2G43A

Structure of the znf ubp domain from deubiquitinating enzyme isopeptidase t (isot)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
117
structure length
117
Chain Sequence
WDGEVRQVSKHAFSLKQLDNPARIPPCGWKCSKCDMRENLWLNLTDGSILCGRRYFDGSGGNNHAVEHYRETGYPLAVKLGTITPDGADVYSYDEDDMVLDPSLAEHLSHFGIDMLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin carboxyl-terminal hydrolase 5
publication title The Ubiquitin Binding Domain ZnF UBP Recognizes the C-Terminal Diglycine Motif of Unanchored Ubiquitin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 28
structure length 117
sequence length 117
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2006-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2g43A01
3FL2A 2YREA 2XB1A 2UZGA 3SOXA 1Z6UA 3SOUA 4WZ0A 3L11A 2CSYA 2Y1MA 4V3KC 2ECTA 2OXQC 5KH9A 4PTBA 5EYAF 3L1ZB 3M62A 5JG6A 2YQLA 3MHHA 2VPBA 1Z2QA 3ZNIA 2YUCA 4WA6A 3GL6A 5AIUA 3ASLA 2MD8C 2KREA 2MA5A 1WEMA 4YBTA 5C13A 5AITA 4FIPA 4O64A 2KIZA 3O7AA 1F62A 3O37A 1WIMA 5G05B 1Z60A 2LGKA 4GNDA 4BHWA 2YURA 4I7DA 5B8DA 1WILA 4N4FA 1E4UA 5D1KB 5B76A 1JM7B 3N9MA 4YABA 4Q6FA 5C11A 3ZPVE 1MM2A 1WEQA 2LRIC 1VFYA 2DX8A 3N9LA 4B7YC 4P5OB 2H0DB 4CCGX 5B75A 1WESA 2KWJA 1FP0A 4V3LC 5H1TA 4AYCB 2MUMA 2C2VS 2YHNA 3U5MA 3LQIA 4PPEA 1HYIA 1X4IA 3LQHA 2F6JA 4IC2A 1ZBDB 3GV4A 2KWKA 5FB1A 4L58A 2QICA 3LRQA 2LQ6A 1WEPA 1JM7A 3O34A 1T1HA 3PUQA 2K4DA 2F6NA 4C9ZA 1CHCA 4XI1A 5I3LA 2KGIA 4ZDTA 2CT2A 2YW8A 2H0DA 3KQIA 3RPGB 3RTRB 4YAXA 5FB0A 3N9OA 4ZUXU 4AYCA 2JMIA 1VYXA 1MM3A 5H1UA 2KR4A 1RMDA 1WGMA 1X4JA 3HCTA 4FO9A 3N9NA 2EGPA 4S3OB 2L5UA 3EB6A 3LQJA 2MD7B 3L1XA 1WE9A 2VNFA 4TKPB 2MA6A 2LXPC 4X3GA 2L80A 1WFKA 3U5OA 5G04B 1JOCA 2L0BA 2IDAA 2AN6A 4GNEA 1K2FA 2NAAA 2XEUA 2M3HA 5TRBA 2YHOA 2HYED 3DQVR 2LGLA 5TDWA 3N9PA 3KNVA 2VP7A 5DINA 2ECWA 3U5PA 2ECIA 2LXHC 2YT5A 1V87A 2K16A 3ZTGA 5LKZA 4R8PK 2D8SA 4GNFA 4N3WA 2KE1A 5LKXA 4I7BA 3C5KA 2L75A 4AP4A 3U5NA 3T7LA 4WZ2A 2Y43A 3QZVA 2BAYA 5LKTA 3O35A 4I7CA 1LDJB 5FEYA 1X4UA 4WZ3B 4W4UA 2G45A 2VJEB 4LKAA 4BBQA 4F52B 3V43A 2MNYA 2M6MA 2YSMA 3ZPV1 5B79A 3IHPA 2KWNA 2FUIA 3DPLR 3HCUA 2LGVA 2K1JA 4FK5A 3ZYQA 5H1VA 4UP5A 1WENA 3O33A 2M85A 4ZQLA 4S3OC 4LLBA 2FSAA 4GB0A 4MVTA 3T6RA 2M1RA 1XWHA 4YBSA 2VJEA 3PURA 2KYUA 4R7EA 4YADA 2PUYA 2KGGA 1VD4A 2F42A 5J3XA 2MNZA 3PHDA 1IYMA 2G43A 4UP0A 3M99A 4FJCA 2ECJA 5G0FA 2YSJA 2ECNA 4L7XA 3MHSA 2VPGA 2JRJA 5KH3A 1WEOA 5KH7A 3ZVZB 4CA1A 4YBMA 2ZETC 4NN2A 3EB5A 4R2YA 1BORA 1WEUA 5TABA 5LCWB 1LDKC 4UI9B 2KU3A 4MSXA 3M63A 3KV5A 3O36A 1G25A 2FUUA 2G6QA 2VPDA 5TBNA 2HDPA 2JMDA 5TDRA 2E6RA 2PNXA 3C6WA 3SOWA 2MIQA 2LN0A 4A4CA 2E6SA 2QIZA 2C2LA 4B86C 3SHBA 2I50A 3ZVYA 3HTKC 4LK9A 2EODA 4A4BA 2LDRA 2VJFB 3I2DA 2LGGA 5B77A 5DKAA 3HCSA 2ECGA 1WEEA 2CKLB 2QJ0A 5H9MA 2K17A 4YC9A 5FERA 1HYJA 2YYRA 4GNGA 3NG2A 3KV6A 2RSDA 3N9QA 4A0CD 1WEWA 4QF2A 3RPGC 2EA6A 4YATA 4AUQB 3O70A 2VPEA 5D1LB 2YQMA 2VJFA 5D1MB 1FBVA 2JMJA 2CSZA 2L43A 1DVPA 2Y1NA 2ECVA 4A49A 2YU4A 2CKLA 5B78A 2RI7A 4AVXA 2KFTA 3VK6A 4LADB 2MT5A 1N87A 2LV9A 1WEVA 4LJNA 4IC3A 5LKUA 1U6GB 4QF3A 2KWOA
chains in the Genus database with same CATH superfamily
3FL2A 2YREA 3FEHA 2XB1A 2UZGA 3SOXA 2XOCA 1Z6UA 2JUNA 3FM8C 3SOUA 4WZ0A 3L11A 2CSYA 2Y1MA 4V3KC 2ECTA 2OXQC 2EXUA 5KH9A 4PTBA 5EYAF 3L1ZB 3M62A 3LDYA 2CRRA 5JG6A 4OGEA 2YQLA 3DWDA 3MHHA 2VPBA 1Z2QA 3ZNIA 2YUCA 4WA6A 3GL6A 5AIUA 3ASLA 2MD8C 2KREA 2MA5A 1WEMA 4YBTA 5C13A 5AITA 4FIPA 4O64A 2KKXA 2KIZA 3O7AA 1F62A 3FJUB 3O37A 1WIMA 5G05B 1Z60A 2LGKA 4GNDA 4BHWA 2YURA 4I7DA 5B8DA 1WILA 4N4FA 1E4UA 5D1KB 3FANA 5B76A 1JM7B 3N9MA 4YABA 4Q6FA 5C11A 3ZPVE 1MM2A 1WEQA 2LRIC 1VFYA 2DX8A 3N9LA 4B7YC 4P5OB 2H0DB 4CCGX 5B75A 1WESA 2DSMA 2KWJA 3SUBA 1FP0A 4V3LC 5H1TA 4AYCB 2MUMA 2C2VS 2YHNA 3U5MA 2M13A 3LQIA 4PPEA 2FFWA 1HYIA 1X4IA 3LQHA 2F6JA 4IC2A 2LAUA 1ZBDB 3M7KA 3GV4A 2KWKA 5FB1A 4L58A 2QICA 3LRQA 2LQ6A 1WEPA 4QF3A 3O34A 1JM7A 1T1HA 3PUQA 2K4DA 2F6NA 4C9ZA 1CHCA 4XI1A 5I3LA 3JUEA 2KGIA 4ZDTA 2B0OE 2OWAA 2CT2A 3E2DA 2YW8A 2H0DA 3KQIA 3RPGB 3RTRB 4YAXA 3FAOA 5FB0A 3N9OA 4ZUXU 4AYCA 2JMIA 1VYXA 1MM3A 5H1UA 3H7HA 2KR4A 4Z0OA 2IQJA 1RMDA 1WGMA 1X4JA 3HCTA 4FO9A 2XOYA 3N9NA 2EGPA 4S3OB 2L5UA 3EB6A 3LQJA 2MD7B 3L1XA 1WE9A 2VNFA 4TKPB 2MA6A 2DJAA 2LXPC 4X3GA 2L80A 5SVXA 1WFKA 3U5OA 5G04B 1JOCA 2L0BA 2IDAA 4OGCA 2AN6A 1K2FA 2NAAA 2XEUA 4GNEA 2M3HA 5TRBA 2YHOA 2HYED 3DQVR 5SVYA 2LGLA 2JM3A 5TDWA 3N9PA 2CRWA 3O47A 3KNVA 2VP7A 5DINA 4H9DA 2ECWA 3U5PA 2D8UA 2ECIA 2LXHC 2YT5A 5SVIB 1V87A 2K16A 3ZTGA 5LKZA 4R8PK 2D8SA 4GNFA 4N3WA 2KE1A 5LKXA 4I7BA 3C5KA 2L75A 4AP4A 3U5NA 3T7LA 4WZ2A 2FD4A 2Y43A 2RR4A 3QZVA 2BAYA 5LKTA 3O35A 4I7CA 1LDJB 5FEYA 1X4UA 2MKEA 4WZ3B 4W4UA 2G45A 2KKYA 2VJEB 4LKAA 4BBQA 2E61A 4F52B 3V43A 2MNYA 2M6MA 2YSMA 3ZPV1 5B79A 3LVRE 3IHPA 5SVIA 2KWNA 2FUIA 3DPLR 3HCUA 2LGVA 2K1JA 4FK5A 3ZYQA 3DDTA 5H1VA 3MDBC 4UP5A 1WENA 3O33A 2M85A 4ZQLA 4S3OC 3T9KA 4LLBA 2FSAA 4GB0A 4MVTA 3T6RA 3Q1DA 2M1RA 1XWHA 4YBSA 2VJEA 3PURA 2KYUA 4R7EA 3PLWA 4YADA 2PUYA 2KGGA 1VD4A 2F42A 2L7PA 5J3XA 2MNZA 3PHDA 1IYMA 4QQ4A 2G43A 4UP0A 3M99A 4FJCA 2ECJA 5G0FA 2YSJA 2ECNA 4L7XA 3MHSA 2VPGA 4O62A 2JRJA 5KH3A 1WEOA 5KH7A 3ZVZB 4CA1A 4YBMA 2ZETC 5K3QA 4NN2A 1DCQA 3EB5A 4R2YA 1BORA 1WEUA 3KDEC 5TABA 5LCWB 1LDKC 4UI9B 4MSXA 3M63A 3KV5A 3O36A 1G25A 2FUUA 2G6QA 2VPDA 5TBNA 2HDPA 2JMDA 5TDRA 2E6RA 2PNXA 3C6WA 3SOWA 2MIQA 2LN0A 2P57A 4A4CA 2E6SA 2QIZA 2C2LA 3LVQE 4B86C 3SHBA 2I50A 3ZVYA 3HTKC 4LK9A 2EODA 4A4BA 2LDRA 2EGMA 2VJFB 3I2DA 2LGGA 5B77A 5DKAA 3HCSA 2ECGA 1WEEA 2CONA 2CKLB 2QJ0A 5H9MA 2K17A 4YC9A 5FERA 1HYJA 2YVRA 2YYRA 4GNGA 3NG2A 3KV6A 2RSDA 3N9QA 4A0CD 1WEWA 4QF2A 3RPGC 2EA6A 4YATA 4AUQB 4Z0RA 3O70A 2VPEA 1MBMA 5D1LB 2CSVA 2YQMA 2VJFA 5D1MB 1FBVA 2JMJA 2CSZA 2L43A 1DVPA 2Y1NA 2ECVA 4A49A 2YU4A 4F1PA 2CKLA 5B78A 2RI7A 4AVXA 2XOZA 3LJUX 2KFTA 3VK6A 4LADB 2MT5A 1N87A 2LV9A 1WEVA 4LJNA 4IC3A 5LKUA 1U6GB 2KU3A 2XP0A 2KWOA
chains in the Genus database with same CATH topology
3FL2A 2YREA 2XB1A 2UZGA 3SOXA 1Z6UA 3SOUA 4WZ0A 3L11A 2CSYA 2Y1MA 4V3KC 2ECTA 2OXQC 5KH9A 4PTBA 5EYAF 3L1ZB 3M62A 5JG6A 2YQLA 3MHHA 2VPBA 1Z2QA 3ZNIA 2YUCA 4WA6A 3GL6A 5AIUA 3ASLA 2MD8C 2KREA 2MA5A 1WEMA 4YBTA 5C13A 5AITA 4FIPA 4O64A 2KIZA 3O7AA 1F62A 3O37A 1WIMA 5G05B 1Z60A 2LGKA 4GNDA 4BHWA 2YURA 4I7DA 5B8DA 1WILA 4N4FA 1E4UA 5D1KB 5B76A 1JM7B 3N9MA 4YABA 4Q6FA 5C11A 3ZPVE 1MM2A 1WEQA 2LRIC 1VFYA 2DX8A 3N9LA 4B7YC 4P5OB 2H0DB 4CCGX 5B75A 1WESA 2KWJA 1FP0A 4V3LC 5H1TA 4AYCB 2MUMA 2C2VS 2YHNA 3U5MA 3LQIA 4PPEA 1HYIA 1X4IA 3LQHA 2F6JA 4IC2A 1ZBDB 3GV4A 2KWKA 5FB1A 4L58A 2QICA 3LRQA 2LQ6A 1WEPA 1JM7A 3O34A 1T1HA 3PUQA 2K4DA 2F6NA 4C9ZA 1CHCA 4XI1A 5I3LA 2KGIA 4ZDTA 2CT2A 2YW8A 2H0DA 3KQIA 3RPGB 3RTRB 4YAXA 5FB0A 3N9OA 4ZUXU 4AYCA 2JMIA 1VYXA 1MM3A 5H1UA 2KR4A 1RMDA 1WGMA 1X4JA 3HCTA 4FO9A 3N9NA 2EGPA 4S3OB 2L5UA 3EB6A 3LQJA 2MD7B 3L1XA 1WE9A 2VNFA 4TKPB 2MA6A 2LXPC 4X3GA 2L80A 1WFKA 3U5OA 5G04B 1JOCA 2L0BA 2IDAA 2AN6A 4GNEA 1K2FA 2NAAA 2XEUA 2M3HA 5TRBA 2YHOA 2HYED 3DQVR 2LGLA 5TDWA 3N9PA 3KNVA 2VP7A 5DINA 2ECWA 3U5PA 2ECIA 2LXHC 2YT5A 1V87A 2K16A 3ZTGA 5LKZA 4R8PK 2D8SA 4GNFA 4N3WA 2KE1A 5LKXA 4I7BA 3C5KA 2L75A 4AP4A 3U5NA 3T7LA 4WZ2A 2Y43A 3QZVA 2BAYA 5LKTA 3O35A 4I7CA 1LDJB 5FEYA 1X4UA 4WZ3B 4W4UA 2G45A 2VJEB 4LKAA 4BBQA 4F52B 3V43A 2MNYA 2M6MA 2YSMA 3ZPV1 5B79A 3IHPA 2KWNA 2FUIA 3DPLR 3HCUA 2LGVA 2K1JA 4FK5A 3ZYQA 5H1VA 4UP5A 1WENA 3O33A 2M85A 4ZQLA 4S3OC 4LLBA 2FSAA 4GB0A 4MVTA 3T6RA 2M1RA 1XWHA 4YBSA 2VJEA 3PURA 2KYUA 4R7EA 4YADA 2PUYA 2KGGA 1VD4A 2F42A 5J3XA 2MNZA 3PHDA 1IYMA 2G43A 4UP0A 3M99A 4FJCA 2ECJA 5G0FA 2YSJA 2ECNA 4L7XA 3MHSA 2VPGA 2JRJA 5KH3A 1WEOA 5KH7A 3ZVZB 4CA1A 4YBMA 2ZETC 4NN2A 3EB5A 4R2YA 1BORA 1WEUA 5TABA 5LCWB 1LDKC 4UI9B 2KU3A 4MSXA 3M63A 3KV5A 3O36A 1G25A 2FUUA 2G6QA 2VPDA 5TBNA 2HDPA 2JMDA 5TDRA 2E6RA 2PNXA 3C6WA 3SOWA 2MIQA 2LN0A 4A4CA 2E6SA 2QIZA 2C2LA 4B86C 3SHBA 2I50A 3ZVYA 3HTKC 4LK9A 2EODA 4A4BA 2LDRA 2VJFB 3I2DA 2LGGA 5B77A 5DKAA 3HCSA 2ECGA 1WEEA 2CKLB 2QJ0A 5H9MA 2K17A 4YC9A 5FERA 1HYJA 2YYRA 4GNGA 3NG2A 3KV6A 2RSDA 3N9QA 4A0CD 1WEWA 4QF2A 3RPGC 2EA6A 4YATA 4AUQB 3O70A 2VPEA 5D1LB 2YQMA 2VJFA 5D1MB 1FBVA 2JMJA 2CSZA 2L43A 1DVPA 2Y1NA 2ECVA 4A49A 2YU4A 2CKLA 5B78A 2RI7A 4AVXA 2KFTA 3VK6A 4LADB 2MT5A 1N87A 2LV9A 1WEVA 4LJNA 4IC3A 5LKUA 1U6GB 4QF3A 2KWOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FL2 A;  2YRE A;  2XB1 A;  2UZG A;  3SOX A;  1Z6U A;  3SOU A;  4WZ0 A;  3L11 A;  2CSY A;  2Y1M A;  4V3K C;  2ECT A;  2OXQ C;  5KH9 A;  4PTB A;  5EYA F;  3L1Z B;  3M62 A;  5JG6 A;  2YQL A;  3MHH A;  2VPB A;  1Z2Q A;  3ZNI A;  2YUC A;  4WA6 A;  3GL6 A;  5AIU A;  3ASL A;  2MD8 C;  2KRE A;  2MA5 A;  1WEM A;  4YBT A;  5C13 A;  5AIT A;  4FIP A;  4O64 A;  2KIZ A;  3O7A A;  1F62 A;  3O37 A;  1WIM A;  5G05 B;  1Z60 A;  2LGK A;  4GND A;  4BHW A;  2YUR A;  4I7D A;  5B8D A;  1WIL A;  4N4F A;  1E4U A;  5D1K B;  5B76 A;  1JM7 B;  3N9M A;  4YAB A;  4Q6F A;  5C11 A;  3ZPV E;  1MM2 A;  1WEQ A;  2LRI C;  1VFY A;  2DX8 A;  3N9L A;  4B7Y C;  4P5O B;  2H0D B;  4CCG X;  5B75 A;  1WES A;  2KWJ A;  1FP0 A;  4V3L C;  5H1T A;  4AYC B;  2MUM A;  2C2V S;  2YHN A;  3U5M A;  3LQI A;  4PPE A;  1HYI A;  1X4I A;  3LQH A;  2F6J A;  4IC2 A;  1ZBD B;  3GV4 A;  2KWK A;  5FB1 A;  4L58 A;  2QIC A;  3LRQ A;  2LQ6 A;  1WEP A;  1JM7 A;  3O34 A;  1T1H A;  3PUQ A;  2K4D A;  2F6N A;  4C9Z A;  1CHC A;  4XI1 A;  5I3L A;  2KGI A;  4ZDT A;  2CT2 A;  2YW8 A;  2H0D A;  3KQI A;  3RPG B;  3RTR B;  4YAX A;  5FB0 A;  3N9O A;  4ZUX U;  4AYC A;  2JMI A;  1VYX A;  1MM3 A;  5H1U A;  2KR4 A;  1RMD A;  1WGM A;  1X4J A;  3HCT A;  4FO9 A;  3N9N A;  2EGP A;  4S3O B;  2L5U A;  3EB6 A;  3LQJ A;  2MD7 B;  3L1X A;  1WE9 A;  2VNF A;  4TKP B;  2MA6 A;  2LXP C;  4X3G A;  2L80 A;  1WFK A;  3U5O A;  5G04 B;  1JOC A;  2L0B A;  2IDA A;  2AN6 A;  4GNE A;  1K2F A;  2NAA A;  2XEU A;  2M3H A;  5TRB A;  2YHO A;  2HYE D;  3DQV R;  2LGL A;  5TDW A;  3N9P A;  3KNV A;  2VP7 A;  5DIN A;  2ECW A;  3U5P A;  2ECI A;  2LXH C;  2YT5 A;  1V87 A;  2K16 A;  3ZTG A;  5LKZ A;  4R8P K;  2D8S A;  4GNF A;  4N3W A;  2KE1 A;  5LKX A;  4I7B A;  3C5K A;  2L75 A;  4AP4 A;  3U5N A;  3T7L A;  4WZ2 A;  2Y43 A;  3QZV A;  2BAY A;  5LKT A;  3O35 A;  4I7C A;  1LDJ B;  5FEY A;  1X4U A;  4WZ3 B;  4W4U A;  2G45 A;  2VJE B;  4LKA A;  4BBQ A;  4F52 B;  3V43 A;  2MNY A;  2M6M A;  2YSM A;  3ZPV 1;  5B79 A;  3IHP A;  2KWN A;  2FUI A;  3DPL R;  3HCU A;  2LGV A;  2K1J A;  4FK5 A;  3ZYQ A;  5H1V A;  4UP5 A;  1WEN A;  3O33 A;  2M85 A;  4ZQL A;  4S3O C;  4LLB A;  2FSA A;  4GB0 A;  4MVT A;  3T6R A;  2M1R A;  1XWH A;  4YBS A;  2VJE A;  3PUR A;  2KYU A;  4R7E A;  4YAD A;  2PUY A;  2KGG A;  1VD4 A;  2F42 A;  5J3X A;  2MNZ A;  3PHD A;  1IYM A;  2G43 A;  4UP0 A;  3M99 A;  4FJC A;  2ECJ A;  5G0F A;  2YSJ A;  2ECN A;  4L7X A;  3MHS A;  2VPG A;  2JRJ A;  5KH3 A;  1WEO A;  5KH7 A;  3ZVZ B;  4CA1 A;  4YBM A;  2ZET C;  4NN2 A;  3EB5 A;  4R2Y A;  1BOR A;  1WEU A;  5TAB A;  5LCW B;  1LDK C;  4UI9 B;  2KU3 A;  4MSX A;  3M63 A;  3KV5 A;  3O36 A;  1G25 A;  2FUU A;  2G6Q A;  2VPD A;  5TBN A;  2HDP A;  2JMD A;  5TDR A;  2E6R A;  2PNX A;  3C6W A;  3SOW A;  2MIQ A;  2LN0 A;  4A4C A;  2E6S A;  2QIZ A;  2C2L A;  4B86 C;  3SHB A;  2I50 A;  3ZVY A;  3HTK C;  4LK9 A;  2EOD A;  4A4B A;  2LDR A;  2VJF B;  3I2D A;  2LGG A;  5B77 A;  5DKA A;  3HCS A;  2ECG A;  1WEE A;  2CKL B;  2QJ0 A;  5H9M A;  2K17 A;  4YC9 A;  5FER A;  1HYJ A;  2YYR A;  4GNG A;  3NG2 A;  3KV6 A;  2RSD A;  3N9Q A;  4A0C D;  1WEW A;  4QF2 A;  3RPG C;  2EA6 A;  4YAT A;  4AUQ B;  3O70 A;  2VPE A;  5D1L B;  2YQM A;  2VJF A;  5D1M B;  1FBV A;  2JMJ A;  2CSZ A;  2L43 A;  1DVP A;  2Y1N A;  2ECV A;  4A49 A;  2YU4 A;  2CKL A;  5B78 A;  2RI7 A;  4AVX A;  2KFT A;  3VK6 A;  4LAD B;  2MT5 A;  1N87 A;  2LV9 A;  1WEV A;  4LJN A;  4IC3 A;  5LKU A;  1U6G B;  4QF3 A;  2KWO A; 
#chains in the Genus database with same CATH topology
 3FL2 A;  2YRE A;  3FEH A;  2XB1 A;  2UZG A;  3SOX A;  2XOC A;  1Z6U A;  2JUN A;  3FM8 C;  3SOU A;  4WZ0 A;  3L11 A;  2CSY A;  2Y1M A;  4V3K C;  2ECT A;  2OXQ C;  2EXU A;  5KH9 A;  4PTB A;  5EYA F;  3L1Z B;  3M62 A;  3LDY A;  2CRR A;  5JG6 A;  4OGE A;  2YQL A;  3DWD A;  3MHH A;  2VPB A;  1Z2Q A;  3ZNI A;  2YUC A;  4WA6 A;  3GL6 A;  5AIU A;  3ASL A;  2MD8 C;  2KRE A;  2MA5 A;  1WEM A;  4YBT A;  5C13 A;  5AIT A;  4FIP A;  4O64 A;  2KKX A;  2KIZ A;  3O7A A;  1F62 A;  3FJU B;  3O37 A;  1WIM A;  5G05 B;  1Z60 A;  2LGK A;  4GND A;  4BHW A;  2YUR A;  4I7D A;  5B8D A;  1WIL A;  4N4F A;  1E4U A;  5D1K B;  3FAN A;  5B76 A;  1JM7 B;  3N9M A;  4YAB A;  4Q6F A;  5C11 A;  3ZPV E;  1MM2 A;  1WEQ A;  2LRI C;  1VFY A;  2DX8 A;  3N9L A;  4B7Y C;  4P5O B;  2H0D B;  4CCG X;  5B75 A;  1WES A;  2DSM A;  2KWJ A;  3SUB A;  1FP0 A;  4V3L C;  5H1T A;  4AYC B;  2MUM A;  2C2V S;  2YHN A;  3U5M A;  2M13 A;  3LQI A;  4PPE A;  2FFW A;  1HYI A;  1X4I A;  3LQH A;  2F6J A;  4IC2 A;  2LAU A;  1ZBD B;  3M7K A;  3GV4 A;  2KWK A;  5FB1 A;  4L58 A;  2QIC A;  3LRQ A;  2LQ6 A;  1WEP A;  4QF3 A;  3O34 A;  1JM7 A;  1T1H A;  3PUQ A;  2K4D A;  2F6N A;  4C9Z A;  1CHC A;  4XI1 A;  5I3L A;  3JUE A;  2KGI A;  4ZDT A;  2B0O E;  2OWA A;  2CT2 A;  3E2D A;  2YW8 A;  2H0D A;  3KQI A;  3RPG B;  3RTR B;  4YAX A;  3FAO A;  5FB0 A;  3N9O A;  4ZUX U;  4AYC A;  2JMI A;  1VYX A;  1MM3 A;  5H1U A;  3H7H A;  2KR4 A;  4Z0O A;  2IQJ A;  1RMD A;  1WGM A;  1X4J A;  3HCT A;  4FO9 A;  2XOY A;  3N9N A;  2EGP A;  4S3O B;  2L5U A;  3EB6 A;  3LQJ A;  2MD7 B;  3L1X A;  1WE9 A;  2VNF A;  4TKP B;  2MA6 A;  2DJA A;  2LXP C;  4X3G A;  2L80 A;  5SVX A;  1WFK A;  3U5O A;  5G04 B;  1JOC A;  2L0B A;  2IDA A;  4OGC A;  2AN6 A;  1K2F A;  2NAA A;  2XEU A;  4GNE A;  2M3H A;  5TRB A;  2YHO A;  2HYE D;  3DQV R;  5SVY A;  2LGL A;  2JM3 A;  5TDW A;  3N9P A;  2CRW A;  3O47 A;  3KNV A;  2VP7 A;  5DIN A;  4H9D A;  2ECW A;  3U5P A;  2D8U A;  2ECI A;  2LXH C;  2YT5 A;  5SVI B;  1V87 A;  2K16 A;  3ZTG A;  5LKZ A;  4R8P K;  2D8S A;  4GNF A;  4N3W A;  2KE1 A;  5LKX A;  4I7B A;  3C5K A;  2L75 A;  4AP4 A;  3U5N A;  3T7L A;  4WZ2 A;  2FD4 A;  2Y43 A;  2RR4 A;  3QZV A;  2BAY A;  5LKT A;  3O35 A;  4I7C A;  1LDJ B;  5FEY A;  1X4U A;  2MKE A;  4WZ3 B;  4W4U A;  2G45 A;  2KKY A;  2VJE B;  4LKA A;  4BBQ A;  2E61 A;  4F52 B;  3V43 A;  2MNY A;  2M6M A;  2YSM A;  3ZPV 1;  5B79 A;  3LVR E;  3IHP A;  5SVI A;  2KWN A;  2FUI A;  3DPL R;  3HCU A;  2LGV A;  2K1J A;  4FK5 A;  3ZYQ A;  3DDT A;  5H1V A;  3MDB C;  4UP5 A;  1WEN A;  3O33 A;  2M85 A;  4ZQL A;  4S3O C;  3T9K A;  4LLB A;  2FSA A;  4GB0 A;  4MVT A;  3T6R A;  3Q1D A;  2M1R A;  1XWH A;  4YBS A;  2VJE A;  3PUR A;  2KYU A;  4R7E A;  3PLW A;  4YAD A;  2PUY A;  2KGG A;  1VD4 A;  2F42 A;  2L7P A;  5J3X A;  2MNZ A;  3PHD A;  1IYM A;  4QQ4 A;  2G43 A;  4UP0 A;  3M99 A;  4FJC A;  2ECJ A;  5G0F A;  2YSJ A;  2ECN A;  4L7X A;  3MHS A;  2VPG A;  4O62 A;  2JRJ A;  5KH3 A;  1WEO A;  5KH7 A;  3ZVZ B;  4CA1 A;  4YBM A;  2ZET C;  5K3Q A;  4NN2 A;  1DCQ A;  3EB5 A;  4R2Y A;  1BOR A;  1WEU A;  3KDE C;  5TAB A;  5LCW B;  1LDK C;  4UI9 B;  4MSX A;  3M63 A;  3KV5 A;  3O36 A;  1G25 A;  2FUU A;  2G6Q A;  2VPD A;  5TBN A;  2HDP A;  2JMD A;  5TDR A;  2E6R A;  2PNX A;  3C6W A;  3SOW A;  2MIQ A;  2LN0 A;  2P57 A;  4A4C A;  2E6S A;  2QIZ A;  2C2L A;  3LVQ E;  4B86 C;  3SHB A;  2I50 A;  3ZVY A;  3HTK C;  4LK9 A;  2EOD A;  4A4B A;  2LDR A;  2EGM A;  2VJF B;  3I2D A;  2LGG A;  5B77 A;  5DKA A;  3HCS A;  2ECG A;  1WEE A;  2CON A;  2CKL B;  2QJ0 A;  5H9M A;  2K17 A;  4YC9 A;  5FER A;  1HYJ A;  2YVR A;  2YYR A;  4GNG A;  3NG2 A;  3KV6 A;  2RSD A;  3N9Q A;  4A0C D;  1WEW A;  4QF2 A;  3RPG C;  2EA6 A;  4YAT A;  4AUQ B;  4Z0R A;  3O70 A;  2VPE A;  1MBM A;  5D1L B;  2CSV A;  2YQM A;  2VJF A;  5D1M B;  1FBV A;  2JMJ A;  2CSZ A;  2L43 A;  1DVP A;  2Y1N A;  2ECV A;  4A49 A;  2YU4 A;  4F1P A;  2CKL A;  5B78 A;  2RI7 A;  4AVX A;  2XOZ A;  3LJU X;  2KFT A;  3VK6 A;  4LAD B;  2MT5 A;  1N87 A;  2LV9 A;  1WEV A;  4LJN A;  4IC3 A;  5LKU A;  1U6G B;  2KU3 A;  2XP0 A;  2KWO A; 
#chains in the Genus database with same CATH homology
 3FL2 A;  2YRE A;  2XB1 A;  2UZG A;  3SOX A;  1Z6U A;  3SOU A;  4WZ0 A;  3L11 A;  2CSY A;  2Y1M A;  4V3K C;  2ECT A;  2OXQ C;  5KH9 A;  4PTB A;  5EYA F;  3L1Z B;  3M62 A;  5JG6 A;  2YQL A;  3MHH A;  2VPB A;  1Z2Q A;  3ZNI A;  2YUC A;  4WA6 A;  3GL6 A;  5AIU A;  3ASL A;  2MD8 C;  2KRE A;  2MA5 A;  1WEM A;  4YBT A;  5C13 A;  5AIT A;  4FIP A;  4O64 A;  2KIZ A;  3O7A A;  1F62 A;  3O37 A;  1WIM A;  5G05 B;  1Z60 A;  2LGK A;  4GND A;  4BHW A;  2YUR A;  4I7D A;  5B8D A;  1WIL A;  4N4F A;  1E4U A;  5D1K B;  5B76 A;  1JM7 B;  3N9M A;  4YAB A;  4Q6F A;  5C11 A;  3ZPV E;  1MM2 A;  1WEQ A;  2LRI C;  1VFY A;  2DX8 A;  3N9L A;  4B7Y C;  4P5O B;  2H0D B;  4CCG X;  5B75 A;  1WES A;  2KWJ A;  1FP0 A;  4V3L C;  5H1T A;  4AYC B;  2MUM A;  2C2V S;  2YHN A;  3U5M A;  3LQI A;  4PPE A;  1HYI A;  1X4I A;  3LQH A;  2F6J A;  4IC2 A;  1ZBD B;  3GV4 A;  2KWK A;  5FB1 A;  4L58 A;  2QIC A;  3LRQ A;  2LQ6 A;  1WEP A;  1JM7 A;  3O34 A;  1T1H A;  3PUQ A;  2K4D A;  2F6N A;  4C9Z A;  1CHC A;  4XI1 A;  5I3L A;  2KGI A;  4ZDT A;  2CT2 A;  2YW8 A;  2H0D A;  3KQI A;  3RPG B;  3RTR B;  4YAX A;  5FB0 A;  3N9O A;  4ZUX U;  4AYC A;  2JMI A;  1VYX A;  1MM3 A;  5H1U A;  2KR4 A;  1RMD A;  1WGM A;  1X4J A;  3HCT A;  4FO9 A;  3N9N A;  2EGP A;  4S3O B;  2L5U A;  3EB6 A;  3LQJ A;  2MD7 B;  3L1X A;  1WE9 A;  2VNF A;  4TKP B;  2MA6 A;  2LXP C;  4X3G A;  2L80 A;  1WFK A;  3U5O A;  5G04 B;  1JOC A;  2L0B A;  2IDA A;  2AN6 A;  4GNE A;  1K2F A;  2NAA A;  2XEU A;  2M3H A;  5TRB A;  2YHO A;  2HYE D;  3DQV R;  2LGL A;  5TDW A;  3N9P A;  3KNV A;  2VP7 A;  5DIN A;  2ECW A;  3U5P A;  2ECI A;  2LXH C;  2YT5 A;  1V87 A;  2K16 A;  3ZTG A;  5LKZ A;  4R8P K;  2D8S A;  4GNF A;  4N3W A;  2KE1 A;  5LKX A;  4I7B A;  3C5K A;  2L75 A;  4AP4 A;  3U5N A;  3T7L A;  4WZ2 A;  2Y43 A;  3QZV A;  2BAY A;  5LKT A;  3O35 A;  4I7C A;  1LDJ B;  5FEY A;  1X4U A;  4WZ3 B;  4W4U A;  2G45 A;  2VJE B;  4LKA A;  4BBQ A;  4F52 B;  3V43 A;  2MNY A;  2M6M A;  2YSM A;  3ZPV 1;  5B79 A;  3IHP A;  2KWN A;  2FUI A;  3DPL R;  3HCU A;  2LGV A;  2K1J A;  4FK5 A;  3ZYQ A;  5H1V A;  4UP5 A;  1WEN A;  3O33 A;  2M85 A;  4ZQL A;  4S3O C;  4LLB A;  2FSA A;  4GB0 A;  4MVT A;  3T6R A;  2M1R A;  1XWH A;  4YBS A;  2VJE A;  3PUR A;  2KYU A;  4R7E A;  4YAD A;  2PUY A;  2KGG A;  1VD4 A;  2F42 A;  5J3X A;  2MNZ A;  3PHD A;  1IYM A;  2G43 A;  4UP0 A;  3M99 A;  4FJC A;  2ECJ A;  5G0F A;  2YSJ A;  2ECN A;  4L7X A;  3MHS A;  2VPG A;  2JRJ A;  5KH3 A;  1WEO A;  5KH7 A;  3ZVZ B;  4CA1 A;  4YBM A;  2ZET C;  4NN2 A;  3EB5 A;  4R2Y A;  1BOR A;  1WEU A;  5TAB A;  5LCW B;  1LDK C;  4UI9 B;  2KU3 A;  4MSX A;  3M63 A;  3KV5 A;  3O36 A;  1G25 A;  2FUU A;  2G6Q A;  2VPD A;  5TBN A;  2HDP A;  2JMD A;  5TDR A;  2E6R A;  2PNX A;  3C6W A;  3SOW A;  2MIQ A;  2LN0 A;  4A4C A;  2E6S A;  2QIZ A;  2C2L A;  4B86 C;  3SHB A;  2I50 A;  3ZVY A;  3HTK C;  4LK9 A;  2EOD A;  4A4B A;  2LDR A;  2VJF B;  3I2D A;  2LGG A;  5B77 A;  5DKA A;  3HCS A;  2ECG A;  1WEE A;  2CKL B;  2QJ0 A;  5H9M A;  2K17 A;  4YC9 A;  5FER A;  1HYJ A;  2YYR A;  4GNG A;  3NG2 A;  3KV6 A;  2RSD A;  3N9Q A;  4A0C D;  1WEW A;  4QF2 A;  3RPG C;  2EA6 A;  4YAT A;  4AUQ B;  3O70 A;  2VPE A;  5D1L B;  2YQM A;  2VJF A;  5D1M B;  1FBV A;  2JMJ A;  2CSZ A;  2L43 A;  1DVP A;  2Y1N A;  2ECV A;  4A49 A;  2YU4 A;  2CKL A;  5B78 A;  2RI7 A;  4AVX A;  2KFT A;  3VK6 A;  4LAD B;  2MT5 A;  1N87 A;  2LV9 A;  1WEV A;  4LJN A;  4IC3 A;  5LKU A;  1U6G B;  4QF3 A;  2KWO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...