A;  2KWJ A;  2KRE A;  4FK5 A;  2VP7 A;  2FUI A;  3N9L A;  2Y43 A;  2BAY A;  1VD4 A;  3L1Z B;  2MIQ A;  1WEE A;  3EB5 A;  1WEQ A;  1N87 A;  2YW8 A;  3O34 A;  2EA6 A;  2ZET C;  2KIZ A;  4LK9 A;  3ZPV E;  1WIL A;  2KWK A;  1VYX A;  2FUU A;  2LGK A;  2YSM A;  2KWN A;  1X4J A;  4X3G A;  4B86 C;  2RSD A;  2LXP C;  2M85 A;  4XI1 A;  1XWH A;  5DIN A;  3KV6 A;  4LAD B;  2H0D A;  5LKT A;  1MM2 A;  2MUM A;  3T7L A;  1LDJ B;  2CSY A;  5B75 A;  2XB1 A;  4UI9 B;  2KGI A;  1JOC A;  4GNE A;  2ECJ A;  2L75 A;  1DVP A;  4P5O B;  5B79 A;  3SOU A;  1WFK A;  2I50 A;  1WEW A;  2YT5 A;  2LGV A;  3RPG B;  1LDK C;  1WES A;  2DX8 A;  3N9N A;  2G6Q A;  4B7Y C;  2ECG A;  1RMD A;  4Q6F A;  2HYE D;  4YAT A;  3SOW A;  2VJE B;  2QIZ A;  3HTK C;  2KYU A;  4CA1 A;  3U5O A;  4I7B A;  5DKA A;  2L80 A;  2PUY A;  2EOD A;  2KWO A;  1WGM A;  5TRB A;  3U5N A;  2F42 A;  4O64 A;  5FER A;  4F52 B;  4UP0 A;  4TKP B;  2LN0 A;  3LQI A;  2FSA A;  5D1M B;  1JM7 A;  4LJN A;  4YC9 A;  3EB6 A;  3HCT A;  3N9Q A;  5LKU A;  2K4D A;  2YQL A;  3PHD A;  2LGG A;  1Z2Q A;  2MNZ A;  2MNY A;  2YUR A;  2L43 A;  3HCU A;  4V3K C;  4FJC A;  5J3X A;  2YUC A;  3RTR B;  5H1U A;  4YBS A;  3MHS A;  1X4I A;  3ZTG A;  2MA5 A;  4CCG X;  3U5P A;  5G0F A;  4A4C A;  1Z6U A;  2JMJ A;  5H1T A;  3L1X A;  4BHW A;  4A49 A;  4MVT A;  3RPG C;  4WA6 A;  4PPE A;  3KNV A;  4YAD A;  4ZDT A;  2L5U A;  3HCS A;  2ECN A;  2OXQ C;  4WZ2 A;  4ZUX U;  3LQJ A;  2C2L A;  3I2D A;  1U6G B;  2M3H A;  2YU4 A;  2IDA A;  1MM3 A;  3ZVZ B;  2MD8 C;  1T1H A;  1WE9 A;  2KGG A;  1IYM A;  4W4U A;  2AN6 A;  4FO9 A;  2NAA A;  3V43 A;  4YBM A;  2LXH C;  1JM7 B;  4AYC B;  3NG2 A;  1WEN A;  2EGP A;  2VJE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...