2G43A

Structure of the znf ubp domain from deubiquitinating enzyme isopeptidase t (isot)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
117
structure length
117
Chain Sequence
WDGEVRQVSKHAFSLKQLDNPARIPPCGWKCSKCDMRENLWLNLTDGSILCGRRYFDGSGGNNHAVEHYRETGYPLAVKLGTITPDGADVYSYDEDDMVLDPSLAEHLSHFGIDMLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Ubiquitin Binding Domain ZnF UBP Recognizes the C-Terminal Diglycine Motif of Unanchored Ubiquitin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Ubiquitin carboxyl-terminal hydrolase 5
total genus 28
structure length 117
sequence length 117
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2006-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2g43A01
5C11A 2L80A 4B86C 4CCGX 2KIZA 4L7XA 1WEQA 2KWKA 2LGGA 2RI7A 5B78A 5FB0A 4I7CA 3ZYQA 2VPDA 5DINA 4QF2A 2LRIC 1WEPA 1DVPA 2E6SA 4WZ0A 1VFYA 5B75A 1F62A 2G45A 2XEUA 1WEUA 2KR4A 2H0DA 2F6JA 2DX8A 3O33A 4UP0A 1Z60A 3I2DA 4LLBA 3C6WA 3HCUA 4V3LC 5B76A 3PHDA 3KV5A 2PNXA 5D1LB 3L1ZB 2ECVA 3T6RA 3EB5A 4A0CD 1WGMA 2EA6A 2E6RA 5KH7A 2YUCA 1WILA 3ZPV1 2MNZA 3RPGC 5D1KB 2YSJA 2HYED 3FL2A 2FUIA 2L5UA 3N9NA 4LKAA 3O35A 3PURA 3O70A 4XI1A 2YHNA 2NAAA 2VP7A 4CA1A 3MHSA 1Z6UA 2M85A 2ECJA 3SOXA 5LCWB 2VPBA 4TKPB 3ASLA 2VJFA 2EODA 2LQ6A 2LXPC 5KH9A 5B8DA 2C2LA 2LGVA 3HTKC 2Y43A 1HYJA 2LGLA 3PUQA 1FBVA 2JMIA 5J3XA 4GNEA 2YW8A 3O37A 3KNVA 4L58A 4AUQB 3DQVR 4WZ3B 2I50A 3N9MA 1WENA 2VJEB 2UZGA 4AP4A 4W4UA 1XWHA 1WE9A 4FK5A 2ECIA 3N9QA 1LDKC 3LQJA 1MM3A 2YU4A 4A49A 2Y1MA 2QICA 4B7YC 3KQIA 4MVTA 5JG6A 4I7BA 2EGPA 2F42A 2L0BA 1U6GB 2MNYA 4AYCA 2HDPA 2CKLB 4BBQA 2QIZA 2YYRA 4NN2A 4YAXA 2ZETC 3NG2A 1LDJB 4YBSA 3L1XA 2MT5A 2C2VS 4O64A 4YABA 5AITA 4N4FA 1WEMA 5C13A 1MM2A 3KV6A 4ZQLA 2QJ0A 4FJCA 2YT5A 5G0FA 1FP0A 4LK9A 2CT2A 2F6NA 4A4CA 3ZNIA 2JMJA 4X3GA 2FSAA 1BORA 2M6MA 2KGGA 3U5MA 2LDRA 1HYIA 2Y1NA 3N9LA 5LKXA 4PTBA 5LKTA 1WESA 4P5OB 3RPGB 5G05B 5B79A 2K17A 2KFTA 4PPEA 3O34A 4GNFA 2MD8C 2OXQC 2ECGA 2L43A 3M63A 3ZPVE 4GNDA 1JOCA 5EYAF 3GL6A 3LQHA 2CKLA 4MSXA 5TABA 2PUYA 2ECTA 2ECWA 4N3WA 3O36A 3N9OA 1IYMA 2KWNA 4WA6A 5D1MB 2MD7B 4AYCB 2XB1A 2YSMA 4IC2A 2YREA 2YQLA 2AN6A 1V87A 5FEYA 1WEOA 2LXHC 4A4BA 2VNFA 2H0DB 3GV4A 3SHBA 4IC3A 3IHPA 5TBNA 1WEEA 1CHCA 3MHHA 4YBTA 1WFKA 2YHOA 5H1TA 3U5OA 2KE1A 4C9ZA 4AVXA 2KGIA 2KWJA 5TDWA 3LRQA 5LKUA 5G04B 2D8SA 5DKAA 3M62A 2MUMA 4BHWA 2YURA 3HCTA 5FB1A 3QZVA 2MIQA 4GB0A 3V43A 1VYXA 3VK6A 1G25A 3T7LA 2VJFB 1X4UA 2G6QA 5FERA 3SOWA 2LV9A 3U5NA 1WIMA 3M99A 2CSZA 3RTRB 4GNGA 5TRBA 2JRJA 3SOUA 1WEVA 1X4IA 3ZTGA 1JM7B 2FUUA 2KU3A 5KH3A 2MA5A 3N9PA 3DPLR 2L75A 4ZUXU 4FO9A 2KWOA 2CSYA 5I3LA 4FIPA 4YADA 3ZVYA 1ZBDB 4QF3A 5AIUA 2K4DA 3C5KA 4ZDTA 3HCSA 2JMDA 2KREA 4YBMA 3LQIA 1Z2QA 2G43A 4S3OC 4WZ2A 2VJEA 1N87A 2K16A 2M3HA 3U5PA 2K1JA 3ZVZB 2M1RA 4UI9B 2BAYA 1X4JA 4F52B 5H9MA 4YC9A 2ECNA 4R2YA 4R7EA 2LGKA 1RMDA 5TDRA 5B77A 1JM7A 4S3OB 2IDAA 4Q6FA 5H1VA 3L11A 4I7DA 2MA6A 4V3KC 4UP5A 4R8PK 1E4UA 3O7AA 5H1UA 2YQMA 2KYUA 3EB6A 1WEWA 2VPEA 2VPGA 4LJNA 4LADB 1K2FA 2RSDA 1T1HA 1VD4A 2LN0A 4YATA 5LKZA
chains in the Genus database with same CATH superfamily
5C11A 2L80A 4B86C 4CCGX 2KIZA 4L7XA 2FD4A 3FAOA 1WEQA 2CRRA 2KWKA 2LGGA 2RI7A 5B78A 5FB0A 4I7CA 3ZYQA 5K3QA 2VPDA 5DINA 5SVIB 4QF2A 2LRIC 1WEPA 2E6SA 1DVPA 3LDYA 4WZ0A 1VFYA 5B75A 1F62A 2G45A 2XEUA 2KKYA 1WEUA 2KR4A 2H0DA 2F6JA 2DX8A 3O33A 4UP0A 1Z60A 3I2DA 4LLBA 3C6WA 3HCUA 4V3LC 4O62A 5B76A 3PHDA 3KV5A 2PNXA 5D1LB 3L1ZB 2ECVA 3T6RA 3EB5A 4A0CD 1WGMA 2EA6A 3MDBC 2E6RA 5KH7A 2JM3A 2YUCA 1WILA 3ZPV1 2MNZA 3RPGC 5D1KB 2YSJA 2HYED 3FL2A 2M13A 2FUIA 2L5UA 3N9NA 4LKAA 3O35A 3PURA 3O70A 4XI1A 3KDEC 2YHNA 2NAAA 2VP7A 4CA1A 3MHSA 2LAUA 3FM8C 1Z6UA 2M85A 2ECJA 3SOXA 5LCWB 2VPBA 4TKPB 3ASLA 2VJFA 2EODA 2LQ6A 2LXPC 5KH9A 5B8DA 2C2LA 2LGVA 3HTKC 2Y43A 1HYJA 2LGLA 3PUQA 1FBVA 2JMIA 3O47A 5J3XA 4GNEA 2YW8A 3O37A 3KNVA 4L58A 4AUQB 3DQVR 4WZ3B 2I50A 3N9MA 5SVXA 1WENA 2VJEB 2UZGA 4AP4A 4W4UA 1XWHA 1WE9A 1DCQA 3PLWA 4FK5A 2ECIA 2DJAA 3N9QA 1LDKC 3LQJA 2OWAA 1MM3A 2YU4A 4A49A 3JUEA 2Y1MA 2QICA 4B7YC 3KQIA 4MVTA 5JG6A 4I7BA 2EGPA 2F42A 2L0BA 1U6GB 2MNYA 4AYCA 2HDPA 3DWDA 2CKLB 4BBQA 2QIZA 2YYRA 2KKXA 4NN2A 4YAXA 2ZETC 3NG2A 1LDJB 4YBSA 3L1XA 2MT5A 2C2VS 4F1PA 4O64A 4YABA 4H9DA 5AITA 4N4FA 1WEMA 2FFWA 1MM2A 5C13A 3KV6A 4ZQLA 2QJ0A 4FJCA 2YT5A 5G0FA 1FP0A 4LK9A 2CT2A 2CONA 2F6NA 4A4CA 2E61A 3ZNIA 2JMJA 4X3GA 3H7HA 2FSAA 1BORA 2M6MA 2KGGA 3U5MA 2LDRA 1HYIA 2XOYA 2Y1NA 3N9LA 5LKXA 4PTBA 5LKTA 1WESA 4P5OB 3RPGB 5G05B 4QQ4A 4Z0RA 5B79A 2K17A 2KFTA 2L7PA 4PPEA 3O34A 2RR4A 4GNFA 2MD8C 2OXQC 2ECGA 2XOZA 2L43A 3M63A 3ZPVE 4GNDA 1JOCA 5EYAF 3M7KA 3GL6A 3LQHA 2CKLA 4MSXA 3E2DA 5TABA 2PUYA 2ECTA 3FEHA 2ECWA 4N3WA 3O36A 3N9OA 1IYMA 2KWNA 4WA6A 5D1MB 2MD7B 4AYCB 2XB1A 2YSMA 2CRWA 4IC2A 2YREA 2YQLA 2AN6A 1V87A 5FEYA 5SVIA 1WEOA 2LXHC 2VNFA 3GV4A 2H0DB 3SHBA 4A4BA 4IC3A 4Z0OA 3IHPA 5SVYA 5TBNA 1WEEA 1CHCA 3MHHA 4YBTA 1WFKA 2YHOA 5H1TA 3U5OA 2KE1A 4C9ZA 4OGCA 4AVXA 2KGIA 2KWJA 2P57A 5TDWA 3LRQA 5LKUA 5G04B 2D8SA 2JUNA 5DKAA 3M62A 2MUMA 4BHWA 2YURA 3HCTA 2CSVA 5FB1A 3QZVA 2MIQA 4GB0A 3V43A 1VYXA 3VK6A 1G25A 3T7LA 2VJFB 1X4UA 2G6QA 5FERA 3SOWA 2LV9A 3U5NA 1WIMA 3M99A 2CSZA 3RTRB 4GNGA 5TRBA 2JRJA 3SOUA 1WEVA 1X4IA 3ZTGA 1JM7B 2FUUA 2KU3A 5KH3A 2MA5A 3N9PA 2MKEA 3DPLR 2L75A 4ZUXU 4FO9A 2KWOA 2CSYA 5I3LA 4FIPA 4YADA 3ZVYA 2B0OE 4OGEA 1ZBDB 4QF3A 2IQJA 3LVRE 5AIUA 3DDTA 2K4DA 3C5KA 4ZDTA 3HCSA 2JMDA 2KREA 4YBMA 3LQIA 1Z2QA 2G43A 4S3OC 4WZ2A 2VJEA 3T9KA 1N87A 2K16A 2M3HA 3FANA 3U5PA 2K1JA 3Q1DA 2M1RA 3ZVZB 4UI9B 2BAYA 1X4JA 4F52B 5H9MA 4YC9A 2ECNA 4R2YA 2YVRA 4R7EA 2LGKA 1RMDA 5TDRA 5B77A 1JM7A 2EXUA 3SUBA 4S3OB 2IDAA 4Q6FA 5H1VA 3L11A 4I7DA 2D8UA 2MA6A 3FJUB 3LJUX 4V3KC 4UP5A 2XP0A 4R8PK 1E4UA 3O7AA 1MBMA 5H1UA 2YQMA 2KYUA 3EB6A 3LVQE 1WEWA 2DSMA 2VPEA 2VPGA 2XOCA 4LJNA 4LADB 1K2FA 2RSDA 2EGMA 1T1HA 1VD4A 2LN0A 4YATA 5LKZA
chains in the Genus database with same CATH topology
5C11A 2L80A 4B86C 4CCGX 2KIZA 4L7XA 1WEQA 2KWKA 2LGGA 2RI7A 5B78A 5FB0A 4I7CA 3ZYQA 2VPDA 5DINA 4QF2A 2LRIC 1WEPA 1DVPA 2E6SA 4WZ0A 1VFYA 5B75A 1F62A 2G45A 2XEUA 1WEUA 2KR4A 2H0DA 2F6JA 2DX8A 3O33A 4UP0A 1Z60A 3I2DA 4LLBA 3C6WA 3HCUA 4V3LC 5B76A 3PHDA 3KV5A 2PNXA 5D1LB 3L1ZB 2ECVA 3T6RA 3EB5A 4A0CD 1WGMA 2EA6A 2E6RA 5KH7A 2YUCA 1WILA 3ZPV1 2MNZA 3RPGC 5D1KB 2YSJA 2HYED 3FL2A 2FUIA 2L5UA 3N9NA 4LKAA 3O35A 3PURA 3O70A 4XI1A 2YHNA 2NAAA 2VP7A 4CA1A 3MHSA 1Z6UA 2M85A 2ECJA 3SOXA 5LCWB 2VPBA 4TKPB 3ASLA 2VJFA 2EODA 2LQ6A 2LXPC 5KH9A 5B8DA 2C2LA 2LGVA 3HTKC 2Y43A 1HYJA 2LGLA 3PUQA 1FBVA 2JMIA 5J3XA 4GNEA 2YW8A 3O37A 3KNVA 4L58A 4AUQB 3DQVR 4WZ3B 2I50A 3N9MA 1WENA 2VJEB 2UZGA 4AP4A 4W4UA 1XWHA 1WE9A 4FK5A 2ECIA 3N9QA 1LDKC 3LQJA 1MM3A 2YU4A 4A49A 2Y1MA 2QICA 4B7YC 3KQIA 4MVTA 5JG6A 4I7BA 2EGPA 2F42A 2L0BA 1U6GB 2MNYA 4AYCA 2HDPA 2CKLB 4BBQA 2QIZA 2YYRA 4NN2A 4YAXA 2ZETC 3NG2A 1LDJB 4YBSA 3L1XA 2MT5A 2C2VS 4O64A 4YABA 5AITA 4N4FA 1WEMA 5C13A 1MM2A 3KV6A 4ZQLA 2QJ0A 4FJCA 2YT5A 5G0FA 1FP0A 4LK9A 2CT2A 2F6NA 4A4CA 3ZNIA 2JMJA 4X3GA 2FSAA 1BORA 2M6MA 2KGGA 3U5MA 2LDRA 1HYIA 2Y1NA 3N9LA 5LKXA 4PTBA 5LKTA 1WESA 4P5OB 3RPGB 5G05B 5B79A 2K17A 2KFTA 4PPEA 3O34A 4GNFA 2MD8C 2OXQC 2ECGA 2L43A 3M63A 3ZPVE 4GNDA 1JOCA 5EYAF 3GL6A 3LQHA 2CKLA 4MSXA 5TABA 2PUYA 2ECTA 2ECWA 4N3WA 3O36A 3N9OA 1IYMA 2KWNA 4WA6A 5D1MB 2MD7B 4AYCB 2XB1A 2YSMA 4IC2A 2YREA 2YQLA 2AN6A 1V87A 5FEYA 1WEOA 2LXHC 4A4BA 2VNFA 2H0DB 3GV4A 3SHBA 4IC3A 3IHPA 5TBNA 1WEEA 1CHCA 3MHHA 4YBTA 1WFKA 2YHOA 5H1TA 3U5OA 2KE1A 4C9ZA 4AVXA 2KGIA 2KWJA 5TDWA 3LRQA 5LKUA 5G04B 2D8SA 5DKAA 3M62A 2MUMA 4BHWA 2YURA 3HCTA 5FB1A 3QZVA 2MIQA 4GB0A 3V43A 1VYXA 3VK6A 1G25A 3T7LA 2VJFB 1X4UA 2G6QA 5FERA 3SOWA 2LV9A 3U5NA 1WIMA 3M99A 2CSZA 3RTRB 4GNGA 5TRBA 2JRJA 3SOUA 1WEVA 1X4IA 3ZTGA 1JM7B 2FUUA 2KU3A 5KH3A 2MA5A 3N9PA 3DPLR 2L75A 4ZUXU 4FO9A 2KWOA 2CSYA 5I3LA 4FIPA 4YADA 3ZVYA 1ZBDB 4QF3A 5AIUA 2K4DA 3C5KA 4ZDTA 3HCSA 2JMDA 2KREA 4YBMA 3LQIA 1Z2QA 2G43A 4S3OC 4WZ2A 2VJEA 1N87A 2K16A 2M3HA 3U5PA 2K1JA 3ZVZB 2M1RA 4UI9B 2BAYA 1X4JA 4F52B 5H9MA 4YC9A 2ECNA 4R2YA 4R7EA 2LGKA 1RMDA 5TDRA 5B77A 1JM7A 4S3OB 2IDAA 4Q6FA 5H1VA 3L11A 4I7DA 2MA6A 4V3KC 4UP5A 4R8PK 1E4UA 3O7AA 5H1UA 2YQMA 2KYUA 3EB6A 1WEWA 2VPEA 2VPGA 4LJNA 4LADB 1K2FA 2RSDA 1T1HA 1VD4A 2LN0A 4YATA 5LKZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C11 A;  2L80 A;  4B86 C;  4CCG X;  2KIZ A;  4L7X A;  1WEQ A;  2KWK A;  2LGG A;  2RI7 A;  5B78 A;  5FB0 A;  4I7C A;  3ZYQ A;  2VPD A;  5DIN A;  4QF2 A;  2LRI C;  1WEP A;  1DVP A;  2E6S A;  4WZ0 A;  1VFY A;  5B75 A;  1F62 A;  2G45 A;  2XEU A;  1WEU A;  2KR4 A;  2H0D A;  2F6J A;  2DX8 A;  3O33 A;  4UP0 A;  1Z60 A;  3I2D A;  4LLB A;  3C6W A;  3HCU A;  4V3L C;  5B76 A;  3PHD A;  3KV5 A;  2PNX A;  5D1L B;  3L1Z B;  2ECV A;  3T6R A;  3EB5 A;  4A0C D;  1WGM A;  2EA6 A;  2E6R A;  5KH7 A;  2YUC A;  1WIL A;  3ZPV 1;  2MNZ A;  3RPG C;  5D1K B;  2YSJ A;  2HYE D;  3FL2 A;  2FUI A;  2L5U A;  3N9N A;  4LKA A;  3O35 A;  3PUR A;  3O70 A;  4XI1 A;  2YHN A;  2NAA A;  2VP7 A;  4CA1 A;  3MHS A;  1Z6U A;  2M85 A;  2ECJ A;  3SOX A;  5LCW B;  2VPB A;  4TKP B;  3ASL A;  2VJF A;  2EOD A;  2LQ6 A;  2LXP C;  5KH9 A;  5B8D A;  2C2L A;  2LGV A;  3HTK C;  2Y43 A;  1HYJ A;  2LGL A;  3PUQ A;  1FBV A;  2JMI A;  5J3X A;  4GNE A;  2YW8 A;  3O37 A;  3KNV A;  4L58 A;  4AUQ B;  3DQV R;  4WZ3 B;  2I50 A;  3N9M A;  1WEN A;  2VJE B;  2UZG A;  4AP4 A;  4W4U A;  1XWH A;  1WE9 A;  4FK5 A;  2ECI A;  3N9Q A;  1LDK C;  3LQJ A;  1MM3 A;  2YU4 A;  4A49 A;  2Y1M A;  2QIC A;  4B7Y C;  3KQI A;  4MVT A;  5JG6 A;  4I7B A;  2EGP A;  2F42 A;  2L0B A;  1U6G B;  2MNY A;  4AYC A;  2HDP A;  2CKL B;  4BBQ A;  2QIZ A;  2YYR A;  4NN2 A;  4YAX A;  2ZET C;  3NG2 A;  1LDJ B;  4YBS A;  3L1X A;  2MT5 A;  2C2V S;  4O64 A;  4YAB A;  5AIT A;  4N4F A;  1WEM A;  5C13 A;  1MM2 A;  3KV6 A;  4ZQL A;  2QJ0 A;  4FJC A;  2YT5 A;  5G0F A;  1FP0 A;  4LK9 A;  2CT2 A;  2F6N A;  4A4C A;  3ZNI A;  2JMJ A;  4X3G A;  2FSA A;  1BOR A;  2M6M A;  2KGG A;  3U5M A;  2LDR A;  1HYI A;  2Y1N A;  3N9L A;  5LKX A;  4PTB A;  5LKT A;  1WES A;  4P5O B;  3RPG B;  5G05 B;  5B79 A;  2K17 A;  2KFT A;  4PPE A;  3O34 A;  4GNF A;  2MD8 C;  2OXQ C;  2ECG A;  2L43 A;  3M63 A;  3ZPV E;  4GND A;  1JOC A;  5EYA F;  3GL6 A;  3LQH A;  2CKL A;  4MSX A;  5TAB A;  2PUY A;  2ECT A;  2ECW A;  4N3W A;  3O36 A;  3N9O A;  1IYM A;  2KWN A;  4WA6 A;  5D1M B;  2MD7 B;  4AYC B;  2XB1 A;  2YSM A;  4IC2 A;  2YRE A;  2YQL A;  2AN6 A;  1V87 A;  5FEY A;  1WEO A;  2LXH C;  4A4B A;  2VNF A;  2H0D B;  3GV4 A;  3SHB A;  4IC3 A;  3IHP A;  5TBN A;  1WEE A;  1CHC A;  3MHH A;  4YBT A;  1WFK A;  2YHO A;  5H1T A;  3U5O A;  2KE1 A;  4C9Z A;  4AVX A;  2KGI A;  2KWJ A;  5TDW A;  3LRQ A;  5LKU A;  5G04 B;  2D8S A;  5DKA A;  3M62 A;  2MUM A;  4BHW A;  2YUR A;  3HCT A;  5FB1 A;  3QZV A;  2MIQ A;  4GB0 A;  3V43 A;  1VYX A;  3VK6 A;  1G25 A;  3T7L A;  2VJF B;  1X4U A;  2G6Q A;  5FER A;  3SOW A;  2LV9 A;  3U5N A;  1WIM A;  3M99 A;  2CSZ A;  3RTR B;  4GNG A;  5TRB A;  2JRJ A;  3SOU A;  1WEV A;  1X4I A;  3ZTG A;  1JM7 B;  2FUU A;  2KU3 A;  5KH3 A;  2MA5 A;  3N9P A;  3DPL R;  2L75 A;  4ZUX U;  4FO9 A;  2KWO A;  2CSY A;  5I3L A;  4FIP A;  4YAD A;  3ZVY A;  1ZBD B;  4QF3 A;  5AIU A;  2K4D A;  3C5K A;  4ZDT A;  3HCS A;  2JMD A;  2KRE A;  4YBM A;  3LQI A;  1Z2Q A;  2G43 A;  4S3O C;  4WZ2 A;  2VJE A;  1N87 A;  2K16 A;  2M3H A;  3U5P A;  2K1J A;  3ZVZ B;  2M1R A;  4UI9 B;  2BAY A;  1X4J A;  4F52 B;  5H9M A;  4YC9 A;  2ECN A;  4R2Y A;  4R7E A;  2LGK A;  1RMD A;  5TDR A;  5B77 A;  1JM7 A;  4S3O B;  2IDA A;  4Q6F A;  5H1V A;  3L11 A;  4I7D A;  2MA6 A;  4V3K C;  4UP5 A;  4R8P K;  1E4U A;  3O7A A;  5H1U A;  2YQM A;  2KYU A;  3EB6 A;  1WEW A;  2VPE A;  2VPG A;  4LJN A;  4LAD B;  1K2F A;  2RSD A;  1T1H A;  1VD4 A;  2LN0 A;  4YAT A;  5LKZ A; 
#chains in the Genus database with same CATH topology
 5C11 A;  2L80 A;  4B86 C;  4CCG X;  2KIZ A;  4L7X A;  2FD4 A;  3FAO A;  1WEQ A;  2CRR A;  2KWK A;  2LGG A;  2RI7 A;  5B78 A;  5FB0 A;  4I7C A;  3ZYQ A;  5K3Q A;  2VPD A;  5DIN A;  5SVI B;  4QF2 A;  2LRI C;  1WEP A;  2E6S A;  1DVP A;  3LDY A;  4WZ0 A;  1VFY A;  5B75 A;  1F62 A;  2G45 A;  2XEU A;  2KKY A;  1WEU A;  2KR4 A;  2H0D A;  2F6J A;  2DX8 A;  3O33 A;  4UP0 A;  1Z60 A;  3I2D A;  4LLB A;  3C6W A;  3HCU A;  4V3L C;  4O62 A;  5B76 A;  3PHD A;  3KV5 A;  2PNX A;  5D1L B;  3L1Z B;  2ECV A;  3T6R A;  3EB5 A;  4A0C D;  1WGM A;  2EA6 A;  3MDB C;  2E6R A;  5KH7 A;  2JM3 A;  2YUC A;  1WIL A;  3ZPV 1;  2MNZ A;  3RPG C;  5D1K B;  2YSJ A;  2HYE D;  3FL2 A;  2M13 A;  2FUI A;  2L5U A;  3N9N A;  4LKA A;  3O35 A;  3PUR A;  3O70 A;  4XI1 A;  3KDE C;  2YHN A;  2NAA A;  2VP7 A;  4CA1 A;  3MHS A;  2LAU A;  3FM8 C;  1Z6U A;  2M85 A;  2ECJ A;  3SOX A;  5LCW B;  2VPB A;  4TKP B;  3ASL A;  2VJF A;  2EOD A;  2LQ6 A;  2LXP C;  5KH9 A;  5B8D A;  2C2L A;  2LGV A;  3HTK C;  2Y43 A;  1HYJ A;  2LGL A;  3PUQ A;  1FBV A;  2JMI A;  3O47 A;  5J3X A;  4GNE A;  2YW8 A;  3O37 A;  3KNV A;  4L58 A;  4AUQ B;  3DQV R;  4WZ3 B;  2I50 A;  3N9M A;  5SVX A;  1WEN A;  2VJE B;  2UZG A;  4AP4 A;  4W4U A;  1XWH A;  1WE9 A;  1DCQ A;  3PLW A;  4FK5 A;  2ECI A;  2DJA A;  3N9Q A;  1LDK C;  3LQJ A;  2OWA A;  1MM3 A;  2YU4 A;  4A49 A;  3JUE A;  2Y1M A;  2QIC A;  4B7Y C;  3KQI A;  4MVT A;  5JG6 A;  4I7B A;  2EGP A;  2F42 A;  2L0B A;  1U6G B;  2MNY A;  4AYC A;  2HDP A;  3DWD A;  2CKL B;  4BBQ A;  2QIZ A;  2YYR A;  2KKX A;  4NN2 A;  4YAX A;  2ZET C;  3NG2 A;  1LDJ B;  4YBS A;  3L1X A;  2MT5 A;  2C2V S;  4F1P A;  4O64 A;  4YAB A;  4H9D A;  5AIT A;  4N4F A;  1WEM A;  2FFW A;  1MM2 A;  5C13 A;  3KV6 A;  4ZQL A;  2QJ0 A;  4FJC A;  2YT5 A;  5G0F A;  1FP0 A;  4LK9 A;  2CT2 A;  2CON A;  2F6N A;  4A4C A;  2E61 A;  3ZNI A;  2JMJ A;  4X3G A;  3H7H A;  2FSA A;  1BOR A;  2M6M A;  2KGG A;  3U5M A;  2LDR A;  1HYI A;  2XOY A;  2Y1N A;  3N9L A;  5LKX A;  4PTB A;  5LKT A;  1WES A;  4P5O B;  3RPG B;  5G05 B;  4QQ4 A;  4Z0R A;  5B79 A;  2K17 A;  2KFT A;  2L7P A;  4PPE A;  3O34 A;  2RR4 A;  4GNF A;  2MD8 C;  2OXQ C;  2ECG A;  2XOZ A;  2L43 A;  3M63 A;  3ZPV E;  4GND A;  1JOC A;  5EYA F;  3M7K A;  3GL6 A;  3LQH A;  2CKL A;  4MSX A;  3E2D A;  5TAB A;  2PUY A;  2ECT A;  3FEH A;  2ECW A;  4N3W A;  3O36 A;  3N9O A;  1IYM A;  2KWN A;  4WA6 A;  5D1M B;  2MD7 B;  4AYC B;  2XB1 A;  2YSM A;  2CRW A;  4IC2 A;  2YRE A;  2YQL A;  2AN6 A;  1V87 A;  5FEY A;  5SVI A;  1WEO A;  2LXH C;  2VNF A;  3GV4 A;  2H0D B;  3SHB A;  4A4B A;  4IC3 A;  4Z0O A;  3IHP A;  5SVY A;  5TBN A;  1WEE A;  1CHC A;  3MHH A;  4YBT A;  1WFK A;  2YHO A;  5H1T A;  3U5O A;  2KE1 A;  4C9Z A;  4OGC A;  4AVX A;  2KGI A;  2KWJ A;  2P57 A;  5TDW A;  3LRQ A;  5LKU A;  5G04 B;  2D8S A;  2JUN A;  5DKA A;  3M62 A;  2MUM A;  4BHW A;  2YUR A;  3HCT A;  2CSV A;  5FB1 A;  3QZV A;  2MIQ A;  4GB0 A;  3V43 A;  1VYX A;  3VK6 A;  1G25 A;  3T7L A;  2VJF B;  1X4U A;  2G6Q A;  5FER A;  3SOW A;  2LV9 A;  3U5N A;  1WIM A;  3M99 A;  2CSZ A;  3RTR B;  4GNG A;  5TRB A;  2JRJ A;  3SOU A;  1WEV A;  1X4I A;  3ZTG A;  1JM7 B;  2FUU A;  2KU3 A;  5KH3 A;  2MA5 A;  3N9P A;  2MKE A;  3DPL R;  2L75 A;  4ZUX U;  4FO9 A;  2KWO A;  2CSY A;  5I3L A;  4FIP A;  4YAD A;  3ZVY A;  2B0O E;  4OGE A;  1ZBD B;  4QF3 A;  2IQJ A;  3LVR E;  5AIU A;  3DDT A;  2K4D A;  3C5K A;  4ZDT A;  3HCS A;  2JMD A;  2KRE A;  4YBM A;  3LQI A;  1Z2Q A;  2G43 A;  4S3O C;  4WZ2 A;  2VJE A;  3T9K A;  1N87 A;  2K16 A;  2M3H A;  3FAN A;  3U5P A;  2K1J A;  3Q1D A;  2M1R A;  3ZVZ B;  4UI9 B;  2BAY A;  1X4J A;  4F52 B;  5H9M A;  4YC9 A;  2ECN A;  4R2Y A;  2YVR A;  4R7E A;  2LGK A;  1RMD A;  5TDR A;  5B77 A;  1JM7 A;  2EXU A;  3SUB A;  4S3O B;  2IDA A;  4Q6F A;  5H1V A;  3L11 A;  4I7D A;  2D8U A;  2MA6 A;  3FJU B;  3LJU X;  4V3K C;  4UP5 A;  2XP0 A;  4R8P K;  1E4U A;  3O7A A;  1MBM A;  5H1U A;  2YQM A;  2KYU A;  3EB6 A;  3LVQ E;  1WEW A;  2DSM A;  2VPE A;  2VPG A;  2XOC A;  4LJN A;  4LAD B;  1K2F A;  2RSD A;  2EGM A;  1T1H A;  1VD4 A;  2LN0 A;  4YAT A;  5LKZ A; 
#chains in the Genus database with same CATH homology
 5C11 A;  2L80 A;  4B86 C;  4CCG X;  2KIZ A;  4L7X A;  1WEQ A;  2KWK A;  2LGG A;  2RI7 A;  5B78 A;  5FB0 A;  4I7C A;  3ZYQ A;  2VPD A;  5DIN A;  4QF2 A;  2LRI C;  1WEP A;  1DVP A;  2E6S A;  4WZ0 A;  1VFY A;  5B75 A;  1F62 A;  2G45 A;  2XEU A;  1WEU A;  2KR4 A;  2H0D A;  2F6J A;  2DX8 A;  3O33 A;  4UP0 A;  1Z60 A;  3I2D A;  4LLB A;  3C6W A;  3HCU A;  4V3L C;  5B76 A;  3PHD A;  3KV5 A;  2PNX A;  5D1L B;  3L1Z B;  2ECV A;  3T6R A;  3EB5 A;  4A0C D;  1WGM A;  2EA6 A;  2E6R A;  5KH7 A;  2YUC A;  1WIL A;  3ZPV 1;  2MNZ A;  3RPG C;  5D1K B;  2YSJ A;  2HYE D;  3FL2 A;  2FUI A;  2L5U A;  3N9N A;  4LKA A;  3O35 A;  3PUR A;  3O70 A;  4XI1 A;  2YHN A;  2NAA A;  2VP7 A;  4CA1 A;  3MHS A;  1Z6U A;  2M85 A;  2ECJ A;  3SOX A;  5LCW B;  2VPB A;  4TKP B;  3ASL A;  2VJF A;  2EOD A;  2LQ6 A;  2LXP C;  5KH9 A;  5B8D A;  2C2L A;  2LGV A;  3HTK C;  2Y43 A;  1HYJ A;  2LGL A;  3PUQ A;  1FBV A;  2JMI A;  5J3X A;  4GNE A;  2YW8 A;  3O37 A;  3KNV A;  4L58 A;  4AUQ B;  3DQV R;  4WZ3 B;  2I50 A;  3N9M A;  1WEN A;  2VJE B;  2UZG A;  4AP4 A;  4W4U A;  1XWH A;  1WE9 A;  4FK5 A;  2ECI A;  3N9Q A;  1LDK C;  3LQJ A;  1MM3 A;  2YU4 A;  4A49 A;  2Y1M A;  2QIC A;  4B7Y C;  3KQI A;  4MVT A;  5JG6 A;  4I7B A;  2EGP A;  2F42 A;  2L0B A;  1U6G B;  2MNY A;  4AYC A;  2HDP A;  2CKL B;  4BBQ A;  2QIZ A;  2YYR A;  4NN2 A;  4YAX A;  2ZET C;  3NG2 A;  1LDJ B;  4YBS A;  3L1X A;  2MT5 A;  2C2V S;  4O64 A;  4YAB A;  5AIT A;  4N4F A;  1WEM A;  5C13 A;  1MM2 A;  3KV6 A;  4ZQL A;  2QJ0 A;  4FJC A;  2YT5 A;  5G0F A;  1FP0 A;  4LK9 A;  2CT2 A;  2F6N A;  4A4C A;  3ZNI A;  2JMJ A;  4X3G A;  2FSA A;  1BOR A;  2M6M A;  2KGG A;  3U5M A;  2LDR A;  1HYI A;  2Y1N A;  3N9L A;  5LKX A;  4PTB A;  5LKT A;  1WES A;  4P5O B;  3RPG B;  5G05 B;  5B79 A;  2K17 A;  2KFT A;  4PPE A;  3O34 A;  4GNF A;  2MD8 C;  2OXQ C;  2ECG A;  2L43 A;  3M63 A;  3ZPV E;  4GND A;  1JOC A;  5EYA F;  3GL6 A;  3LQH A;  2CKL A;  4MSX A;  5TAB A;  2PUY A;  2ECT A;  2ECW A;  4N3W A;  3O36 A;  3N9O A;  1IYM A;  2KWN A;  4WA6 A;  5D1M B;  2MD7 B;  4AYC B;  2XB1 A;  2YSM A;  4IC2 A;  2YRE A;  2YQL A;  2AN6 A;  1V87 A;  5FEY A;  1WEO A;  2LXH C;  4A4B A;  2VNF A;  2H0D B;  3GV4 A;  3SHB A;  4IC3 A;  3IHP A;  5TBN A;  1WEE A;  1CHC A;  3MHH A;  4YBT A;  1WFK A;  2YHO A;  5H1T A;  3U5O A;  2KE1 A;  4C9Z A;  4AVX A;  2KGI A;  2KWJ A;  5TDW A;  3LRQ A;  5LKU A;  5G04 B;  2D8S A;  5DKA A;  3M62 A;  2MUM A;  4BHW A;  2YUR A;  3HCT A;  5FB1 A;  3QZV A;  2MIQ A;  4GB0 A;  3V43 A;  1VYX A;  3VK6 A;  1G25 A;  3T7L A;  2VJF B;  1X4U A;  2G6Q A;  5FER A;  3SOW A;  2LV9 A;  3U5N A;  1WIM A;  3M99 A;  2CSZ A;  3RTR B;  4GNG A;  5TRB A;  2JRJ A;  3SOU A;  1WEV A;  1X4I A;  3ZTG A;  1JM7 B;  2FUU A;  2KU3 A;  5KH3 A;  2MA5 A;  3N9P A;  3DPL R;  2L75 A;  4ZUX U;  4FO9 A;  2KWO A;  2CSY A;  5I3L A;  4FIP A;  4YAD A;  3ZVY A;  1ZBD B;  4QF3 A;  5AIU A;  2K4D A;  3C5K A;  4ZDT A;  3HCS A;  2JMD A;  2KRE A;  4YBM A;  3LQI A;  1Z2Q A;  2G43 A;  4S3O C;  4WZ2 A;  2VJE A;  1N87 A;  2K16 A;  2M3H A;  3U5P A;  2K1J A;  3ZVZ B;  2M1R A;  4UI9 B;  2BAY A;  1X4J A;  4F52 B;  5H9M A;  4YC9 A;  2ECN A;  4R2Y A;  4R7E A;  2LGK A;  1RMD A;  5TDR A;  5B77 A;  1JM7 A;  4S3O B;  2IDA A;  4Q6F A;  5H1V A;  3L11 A;  4I7D A;  2MA6 A;  4V3K C;  4UP5 A;  4R8P K;  1E4U A;  3O7A A;  5H1U A;  2YQM A;  2KYU A;  3EB6 A;  1WEW A;  2VPE A;  2VPG A;  4LJN A;  4LAD B;  1K2F A;  2RSD A;  1T1H A;  1VD4 A;  2LN0 A;  4YAT A;  5LKZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...