2G43A

Structure of the znf ubp domain from deubiquitinating enzyme isopeptidase t (isot)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
117
structure length
117
Chain Sequence
WDGEVRQVSKHAFSLKQLDNPARIPPCGWKCSKCDMRENLWLNLTDGSILCGRRYFDGSGGNNHAVEHYRETGYPLAVKLGTITPDGADVYSYDEDDMVLDPSLAEHLSHFGIDMLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ubiquitin carboxyl-terminal hydrolase 5
publication title The Ubiquitin Binding Domain ZnF UBP Recognizes the C-Terminal Diglycine Motif of Unanchored Ubiquitin.
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 117
sequence length 117
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2006-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2g43A01
3LQIA 2CSYA 2L5UA 5FERA 3MHSA 3L1XA 2LV9A 2LGKA 2LXHC 4V3LC 4W4UA 4O64A 4S3OC 1WENA 3HTKC 3C5KA 1E4UA 4LLBA 1FP0A 4BHWA 5B76A 2NAAA 5G05B 2MD8C 2JRJA 3SOXA 3O70A 1N87A 2L75A 3SOUA 3M99A 5D1MB 3GL6A 2EA6A 5FB0A 5LKXA 2F42A 3C6WA 2KYUA 2M1RA 5TBNA 2PNXA 3M63A 2G45A 2L43A 4WZ2A 4AYCB 3L1ZB 2YHNA 3O37A 2H0DA 2YUCA 4CCGX 3T7LA 1Z2QA 2G6QA 4YAXA 4GNGA 2FSAA 2ECNA 3M62A 5KH7A 2XB1A 1WEOA 2AN6A 3IHPA 2F6JA 1WILA 2ECWA 4WZ3B 4ZQLA 1HYIA 4S3OB 1WEWA 1CHCA 1WGMA 2KIZA 5FEYA 1Z6UA 3LQHA 4V3KC 4YBSA 2G43A 3LQJA 2LRIC 1HYJA 4TKPB 3LRQA 3HCTA 4YATA 2KWKA 2ECVA 4NN2A 4AP4A 3N9LA 2E6RA 5G04B 1X4IA 2OXQC 4YABA 2QJ0A 2YHOA 4P5OB 4ZUXU 4R8PK 2VJFB 2MIQA 1X4UA 5B78A 3GV4A 4R2YA 4YBMA 1IYMA 2KWOA 4GNDA 5TDWA 4IC3A 4QF2A 2XEUA 2KGIA 5TRBA 1V87A 4Q6FA 2F6NA 3ZPV1 5EYAF 4PTBA 5D1LB 3EB6A 2HYED 5DINA 2VPBA 5DKAA 3I2DA 2I50A 4LKAA 5KH3A 2CKLB 2HDPA 2L80A 5B79A 3ZNIA 4A4BA 3ASLA 3U5MA 1WEMA 2ZETC 1F62A 5I3LA 2MA6A 1ZBDB 3RPGC 2ECGA 2FUUA 2KWNA 1XWHA 1VD4A 2UZGA 2VJEB 3SOWA 4N4FA 2E6SA 4X3GA 3ZPVE 3N9MA 2YQMA 3FL2A 2BAYA 5H1UA 2CSZA 2VNFA 3PUQA 1WEVA 4FK5A 2KWJA 4UP5A 2D8SA 2K16A 2EODA 2K1JA 1RMDA 5FB1A 4L58A 4I7CA 5LCWB 2KR4A 4N3WA 3DPLR 3KV6A 1WEEA 3HCSA 5B77A 2KGGA 4I7DA 1JM7B 3U5NA 3O7AA 4FJCA 4MSXA 3O36A 2MUMA 1G25A 4QF3A 3RPGB 2LGVA 2YYRA 1WIMA 2VP7A 5B8DA 2ECJA 5AIUA 5LKUA 2M3HA 2YW8A 2JMIA 3PURA 3N9PA 2YREA 1WFKA 2K17A 3HCUA 4MVTA 4YC9A 2RI7A 4YADA 2YSMA 3ZVYA 2MD7B 3ZVZB 3KV5A 5H1TA 2YT5A 2LGLA 4AYCA 4CA1A 3ZTGA 2M85A 5KH9A 4AVXA 5J3XA 2IDAA 3N9OA 2RSDA 1WEQA 4FO9A 4XI1A 2CT2A 2H0DB 3PHDA 4FIPA 2YQLA 4LJNA 1BORA 4L7XA 3N9NA 1MM3A 3RTRB 1X4JA 5TDRA 2C2VS 2KE1A 5TABA 2YURA 2VPGA 2Y43A 1WEUA 5C11A 2PUYA 3ZYQA 4I7BA 2MNZA 2Y1NA 3O35A 1DVPA 2EGPA 4R7EA 2ECTA 2Y1MA 3KQIA 1WESA 2FUIA 2DX8A 2VJFA 2KFTA 3O33A 3O34A 3V43A 1Z60A 1VYXA 3MHHA 5LKTA 2KREA 3EB5A 4A4CA 4LK9A 2VPDA 5H1VA 3NG2A 4BBQA 4YBTA 4WZ0A 3KNVA 2L0BA 4B86C 1K2FA 3SHBA 2YU4A 3DQVR 3U5PA 1WEPA 2CKLA 2JMJA 4ZDTA 2MNYA 5C13A 2QIZA 1U6GB 4F52B 5B75A 2ECIA 4GNEA 5H9MA 2K4DA 2KU3A 2LDRA 3N9QA 2QICA 2VJEA 1LDKC 2LN0A 4GNFA 4AUQB 2M6MA 5JG6A 4WA6A 2MT5A 1FBVA 4GB0A 2MA5A 1MM2A 3U5OA 4UP0A 5LKZA 2VPEA 4IC2A 1VFYA 3T6RA 2LQ6A 4C9ZA 4PPEA 4A49A 1JOCA 1LDJB 4B7YC 3L11A 2YSJA 5G0FA 3VK6A 2C2LA 4LADB 5D1KB 5AITA 1JM7A 4UI9B 4A0CD 3QZVA 2LXPC 2JMDA 1WE9A 2LGGA 1T1HA
chains in the Genus database with same CATH superfamily
3LQIA 2CSYA 2L5UA 5FERA 3MHSA 3L1XA 2LV9A 2LGKA 2LXHC 4V3LC 4F1PA 2E61A 4W4UA 4O64A 4S3OC 1WENA 3HTKC 3C5KA 1E4UA 4LLBA 3T9KA 1FP0A 4BHWA 5B76A 2NAAA 5G05B 2MD8C 2JRJA 3SOXA 3O70A 1N87A 2L75A 3SOUA 3M99A 5D1MB 3GL6A 2EA6A 5FB0A 5LKXA 2F42A 3C6WA 2KYUA 2M1RA 5TBNA 2XP0A 2PNXA 3M63A 2G45A 2L43A 4WZ2A 3LVQE 4AYCB 3L1ZB 2YHNA 3O37A 2H0DA 2YUCA 4CCGX 2JM3A 3T7LA 1Z2QA 2G6QA 4YAXA 4GNGA 2FSAA 2ECNA 3M62A 5KH7A 2XB1A 1WEOA 2AN6A 3IHPA 2F6JA 1WILA 2ECWA 4WZ3B 4ZQLA 1HYIA 4S3OB 1WEWA 1CHCA 5SVYA 1WGMA 2KIZA 5FEYA 1Z6UA 3LQHA 4V3KC 5SVXA 4YBSA 2G43A 3LQJA 3E2DA 2LRIC 1HYJA 4TKPB 3LRQA 3HCTA 4YATA 2YVRA 2KWKA 4NN2A 2ECVA 2P57A 4AP4A 3DDTA 3N9LA 2E6RA 5G04B 1X4IA 2OXQC 3FEHA 2CRWA 4YABA 2QJ0A 2YHOA 4P5OB 4ZUXU 4R8PK 2VJFB 2MIQA 5SVIB 1X4UA 5B78A 3GV4A 4R2YA 4YBMA 1IYMA 2KWOA 4GNDA 5TDWA 4IC3A 4O62A 3LJUX 4QF2A 3SUBA 2XEUA 2KGIA 3LVRE 5TRBA 1V87A 4Q6FA 2F6NA 3ZPV1 5EYAF 4PTBA 5D1LB 3EB6A 2HYED 5DINA 2VPBA 5DKAA 3I2DA 2I50A 4LKAA 2XOZA 5KH3A 2CKLB 2HDPA 2L80A 2D8UA 5B79A 2MKEA 3ZNIA 4A4BA 3ASLA 3U5MA 1WEMA 2ZETC 1F62A 5I3LA 2MA6A 1ZBDB 3RPGC 2EGMA 2ECGA 2FUUA 2KWNA 1XWHA 1VD4A 3H7HA 2UZGA 2VJEB 3SOWA 4N4FA 2E6SA 4X3GA 3ZPVE 3N9MA 2EXUA 2IQJA 2YQMA 3FL2A 2BAYA 5H1UA 2CSZA 2VNFA 3PUQA 1WEVA 4FK5A 2KWJA 4UP5A 2D8SA 2K16A 2EODA 2K1JA 1RMDA 3Q1DA 5FB1A 4L58A 4I7CA 5LCWB 2KR4A 4N3WA 4OGEA 3DPLR 3KV6A 1WEEA 3HCSA 2L7PA 4H9DA 5B77A 2KGGA 4I7DA 1JM7B 3U5NA 1MBMA 3O47A 3O7AA 4FJCA 4MSXA 3O36A 2MUMA 1G25A 5K3QA 4QF3A 3RPGB 2LGVA 2YYRA 1WIMA 2DSMA 2B0OE 2VP7A 5B8DA 2ECJA 3FANA 2CRRA 5AIUA 5LKUA 2M3HA 2YW8A 2JMIA 3PURA 3N9PA 4Z0OA 2YREA 1WFKA 2K17A 4OGCA 3HCUA 4MVTA 4YC9A 2RI7A 4YADA 2YSMA 3ZVYA 2MD7B 3MDBC 3ZVZB 3KV5A 5H1TA 2YT5A 2LGLA 2CONA 4AYCA 4CA1A 3ZTGA 2M85A 5KH9A 4AVXA 5J3XA 2IDAA 3N9OA 2RSDA 1WEQA 2FFWA 2KKXA 4FO9A 4XI1A 2CT2A 2H0DB 3PHDA 4FIPA 2YQLA 4LJNA 1BORA 2XOCA 4L7XA 3N9NA 2CSVA 1MM3A 3RTRB 1X4JA 5TDRA 2C2VS 2KE1A 5TABA 2YURA 2VPGA 2Y43A 1WEUA 5C11A 2PUYA 3ZYQA 4I7BA 2LAUA 2MNZA 2Y1NA 3O35A 1DVPA 3M7KA 2EGPA 4R7EA 2ECTA 2Y1MA 3KQIA 1WESA 2FUIA 2DX8A 2VJFA 2KFTA 3O33A 5SVIA 2FD4A 3O34A 4QQ4A 3V43A 3KDEC 1Z60A 1VYXA 3MHHA 5LKTA 2KREA 3EB5A 4A4CA 4LK9A 2VPDA 3JUEA 3FJUB 5H1VA 3NG2A 4BBQA 2OWAA 2M13A 4WZ0A 4YBTA 3KNVA 4Z0RA 2L0BA 4B86C 1K2FA 3SHBA 2YU4A 3DQVR 3U5PA 2KKYA 1WEPA 2CKLA 2JMJA 4ZDTA 2MNYA 3FM8C 1DCQA 5C13A 2QIZA 1U6GB 4F52B 5B75A 2ECIA 4GNEA 5H9MA 2K4DA 2KU3A 2LDRA 3N9QA 2QICA 2VJEA 1LDKC 2LN0A 4GNFA 2XOYA 4AUQB 3PLWA 2M6MA 5JG6A 4WA6A 2MT5A 1FBVA 4GB0A 2MA5A 3FAOA 1MM2A 3U5OA 4UP0A 5LKZA 2VPEA 4IC2A 2RR4A 1VFYA 3T6RA 2LQ6A 4C9ZA 4PPEA 2DJAA 4A49A 1JOCA 3DWDA 1LDJB 4B7YC 3L11A 2YSJA 5G0FA 3VK6A 3LDYA 2JUNA 2C2LA 4LADB 5D1KB 5AITA 1JM7A 4UI9B 4A0CD 3QZVA 2LXPC 2JMDA 1WE9A 2LGGA 1T1HA
chains in the Genus database with same CATH topology
3LQIA 2CSYA 2L5UA 5FERA 3MHSA 3L1XA 2LV9A 2LGKA 2LXHC 4V3LC 4W4UA 4O64A 4S3OC 1WENA 3HTKC 3C5KA 1E4UA 4LLBA 1FP0A 4BHWA 5B76A 2NAAA 5G05B 2MD8C 2JRJA 3SOXA 3O70A 1N87A 2L75A 3SOUA 3M99A 5D1MB 3GL6A 2EA6A 5FB0A 5LKXA 2F42A 3C6WA 2KYUA 2M1RA 5TBNA 2PNXA 3M63A 2G45A 2L43A 4WZ2A 4AYCB 3L1ZB 2YHNA 3O37A 2H0DA 2YUCA 4CCGX 3T7LA 1Z2QA 2G6QA 4YAXA 4GNGA 2FSAA 2ECNA 3M62A 5KH7A 2XB1A 1WEOA 2AN6A 3IHPA 2F6JA 1WILA 2ECWA 4WZ3B 4ZQLA 1HYIA 4S3OB 1WEWA 1CHCA 1WGMA 2KIZA 5FEYA 1Z6UA 3LQHA 4V3KC 4YBSA 2G43A 3LQJA 2LRIC 1HYJA 4TKPB 3LRQA 3HCTA 4YATA 2KWKA 2ECVA 4NN2A 4AP4A 3N9LA 2E6RA 5G04B 1X4IA 2OXQC 4YABA 2QJ0A 2YHOA 4P5OB 4ZUXU 4R8PK 2VJFB 2MIQA 1X4UA 5B78A 3GV4A 4R2YA 4YBMA 1IYMA 2KWOA 4GNDA 5TDWA 4IC3A 4QF2A 2XEUA 2KGIA 5TRBA 1V87A 4Q6FA 2F6NA 3ZPV1 5EYAF 4PTBA 5D1LB 3EB6A 2HYED 5DINA 2VPBA 5DKAA 3I2DA 2I50A 4LKAA 5KH3A 2CKLB 2HDPA 2L80A 5B79A 3ZNIA 4A4BA 3ASLA 3U5MA 1WEMA 2ZETC 1F62A 5I3LA 2MA6A 1ZBDB 3RPGC 2ECGA 2FUUA 2KWNA 1XWHA 1VD4A 2UZGA 2VJEB 3SOWA 4N4FA 2E6SA 4X3GA 3ZPVE 3N9MA 2YQMA 3FL2A 2BAYA 5H1UA 2CSZA 2VNFA 3PUQA 1WEVA 4FK5A 2KWJA 4UP5A 2D8SA 2K16A 2EODA 2K1JA 1RMDA 5FB1A 4L58A 4I7CA 5LCWB 2KR4A 4N3WA 3DPLR 3KV6A 1WEEA 3HCSA 5B77A 2KGGA 4I7DA 1JM7B 3U5NA 3O7AA 4FJCA 4MSXA 3O36A 2MUMA 1G25A 4QF3A 3RPGB 2LGVA 2YYRA 1WIMA 2VP7A 5B8DA 2ECJA 5AIUA 5LKUA 2M3HA 2YW8A 2JMIA 3PURA 3N9PA 2YREA 1WFKA 2K17A 3HCUA 4MVTA 4YC9A 2RI7A 4YADA 2YSMA 3ZVYA 2MD7B 3ZVZB 3KV5A 5H1TA 2YT5A 2LGLA 4AYCA 4CA1A 3ZTGA 2M85A 5KH9A 4AVXA 5J3XA 2IDAA 3N9OA 2RSDA 1WEQA 4FO9A 4XI1A 2CT2A 2H0DB 3PHDA 4FIPA 2YQLA 4LJNA 1BORA 4L7XA 3N9NA 1MM3A 3RTRB 1X4JA 5TDRA 2C2VS 2KE1A 5TABA 2YURA 2VPGA 2Y43A 1WEUA 5C11A 2PUYA 3ZYQA 4I7BA 2MNZA 2Y1NA 3O35A 1DVPA 2EGPA 4R7EA 2ECTA 2Y1MA 3KQIA 1WESA 2FUIA 2DX8A 2VJFA 2KFTA 3O33A 3O34A 3V43A 1Z60A 1VYXA 3MHHA 5LKTA 2KREA 3EB5A 4A4CA 4LK9A 2VPDA 5H1VA 3NG2A 4BBQA 4YBTA 4WZ0A 3KNVA 2L0BA 4B86C 1K2FA 3SHBA 2YU4A 3DQVR 3U5PA 1WEPA 2CKLA 2JMJA 4ZDTA 2MNYA 5C13A 2QIZA 1U6GB 4F52B 5B75A 2ECIA 4GNEA 5H9MA 2K4DA 2KU3A 2LDRA 3N9QA 2QICA 2VJEA 1LDKC 2LN0A 4GNFA 4AUQB 2M6MA 5JG6A 4WA6A 2MT5A 1FBVA 4GB0A 2MA5A 1MM2A 3U5OA 4UP0A 5LKZA 2VPEA 4IC2A 1VFYA 3T6RA 2LQ6A 4C9ZA 4PPEA 4A49A 1JOCA 1LDJB 4B7YC 3L11A 2YSJA 5G0FA 3VK6A 2C2LA 4LADB 5D1KB 5AITA 1JM7A 4UI9B 4A0CD 3QZVA 2LXPC 2JMDA 1WE9A 2LGGA 1T1HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LQI A;  2CSY A;  2L5U A;  5FER A;  3MHS A;  3L1X A;  2LV9 A;  2LGK A;  2LXH C;  4V3L C;  4W4U A;  4O64 A;  4S3O C;  1WEN A;  3HTK C;  3C5K A;  1E4U A;  4LLB A;  1FP0 A;  4BHW A;  5B76 A;  2NAA A;  5G05 B;  2MD8 C;  2JRJ A;  3SOX A;  3O70 A;  1N87 A;  2L75 A;  3SOU A;  3M99 A;  5D1M B;  3GL6 A;  2EA6 A;  5FB0 A;  5LKX A;  2F42 A;  3C6W A;  2KYU A;  2M1R A;  5TBN A;  2PNX A;  3M63 A;  2G45 A;  2L43 A;  4WZ2 A;  4AYC B;  3L1Z B;  2YHN A;  3O37 A;  2H0D A;  2YUC A;  4CCG X;  3T7L A;  1Z2Q A;  2G6Q A;  4YAX A;  4GNG A;  2FSA A;  2ECN A;  3M62 A;  5KH7 A;  2XB1 A;  1WEO A;  2AN6 A;  3IHP A;  2F6J A;  1WIL A;  2ECW A;  4WZ3 B;  4ZQL A;  1HYI A;  4S3O B;  1WEW A;  1CHC A;  1WGM A;  2KIZ A;  5FEY A;  1Z6U A;  3LQH A;  4V3K C;  4YBS A;  2G43 A;  3LQJ A;  2LRI C;  1HYJ A;  4TKP B;  3LRQ A;  3HCT A;  4YAT A;  2KWK A;  2ECV A;  4NN2 A;  4AP4 A;  3N9L A;  2E6R A;  5G04 B;  1X4I A;  2OXQ C;  4YAB A;  2QJ0 A;  2YHO A;  4P5O B;  4ZUX U;  4R8P K;  2VJF B;  2MIQ A;  1X4U A;  5B78 A;  3GV4 A;  4R2Y A;  4YBM A;  1IYM A;  2KWO A;  4GND A;  5TDW A;  4IC3 A;  4QF2 A;  2XEU A;  2KGI A;  5TRB A;  1V87 A;  4Q6F A;  2F6N A;  3ZPV 1;  5EYA F;  4PTB A;  5D1L B;  3EB6 A;  2HYE D;  5DIN A;  2VPB A;  5DKA A;  3I2D A;  2I50 A;  4LKA A;  5KH3 A;  2CKL B;  2HDP A;  2L80 A;  5B79 A;  3ZNI A;  4A4B A;  3ASL A;  3U5M A;  1WEM A;  2ZET C;  1F62 A;  5I3L A;  2MA6 A;  1ZBD B;  3RPG C;  2ECG A;  2FUU A;  2KWN A;  1XWH A;  1VD4 A;  2UZG A;  2VJE B;  3SOW A;  4N4F A;  2E6S A;  4X3G A;  3ZPV E;  3N9M A;  2YQM A;  3FL2 A;  2BAY A;  5H1U A;  2CSZ A;  2VNF A;  3PUQ A;  1WEV A;  4FK5 A;  2KWJ A;  4UP5 A;  2D8S A;  2K16 A;  2EOD A;  2K1J A;  1RMD A;  5FB1 A;  4L58 A;  4I7C A;  5LCW B;  2KR4 A;  4N3W A;  3DPL R;  3KV6 A;  1WEE A;  3HCS A;  5B77 A;  2KGG A;  4I7D A;  1JM7 B;  3U5N A;  3O7A A;  4FJC A;  4MSX A;  3O36 A;  2MUM A;  1G25 A;  4QF3 A;  3RPG B;  2LGV A;  2YYR A;  1WIM A;  2VP7 A;  5B8D A;  2ECJ A;  5AIU A;  5LKU A;  2M3H A;  2YW8 A;  2JMI A;  3PUR A;  3N9P A;  2YRE A;  1WFK A;  2K17 A;  3HCU A;  4MVT A;  4YC9 A;  2RI7 A;  4YAD A;  2YSM A;  3ZVY A;  2MD7 B;  3ZVZ B;  3KV5 A;  5H1T A;  2YT5 A;  2LGL A;  4AYC A;  4CA1 A;  3ZTG A;  2M85 A;  5KH9 A;  4AVX A;  5J3X A;  2IDA A;  3N9O A;  2RSD A;  1WEQ A;  4FO9 A;  4XI1 A;  2CT2 A;  2H0D B;  3PHD A;  4FIP A;  2YQL A;  4LJN A;  1BOR A;  4L7X A;  3N9N A;  1MM3 A;  3RTR B;  1X4J A;  5TDR A;  2C2V S;  2KE1 A;  5TAB A;  2YUR A;  2VPG A;  2Y43 A;  1WEU A;  5C11 A;  2PUY A;  3ZYQ A;  4I7B A;  2MNZ A;  2Y1N A;  3O35 A;  1DVP A;  2EGP A;  4R7E A;  2ECT A;  2Y1M A;  3KQI A;  1WES A;  2FUI A;  2DX8 A;  2VJF A;  2KFT A;  3O33 A;  3O34 A;  3V43 A;  1Z60 A;  1VYX A;  3MHH A;  5LKT A;  2KRE A;  3EB5 A;  4A4C A;  4LK9 A;  2VPD A;  5H1V A;  3NG2 A;  4BBQ A;  4YBT A;  4WZ0 A;  3KNV A;  2L0B A;  4B86 C;  1K2F A;  3SHB A;  2YU4 A;  3DQV R;  3U5P A;  1WEP A;  2CKL A;  2JMJ A;  4ZDT A;  2MNY A;  5C13 A;  2QIZ A;  1U6G B;  4F52 B;  5B75 A;  2ECI A;  4GNE A;  5H9M A;  2K4D A;  2KU3 A;  2LDR A;  3N9Q A;  2QIC A;  2VJE A;  1LDK C;  2LN0 A;  4GNF A;  4AUQ B;  2M6M A;  5JG6 A;  4WA6 A;  2MT5 A;  1FBV A;  4GB0 A;  2MA5 A;  1MM2 A;  3U5O A;  4UP0 A;  5LKZ A;  2VPE A;  4IC2 A;  1VFY A;  3T6R A;  2LQ6 A;  4C9Z A;  4PPE A;  4A49 A;  1JOC A;  1LDJ B;  4B7Y C;  3L11 A;  2YSJ A;  5G0F A;  3VK6 A;  2C2L A;  4LAD B;  5D1K B;  5AIT A;  1JM7 A;  4UI9 B;  4A0C D;  3QZV A;  2LXP C;  2JMD A;  1WE9 A;  2LGG A;  1T1H A; 
#chains in the Genus database with same CATH topology
 3LQI A;  2CSY A;  2L5U A;  5FER A;  3MHS A;  3L1X A;  2LV9 A;  2LGK A;  2LXH C;  4V3L C;  4F1P A;  2E61 A;  4W4U A;  4O64 A;  4S3O C;  1WEN A;  3HTK C;  3C5K A;  1E4U A;  4LLB A;  3T9K A;  1FP0 A;  4BHW A;  5B76 A;  2NAA A;  5G05 B;  2MD8 C;  2JRJ A;  3SOX A;  3O70 A;  1N87 A;  2L75 A;  3SOU A;  3M99 A;  5D1M B;  3GL6 A;  2EA6 A;  5FB0 A;  5LKX A;  2F42 A;  3C6W A;  2KYU A;  2M1R A;  5TBN A;  2XP0 A;  2PNX A;  3M63 A;  2G45 A;  2L43 A;  4WZ2 A;  3LVQ E;  4AYC B;  3L1Z B;  2YHN A;  3O37 A;  2H0D A;  2YUC A;  4CCG X;  2JM3 A;  3T7L A;  1Z2Q A;  2G6Q A;  4YAX A;  4GNG A;  2FSA A;  2ECN A;  3M62 A;  5KH7 A;  2XB1 A;  1WEO A;  2AN6 A;  3IHP A;  2F6J A;  1WIL A;  2ECW A;  4WZ3 B;  4ZQL A;  1HYI A;  4S3O B;  1WEW A;  1CHC A;  5SVY A;  1WGM A;  2KIZ A;  5FEY A;  1Z6U A;  3LQH A;  4V3K C;  5SVX A;  4YBS A;  2G43 A;  3LQJ A;  3E2D A;  2LRI C;  1HYJ A;  4TKP B;  3LRQ A;  3HCT A;  4YAT A;  2YVR A;  2KWK A;  4NN2 A;  2ECV A;  2P57 A;  4AP4 A;  3DDT A;  3N9L A;  2E6R A;  5G04 B;  1X4I A;  2OXQ C;  3FEH A;  2CRW A;  4YAB A;  2QJ0 A;  2YHO A;  4P5O B;  4ZUX U;  4R8P K;  2VJF B;  2MIQ A;  5SVI B;  1X4U A;  5B78 A;  3GV4 A;  4R2Y A;  4YBM A;  1IYM A;  2KWO A;  4GND A;  5TDW A;  4IC3 A;  4O62 A;  3LJU X;  4QF2 A;  3SUB A;  2XEU A;  2KGI A;  3LVR E;  5TRB A;  1V87 A;  4Q6F A;  2F6N A;  3ZPV 1;  5EYA F;  4PTB A;  5D1L B;  3EB6 A;  2HYE D;  5DIN A;  2VPB A;  5DKA A;  3I2D A;  2I50 A;  4LKA A;  2XOZ A;  5KH3 A;  2CKL B;  2HDP A;  2L80 A;  2D8U A;  5B79 A;  2MKE A;  3ZNI A;  4A4B A;  3ASL A;  3U5M A;  1WEM A;  2ZET C;  1F62 A;  5I3L A;  2MA6 A;  1ZBD B;  3RPG C;  2EGM A;  2ECG A;  2FUU A;  2KWN A;  1XWH A;  1VD4 A;  3H7H A;  2UZG A;  2VJE B;  3SOW A;  4N4F A;  2E6S A;  4X3G A;  3ZPV E;  3N9M A;  2EXU A;  2IQJ A;  2YQM A;  3FL2 A;  2BAY A;  5H1U A;  2CSZ A;  2VNF A;  3PUQ A;  1WEV A;  4FK5 A;  2KWJ A;  4UP5 A;  2D8S A;  2K16 A;  2EOD A;  2K1J A;  1RMD A;  3Q1D A;  5FB1 A;  4L58 A;  4I7C A;  5LCW B;  2KR4 A;  4N3W A;  4OGE A;  3DPL R;  3KV6 A;  1WEE A;  3HCS A;  2L7P A;  4H9D A;  5B77 A;  2KGG A;  4I7D A;  1JM7 B;  3U5N A;  1MBM A;  3O47 A;  3O7A A;  4FJC A;  4MSX A;  3O36 A;  2MUM A;  1G25 A;  5K3Q A;  4QF3 A;  3RPG B;  2LGV A;  2YYR A;  1WIM A;  2DSM A;  2B0O E;  2VP7 A;  5B8D A;  2ECJ A;  3FAN A;  2CRR A;  5AIU A;  5LKU A;  2M3H A;  2YW8 A;  2JMI A;  3PUR A;  3N9P A;  4Z0O A;  2YRE A;  1WFK A;  2K17 A;  4OGC A;  3HCU A;  4MVT A;  4YC9 A;  2RI7 A;  4YAD A;  2YSM A;  3ZVY A;  2MD7 B;  3MDB C;  3ZVZ B;  3KV5 A;  5H1T A;  2YT5 A;  2LGL A;  2CON A;  4AYC A;  4CA1 A;  3ZTG A;  2M85 A;  5KH9 A;  4AVX A;  5J3X A;  2IDA A;  3N9O A;  2RSD A;  1WEQ A;  2FFW A;  2KKX A;  4FO9 A;  4XI1 A;  2CT2 A;  2H0D B;  3PHD A;  4FIP A;  2YQL A;  4LJN A;  1BOR A;  2XOC A;  4L7X A;  3N9N A;  2CSV A;  1MM3 A;  3RTR B;  1X4J A;  5TDR A;  2C2V S;  2KE1 A;  5TAB A;  2YUR A;  2VPG A;  2Y43 A;  1WEU A;  5C11 A;  2PUY A;  3ZYQ A;  4I7B A;  2LAU A;  2MNZ A;  2Y1N A;  3O35 A;  1DVP A;  3M7K A;  2EGP A;  4R7E A;  2ECT A;  2Y1M A;  3KQI A;  1WES A;  2FUI A;  2DX8 A;  2VJF A;  2KFT A;  3O33 A;  5SVI A;  2FD4 A;  3O34 A;  4QQ4 A;  3V43 A;  3KDE C;  1Z60 A;  1VYX A;  3MHH A;  5LKT A;  2KRE A;  3EB5 A;  4A4C A;  4LK9 A;  2VPD A;  3JUE A;  3FJU B;  5H1V A;  3NG2 A;  4BBQ A;  2OWA A;  2M13 A;  4WZ0 A;  4YBT A;  3KNV A;  4Z0R A;  2L0B A;  4B86 C;  1K2F A;  3SHB A;  2YU4 A;  3DQV R;  3U5P A;  2KKY A;  1WEP A;  2CKL A;  2JMJ A;  4ZDT A;  2MNY A;  3FM8 C;  1DCQ A;  5C13 A;  2QIZ A;  1U6G B;  4F52 B;  5B75 A;  2ECI A;  4GNE A;  5H9M A;  2K4D A;  2KU3 A;  2LDR A;  3N9Q A;  2QIC A;  2VJE A;  1LDK C;  2LN0 A;  4GNF A;  2XOY A;  4AUQ B;  3PLW A;  2M6M A;  5JG6 A;  4WA6 A;  2MT5 A;  1FBV A;  4GB0 A;  2MA5 A;  3FAO A;  1MM2 A;  3U5O A;  4UP0 A;  5LKZ A;  2VPE A;  4IC2 A;  2RR4 A;  1VFY A;  3T6R A;  2LQ6 A;  4C9Z A;  4PPE A;  2DJA A;  4A49 A;  1JOC A;  3DWD A;  1LDJ B;  4B7Y C;  3L11 A;  2YSJ A;  5G0F A;  3VK6 A;  3LDY A;  2JUN A;  2C2L A;  4LAD B;  5D1K B;  5AIT A;  1JM7 A;  4UI9 B;  4A0C D;  3QZV A;  2LXP C;  2JMD A;  1WE9 A;  2LGG A;  1T1H A; 
#chains in the Genus database with same CATH homology
 3LQI A;  2CSY A;  2L5U A;  5FER A;  3MHS A;  3L1X A;  2LV9 A;  2LGK A;  2LXH C;  4V3L C;  4W4U A;  4O64 A;  4S3O C;  1WEN A;  3HTK C;  3C5K A;  1E4U A;  4LLB A;  1FP0 A;  4BHW A;  5B76 A;  2NAA A;  5G05 B;  2MD8 C;  2JRJ A;  3SOX A;  3O70 A;  1N87 A;  2L75 A;  3SOU A;  3M99 A;  5D1M B;  3GL6 A;  2EA6 A;  5FB0 A;  5LKX A;  2F42 A;  3C6W A;  2KYU A;  2M1R A;  5TBN A;  2PNX A;  3M63 A;  2G45 A;  2L43 A;  4WZ2 A;  4AYC B;  3L1Z B;  2YHN A;  3O37 A;  2H0D A;  2YUC A;  4CCG X;  3T7L A;  1Z2Q A;  2G6Q A;  4YAX A;  4GNG A;  2FSA A;  2ECN A;  3M62 A;  5KH7 A;  2XB1 A;  1WEO A;  2AN6 A;  3IHP A;  2F6J A;  1WIL A;  2ECW A;  4WZ3 B;  4ZQL A;  1HYI A;  4S3O B;  1WEW A;  1CHC A;  1WGM A;  2KIZ A;  5FEY A;  1Z6U A;  3LQH A;  4V3K C;  4YBS A;  2G43 A;  3LQJ A;  2LRI C;  1HYJ A;  4TKP B;  3LRQ A;  3HCT A;  4YAT A;  2KWK A;  2ECV A;  4NN2 A;  4AP4 A;  3N9L A;  2E6R A;  5G04 B;  1X4I A;  2OXQ C;  4YAB A;  2QJ0 A;  2YHO A;  4P5O B;  4ZUX U;  4R8P K;  2VJF B;  2MIQ A;  1X4U A;  5B78 A;  3GV4 A;  4R2Y A;  4YBM A;  1IYM A;  2KWO A;  4GND A;  5TDW A;  4IC3 A;  4QF2 A;  2XEU A;  2KGI A;  5TRB A;  1V87 A;  4Q6F A;  2F6N A;  3ZPV 1;  5EYA F;  4PTB A;  5D1L B;  3EB6 A;  2HYE D;  5DIN A;  2VPB A;  5DKA A;  3I2D A;  2I50 A;  4LKA A;  5KH3 A;  2CKL B;  2HDP A;  2L80 A;  5B79 A;  3ZNI A;  4A4B A;  3ASL A;  3U5M A;  1WEM A;  2ZET C;  1F62 A;  5I3L A;  2MA6 A;  1ZBD B;  3RPG C;  2ECG A;  2FUU A;  2KWN A;  1XWH A;  1VD4 A;  2UZG A;  2VJE B;  3SOW A;  4N4F A;  2E6S A;  4X3G A;  3ZPV E;  3N9M A;  2YQM A;  3FL2 A;  2BAY A;  5H1U A;  2CSZ A;  2VNF A;  3PUQ A;  1WEV A;  4FK5 A;  2KWJ A;  4UP5 A;  2D8S A;  2K16 A;  2EOD A;  2K1J A;  1RMD A;  5FB1 A;  4L58 A;  4I7C A;  5LCW B;  2KR4 A;  4N3W A;  3DPL R;  3KV6 A;  1WEE A;  3HCS A;  5B77 A;  2KGG A;  4I7D A;  1JM7 B;  3U5N A;  3O7A A;  4FJC A;  4MSX A;  3O36 A;  2MUM A;  1G25 A;  4QF3 A;  3RPG B;  2LGV A;  2YYR A;  1WIM A;  2VP7 A;  5B8D A;  2ECJ A;  5AIU A;  5LKU A;  2M3H A;  2YW8 A;  2JMI A;  3PUR A;  3N9P A;  2YRE A;  1WFK A;  2K17 A;  3HCU A;  4MVT A;  4YC9 A;  2RI7 A;  4YAD A;  2YSM A;  3ZVY A;  2MD7 B;  3ZVZ B;  3KV5 A;  5H1T A;  2YT5 A;  2LGL A;  4AYC A;  4CA1 A;  3ZTG A;  2M85 A;  5KH9 A;  4AVX A;  5J3X A;  2IDA A;  3N9O A;  2RSD A;  1WEQ A;  4FO9 A;  4XI1 A;  2CT2 A;  2H0D B;  3PHD A;  4FIP A;  2YQL A;  4LJN A;  1BOR A;  4L7X A;  3N9N A;  1MM3 A;  3RTR B;  1X4J A;  5TDR A;  2C2V S;  2KE1 A;  5TAB A;  2YUR A;  2VPG A;  2Y43 A;  1WEU A;  5C11 A;  2PUY A;  3ZYQ A;  4I7B A;  2MNZ A;  2Y1N A;  3O35 A;  1DVP A;  2EGP A;  4R7E A;  2ECT A;  2Y1M A;  3KQI A;  1WES A;  2FUI A;  2DX8 A;  2VJF A;  2KFT A;  3O33 A;  3O34 A;  3V43 A;  1Z60 A;  1VYX A;  3MHH A;  5LKT A;  2KRE A;  3EB5 A;  4A4C A;  4LK9 A;  2VPD A;  5H1V A;  3NG2 A;  4BBQ A;  4YBT A;  4WZ0 A;  3KNV A;  2L0B A;  4B86 C;  1K2F A;  3SHB A;  2YU4 A;  3DQV R;  3U5P A;  1WEP A;  2CKL A;  2JMJ A;  4ZDT A;  2MNY A;  5C13 A;  2QIZ A;  1U6G B;  4F52 B;  5B75 A;  2ECI A;  4GNE A;  5H9M A;  2K4D A;  2KU3 A;  2LDR A;  3N9Q A;  2QIC A;  2VJE A;  1LDK C;  2LN0 A;  4GNF A;  4AUQ B;  2M6M A;  5JG6 A;  4WA6 A;  2MT5 A;  1FBV A;  4GB0 A;  2MA5 A;  1MM2 A;  3U5O A;  4UP0 A;  5LKZ A;  2VPE A;  4IC2 A;  1VFY A;  3T6R A;  2LQ6 A;  4C9Z A;  4PPE A;  4A49 A;  1JOC A;  1LDJ B;  4B7Y C;  3L11 A;  2YSJ A;  5G0F A;  3VK6 A;  2C2L A;  4LAD B;  5D1K B;  5AIT A;  1JM7 A;  4UI9 B;  4A0C D;  3QZV A;  2LXP C;  2JMD A;  1WE9 A;  2LGG A;  1T1H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...