2G43A

Structure of the znf ubp domain from deubiquitinating enzyme isopeptidase t (isot)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
117
structure length
117
Chain Sequence
WDGEVRQVSKHAFSLKQLDNPARIPPCGWKCSKCDMRENLWLNLTDGSILCGRRYFDGSGGNNHAVEHYRETGYPLAVKLGTITPDGADVYSYDEDDMVLDPSLAEHLSHFGIDMLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin carboxyl-terminal hydrolase 5
publication title The Ubiquitin Binding Domain ZnF UBP Recognizes the C-Terminal Diglycine Motif of Unanchored Ubiquitin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 28
structure length 117
sequence length 117
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2006-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2g43A01
4S3OC 2UZGA 4L58A 4I7CA 5D1MB 4P5OB 4AYCB 3KNVA 5DKAA 4R8PK 2JMIA 2KREA 4MVTA 3LQHA 2G45A 2VJFB 4GNGA 2L75A 1E4UA 3ASLA 1V87A 4O64A 1U6GB 2CSYA 4B86C 2C2LA 3L1ZB 4FIPA 2VP7A 2LGVA 3I2DA 1LDJB 2VPBA 5H1TA 4LK9A 1X4IA 5H1UA 2ECJA 2D8SA 3N9OA 3HCSA 4YBMA 2Y1MA 3HTKC 3VK6A 4B7YC 3U5MA 2MUMA 2YHOA 2YREA 4LKAA 2L43A 5LKXA 3ZNIA 4GB0A 2BAYA 2EA6A 2KWNA 4WZ2A 1VYXA 4Q6FA 5KH9A 2KE1A 1WEQA 4A4BA 3KV6A 5B8DA 3GL6A 4FO9A 2ECNA 2LV9A 2M6MA 2AN6A 2F6JA 4UP5A 3O33A 2YU4A 4V3KC 2VJEA 2ZETC 2KWOA 4A4CA 2QICA 5JG6A 3KQIA 5G05B 5C13A 5FB0A 3MHHA 1Z60A 3N9MA 3O34A 2YQMA 2LXPC 3SHBA 4ZDTA 2MIQA 1HYIA 5EYAF 2LRIC 5LCWB 4LLBA 1VD4A 2HDPA 2PNXA 5G0FA 4WZ3B 2L5UA 1WENA 2LGGA 5B78A 2ECWA 2LDRA 4W4UA 5TDRA 2VJEB 1XWHA 1MM3A 5H1VA 3EB6A 1X4JA 3ZYQA 2MT5A 5H9MA 3IHPA 2FSAA 4I7DA 3ZPV1 4PTBA 3PHDA 2KFTA 1Z2QA 2K16A 4CCGX 5LKUA 4LJNA 4WZ0A 2VPGA 3V43A 5FERA 1X4UA 2EGPA 2LXHC 3GV4A 5AITA 2QIZA 2YSMA 2H0DA 2C2VS 2JMDA 4R2YA 1WILA 2ECVA 5I3LA 3ZPVE 5D1KB 2RI7A 2LGLA 2OXQC 4YADA 4YBTA 1WE9A 4GNDA 4UP0A 3FL2A 3T7LA 4YC9A 2YURA 4F52B 3O70A 4AP4A 3O7AA 3DQVR 5FEYA 5TABA 1JOCA 3LRQA 2E6RA 2LGKA 4GNFA 1Z6UA 2YHNA 2Y43A 2YYRA 3SOWA 3U5NA 5J3XA 1WEPA 3O35A 1MM2A 3RPGB 3PURA 4L7XA 2I50A 4YBSA 4UI9B 2H0DB 5TRBA 1WFKA 3N9PA 2Y1NA 2YSJA 1BORA 4BHWA 2K17A 2L0BA 2LN0A 5D1LB 2IDAA 4A0CD 3C5KA 2YW8A 2G43A 4N3WA 4FJCA 2KR4A 4V3LC 2KGGA 3ZVYA 3O36A 4ZUXU 2JMJA 4QF2A 4MSXA 2ECGA 2YT5A 2ECIA 2NAAA 2KYUA 4QF3A 5TBNA 3L11A 2F42A 2E6SA 2KWKA 2F6NA 2VJFA 1JM7A 1CHCA 1WEMA 4CA1A 5DINA 4YATA 3DPLR 2VPDA 4A49A 2FUUA 2VPEA 2CSZA 3NG2A 2ECTA 4IC2A 2M3HA 5TDWA 2KU3A 2K1JA 4WA6A 5LKZA 1G25A 5KH3A 3M63A 3ZVZB 3U5OA 5G04B 1WEUA 1WGMA 4YABA 2CKLA 3N9NA 3M62A 3EB5A 3RPGC 2YUCA 1RMDA 5AIUA 1N87A 4PPEA 1JM7B 2KGIA 2JRJA 1ZBDB 2KWJA 3T6RA 2CT2A 3LQIA 2M85A 2MNZA 2XEUA 2MD8C 2HYED 1IYMA 4LADB 1WEVA 4R7EA 4S3OB 5B79A 2PUYA 3QZVA 2QJ0A 3L1XA 2MD7B 1FBVA 5B77A 2G6QA 4TKPB 4C9ZA 3O37A 2CKLB 2K4DA 2VNFA 3N9LA 2M1RA 4IC3A 3SOXA 3MHSA 2MA5A 4YAXA 1F62A 1DVPA 5KH7A 2XB1A 4AVXA 4AUQB 3KV5A 1WIMA 2MNYA 2RSDA 3M99A 2YQLA 5B76A 1FP0A 5C11A 3U5PA 4GNEA 2FUIA 5B75A 1K2FA 4AYCA 1WEEA 4BBQA 3N9QA 4N4FA 2DX8A 4XI1A 1WEOA 1LDKC 4I7BA 3LQJA 2L80A 1VFYA 3HCTA 1HYJA 3C6WA 3HCUA 3SOUA 2EODA 5FB1A 4FK5A 3RTRB 4X3GA 3PUQA 1T1HA 3ZTGA 1WESA 2MA6A 2KIZA 1WEWA 2LQ6A 4ZQLA 4NN2A 5LKTA
chains in the Genus database with same CATH superfamily
4S3OC 2UZGA 4L58A 4I7CA 4QQ4A 5D1MB 4P5OB 4AYCB 3KNVA 5DKAA 3E2DA 3DWDA 4R8PK 2JMIA 2KREA 4MVTA 3LQHA 2G45A 3PLWA 2VJFB 4GNGA 2L75A 1E4UA 3ASLA 1V87A 4O64A 1U6GB 2CSYA 4B86C 2C2LA 3L1ZB 4FIPA 2VP7A 2CRRA 2LGVA 3I2DA 1LDJB 2VPBA 5H1TA 4LK9A 1X4IA 5H1UA 2ECJA 2D8SA 3N9OA 3LVRE 3HCSA 4YBMA 2Y1MA 3HTKC 3VK6A 4B7YC 2MKEA 3U5MA 2MUMA 2YHOA 2YREA 4LKAA 2L43A 5LKXA 3ZNIA 4GB0A 2BAYA 2EA6A 2KWNA 4WZ2A 1VYXA 4Q6FA 5KH9A 2D8UA 2KE1A 1WEQA 4A4BA 3KV6A 2DSMA 5B8DA 3GL6A 4FO9A 2ECNA 2LV9A 2M6MA 2AN6A 2F6JA 4UP5A 2FD4A 3O33A 2YU4A 4V3KC 2VJEA 2ZETC 2KWOA 4A4CA 2QICA 5JG6A 4F1PA 3KQIA 5G05B 5C13A 5FB0A 3MHHA 1Z60A 3JUEA 3N9MA 3MDBC 3O34A 2YQMA 2LXPC 3SHBA 4ZDTA 2MIQA 1HYIA 5EYAF 2LRIC 5LCWB 4LLBA 1VD4A 2CSVA 2HDPA 2PNXA 5G0FA 4WZ3B 2L5UA 1WENA 2LGGA 3H7HA 5B78A 2ECWA 2LDRA 4W4UA 5TDRA 2RR4A 2VJEB 1XWHA 1MM3A 5H1VA 3KDEC 3EB6A 1X4JA 3ZYQA 2MT5A 5H9MA 3IHPA 2FSAA 3FEHA 3FM8C 2YVRA 4I7DA 3ZPV1 4PTBA 3PHDA 2KFTA 1Z2QA 2K16A 4CCGX 5LKUA 4LJNA 4WZ0A 2VPGA 3V43A 2LAUA 1X4UA 5FERA 2EGPA 2LXHC 2B0OE 3GV4A 5AITA 2QIZA 2YSMA 2H0DA 2C2VS 2JMDA 4R2YA 1WILA 4OGCA 2ECVA 5I3LA 3FJUB 3ZPVE 5D1KB 2RI7A 2LGLA 2OXQC 4YADA 4YBTA 1WE9A 4GNDA 4UP0A 3FL2A 3T7LA 4YC9A 2YURA 4F52B 3O70A 2XOCA 4AP4A 3O7AA 3DQVR 5SVXA 5FEYA 5TABA 1JOCA 3LRQA 2E6RA 2LGKA 4GNFA 1Z6UA 2YHNA 2Y43A 2YYRA 3SOWA 3U5NA 3DDTA 5J3XA 1WEPA 3O35A 1MM2A 3RPGB 3PURA 4L7XA 2I50A 4YBSA 4UI9B 2H0DB 5TRBA 1WFKA 3N9PA 2M13A 2Y1NA 2YSJA 1BORA 4BHWA 2K17A 3Q1DA 2L0BA 2LN0A 5D1LB 2IDAA 4A0CD 2JUNA 3C5KA 2EGMA 2YW8A 2G43A 4N3WA 2XP0A 4FJCA 2DJAA 2KR4A 4V3LC 2KGGA 3ZVYA 3O36A 5SVIA 4ZUXU 2JMJA 4QF2A 4MSXA 2ECGA 2YT5A 2ECIA 2NAAA 2KYUA 4QF3A 2CONA 5TBNA 3L11A 2F42A 2E6SA 2KWKA 3O47A 2F6NA 2VJFA 1JM7A 1CHCA 1WEMA 4CA1A 5DINA 4YATA 3DPLR 4OGEA 2VPDA 4A49A 2FUUA 2VPEA 2CSZA 3NG2A 1DCQA 2ECTA 4IC2A 2M3HA 5TDWA 2KU3A 2K1JA 4WA6A 5LKZA 1G25A 5KH3A 3M63A 3ZVZB 3U5OA 5G04B 5K3QA 1WEUA 2EXUA 1WGMA 4YABA 5SVIB 2CKLA 3N9NA 3M62A 3EB5A 3RPGC 2P57A 2YUCA 1RMDA 5AIUA 1N87A 4PPEA 1JM7B 2E61A 2KGIA 2JRJA 1ZBDB 3LVQE 2KWJA 4Z0OA 3T6RA 2CT2A 3LQIA 2M85A 2MNZA 5SVYA 2XEUA 2MD8C 2HYED 1IYMA 4LADB 3T9KA 1WEVA 4R7EA 4S3OB 5B79A 2XOZA 2PUYA 3QZVA 2QJ0A 3L1XA 2MD7B 3SUBA 1FBVA 5B77A 2G6QA 4TKPB 4C9ZA 4Z0RA 3O37A 4O62A 2CKLB 2K4DA 2VNFA 3N9LA 2M1RA 4IC3A 3SOXA 3MHSA 2MA5A 1MBMA 2XOYA 4YAXA 1F62A 3LDYA 1DVPA 5KH7A 2XB1A 3LJUX 4AVXA 4AUQB 3KV5A 1WIMA 2MNYA 2RSDA 3M99A 2YQLA 5B76A 3FANA 1FP0A 5C11A 3U5PA 4GNEA 2KKYA 2FUIA 5B75A 2OWAA 1K2FA 4AYCA 1WEEA 4BBQA 3FAOA 3N9QA 4N4FA 2DX8A 4XI1A 1WEOA 1LDKC 4I7BA 4H9DA 3LQJA 2L80A 1VFYA 3HCTA 1HYJA 3C6WA 2CRWA 3HCUA 3SOUA 2EODA 5FB1A 4FK5A 3RTRB 4X3GA 2IQJA 3PUQA 2JM3A 2KKXA 2L7PA 1T1HA 3ZTGA 3M7KA 1WESA 2FFWA 2MA6A 2KIZA 1WEWA 2LQ6A 4ZQLA 4NN2A 5LKTA
chains in the Genus database with same CATH topology
4S3OC 2UZGA 4L58A 4I7CA 5D1MB 4P5OB 4AYCB 3KNVA 5DKAA 4R8PK 2JMIA 2KREA 4MVTA 3LQHA 2G45A 2VJFB 4GNGA 2L75A 1E4UA 3ASLA 1V87A 4O64A 1U6GB 2CSYA 4B86C 2C2LA 3L1ZB 4FIPA 2VP7A 2LGVA 3I2DA 1LDJB 2VPBA 5H1TA 4LK9A 1X4IA 5H1UA 2ECJA 2D8SA 3N9OA 3HCSA 4YBMA 2Y1MA 3HTKC 3VK6A 4B7YC 3U5MA 2MUMA 2YHOA 2YREA 4LKAA 2L43A 5LKXA 3ZNIA 4GB0A 2BAYA 2EA6A 2KWNA 4WZ2A 1VYXA 4Q6FA 5KH9A 2KE1A 1WEQA 4A4BA 3KV6A 5B8DA 3GL6A 4FO9A 2ECNA 2LV9A 2M6MA 2AN6A 2F6JA 4UP5A 3O33A 2YU4A 4V3KC 2VJEA 2ZETC 2KWOA 4A4CA 2QICA 5JG6A 3KQIA 5G05B 5C13A 5FB0A 3MHHA 1Z60A 3N9MA 3O34A 2YQMA 2LXPC 3SHBA 4ZDTA 2MIQA 1HYIA 5EYAF 2LRIC 5LCWB 4LLBA 1VD4A 2HDPA 2PNXA 5G0FA 4WZ3B 2L5UA 1WENA 2LGGA 5B78A 2ECWA 2LDRA 4W4UA 5TDRA 2VJEB 1XWHA 1MM3A 5H1VA 3EB6A 1X4JA 3ZYQA 2MT5A 5H9MA 3IHPA 2FSAA 4I7DA 3ZPV1 4PTBA 3PHDA 2KFTA 1Z2QA 2K16A 4CCGX 5LKUA 4LJNA 4WZ0A 2VPGA 3V43A 5FERA 1X4UA 2EGPA 2LXHC 3GV4A 5AITA 2QIZA 2YSMA 2H0DA 2C2VS 2JMDA 4R2YA 1WILA 2ECVA 5I3LA 3ZPVE 5D1KB 2RI7A 2LGLA 2OXQC 4YADA 4YBTA 1WE9A 4GNDA 4UP0A 3FL2A 3T7LA 4YC9A 2YURA 4F52B 3O70A 4AP4A 3O7AA 3DQVR 5FEYA 5TABA 1JOCA 3LRQA 2E6RA 2LGKA 4GNFA 1Z6UA 2YHNA 2Y43A 2YYRA 3SOWA 3U5NA 5J3XA 1WEPA 3O35A 1MM2A 3RPGB 3PURA 4L7XA 2I50A 4YBSA 4UI9B 2H0DB 5TRBA 1WFKA 3N9PA 2Y1NA 2YSJA 1BORA 4BHWA 2K17A 2L0BA 2LN0A 5D1LB 2IDAA 4A0CD 3C5KA 2YW8A 2G43A 4N3WA 4FJCA 2KR4A 4V3LC 2KGGA 3ZVYA 3O36A 4ZUXU 2JMJA 4QF2A 4MSXA 2ECGA 2YT5A 2ECIA 2NAAA 2KYUA 4QF3A 5TBNA 3L11A 2F42A 2E6SA 2KWKA 2F6NA 2VJFA 1JM7A 1CHCA 1WEMA 4CA1A 5DINA 4YATA 3DPLR 2VPDA 4A49A 2FUUA 2VPEA 2CSZA 3NG2A 2ECTA 4IC2A 2M3HA 5TDWA 2KU3A 2K1JA 4WA6A 5LKZA 1G25A 5KH3A 3M63A 3ZVZB 3U5OA 5G04B 1WEUA 1WGMA 4YABA 2CKLA 3N9NA 3M62A 3EB5A 3RPGC 2YUCA 1RMDA 5AIUA 1N87A 4PPEA 1JM7B 2KGIA 2JRJA 1ZBDB 2KWJA 3T6RA 2CT2A 3LQIA 2M85A 2MNZA 2XEUA 2MD8C 2HYED 1IYMA 4LADB 1WEVA 4R7EA 4S3OB 5B79A 2PUYA 3QZVA 2QJ0A 3L1XA 2MD7B 1FBVA 5B77A 2G6QA 4TKPB 4C9ZA 3O37A 2CKLB 2K4DA 2VNFA 3N9LA 2M1RA 4IC3A 3SOXA 3MHSA 2MA5A 4YAXA 1F62A 1DVPA 5KH7A 2XB1A 4AVXA 4AUQB 3KV5A 1WIMA 2MNYA 2RSDA 3M99A 2YQLA 5B76A 1FP0A 5C11A 3U5PA 4GNEA 2FUIA 5B75A 1K2FA 4AYCA 1WEEA 4BBQA 3N9QA 4N4FA 2DX8A 4XI1A 1WEOA 1LDKC 4I7BA 3LQJA 2L80A 1VFYA 3HCTA 1HYJA 3C6WA 3HCUA 3SOUA 2EODA 5FB1A 4FK5A 3RTRB 4X3GA 3PUQA 1T1HA 3ZTGA 1WESA 2MA6A 2KIZA 1WEWA 2LQ6A 4ZQLA 4NN2A 5LKTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4S3O C;  2UZG A;  4L58 A;  4I7C A;  5D1M B;  4P5O B;  4AYC B;  3KNV A;  5DKA A;  4R8P K;  2JMI A;  2KRE A;  4MVT A;  3LQH A;  2G45 A;  2VJF B;  4GNG A;  2L75 A;  1E4U A;  3ASL A;  1V87 A;  4O64 A;  1U6G B;  2CSY A;  4B86 C;  2C2L A;  3L1Z B;  4FIP A;  2VP7 A;  2LGV A;  3I2D A;  1LDJ B;  2VPB A;  5H1T A;  4LK9 A;  1X4I A;  5H1U A;  2ECJ A;  2D8S A;  3N9O A;  3HCS A;  4YBM A;  2Y1M A;  3HTK C;  3VK6 A;  4B7Y C;  3U5M A;  2MUM A;  2YHO A;  2YRE A;  4LKA A;  2L43 A;  5LKX A;  3ZNI A;  4GB0 A;  2BAY A;  2EA6 A;  2KWN A;  4WZ2 A;  1VYX A;  4Q6F A;  5KH9 A;  2KE1 A;  1WEQ A;  4A4B A;  3KV6 A;  5B8D A;  3GL6 A;  4FO9 A;  2ECN A;  2LV9 A;  2M6M A;  2AN6 A;  2F6J A;  4UP5 A;  3O33 A;  2YU4 A;  4V3K C;  2VJE A;  2ZET C;  2KWO A;  4A4C A;  2QIC A;  5JG6 A;  3KQI A;  5G05 B;  5C13 A;  5FB0 A;  3MHH A;  1Z60 A;  3N9M A;  3O34 A;  2YQM A;  2LXP C;  3SHB A;  4ZDT A;  2MIQ A;  1HYI A;  5EYA F;  2LRI C;  5LCW B;  4LLB A;  1VD4 A;  2HDP A;  2PNX A;  5G0F A;  4WZ3 B;  2L5U A;  1WEN A;  2LGG A;  5B78 A;  2ECW A;  2LDR A;  4W4U A;  5TDR A;  2VJE B;  1XWH A;  1MM3 A;  5H1V A;  3EB6 A;  1X4J A;  3ZYQ A;  2MT5 A;  5H9M A;  3IHP A;  2FSA A;  4I7D A;  3ZPV 1;  4PTB A;  3PHD A;  2KFT A;  1Z2Q A;  2K16 A;  4CCG X;  5LKU A;  4LJN A;  4WZ0 A;  2VPG A;  3V43 A;  5FER A;  1X4U A;  2EGP A;  2LXH C;  3GV4 A;  5AIT A;  2QIZ A;  2YSM A;  2H0D A;  2C2V S;  2JMD A;  4R2Y A;  1WIL A;  2ECV A;  5I3L A;  3ZPV E;  5D1K B;  2RI7 A;  2LGL A;  2OXQ C;  4YAD A;  4YBT A;  1WE9 A;  4GND A;  4UP0 A;  3FL2 A;  3T7L A;  4YC9 A;  2YUR A;  4F52 B;  3O70 A;  4AP4 A;  3O7A A;  3DQV R;  5FEY A;  5TAB A;  1JOC A;  3LRQ A;  2E6R A;  2LGK A;  4GNF A;  1Z6U A;  2YHN A;  2Y43 A;  2YYR A;  3SOW A;  3U5N A;  5J3X A;  1WEP A;  3O35 A;  1MM2 A;  3RPG B;  3PUR A;  4L7X A;  2I50 A;  4YBS A;  4UI9 B;  2H0D B;  5TRB A;  1WFK A;  3N9P A;  2Y1N A;  2YSJ A;  1BOR A;  4BHW A;  2K17 A;  2L0B A;  2LN0 A;  5D1L B;  2IDA A;  4A0C D;  3C5K A;  2YW8 A;  2G43 A;  4N3W A;  4FJC A;  2KR4 A;  4V3L C;  2KGG A;  3ZVY A;  3O36 A;  4ZUX U;  2JMJ A;  4QF2 A;  4MSX A;  2ECG A;  2YT5 A;  2ECI A;  2NAA A;  2KYU A;  4QF3 A;  5TBN A;  3L11 A;  2F42 A;  2E6S A;  2KWK A;  2F6N A;  2VJF A;  1JM7 A;  1CHC A;  1WEM A;  4CA1 A;  5DIN A;  4YAT A;  3DPL R;  2VPD A;  4A49 A;  2FUU A;  2VPE A;  2CSZ A;  3NG2 A;  2ECT A;  4IC2 A;  2M3H A;  5TDW A;  2KU3 A;  2K1J A;  4WA6 A;  5LKZ A;  1G25 A;  5KH3 A;  3M63 A;  3ZVZ B;  3U5O A;  5G04 B;  1WEU A;  1WGM A;  4YAB A;  2CKL A;  3N9N A;  3M62 A;  3EB5 A;  3RPG C;  2YUC A;  1RMD A;  5AIU A;  1N87 A;  4PPE A;  1JM7 B;  2KGI A;  2JRJ A;  1ZBD B;  2KWJ A;  3T6R A;  2CT2 A;  3LQI A;  2M85 A;  2MNZ A;  2XEU A;  2MD8 C;  2HYE D;  1IYM A;  4LAD B;  1WEV A;  4R7E A;  4S3O B;  5B79 A;  2PUY A;  3QZV A;  2QJ0 A;  3L1X A;  2MD7 B;  1FBV A;  5B77 A;  2G6Q A;  4TKP B;  4C9Z A;  3O37 A;  2CKL B;  2K4D A;  2VNF A;  3N9L A;  2M1R A;  4IC3 A;  3SOX A;  3MHS A;  2MA5 A;  4YAX A;  1F62 A;  1DVP A;  5KH7 A;  2XB1 A;  4AVX A;  4AUQ B;  3KV5 A;  1WIM A;  2MNY A;  2RSD A;  3M99 A;  2YQL A;  5B76 A;  1FP0 A;  5C11 A;  3U5P A;  4GNE A;  2FUI A;  5B75 A;  1K2F A;  4AYC A;  1WEE A;  4BBQ A;  3N9Q A;  4N4F A;  2DX8 A;  4XI1 A;  1WEO A;  1LDK C;  4I7B A;  3LQJ A;  2L80 A;  1VFY A;  3HCT A;  1HYJ A;  3C6W A;  3HCU A;  3SOU A;  2EOD A;  5FB1 A;  4FK5 A;  3RTR B;  4X3G A;  3PUQ A;  1T1H A;  3ZTG A;  1WES A;  2MA6 A;  2KIZ A;  1WEW A;  2LQ6 A;  4ZQL A;  4NN2 A;  5LKT A; 
#chains in the Genus database with same CATH topology
 4S3O C;  2UZG A;  4L58 A;  4I7C A;  4QQ4 A;  5D1M B;  4P5O B;  4AYC B;  3KNV A;  5DKA A;  3E2D A;  3DWD A;  4R8P K;  2JMI A;  2KRE A;  4MVT A;  3LQH A;  2G45 A;  3PLW A;  2VJF B;  4GNG A;  2L75 A;  1E4U A;  3ASL A;  1V87 A;  4O64 A;  1U6G B;  2CSY A;  4B86 C;  2C2L A;  3L1Z B;  4FIP A;  2VP7 A;  2CRR A;  2LGV A;  3I2D A;  1LDJ B;  2VPB A;  5H1T A;  4LK9 A;  1X4I A;  5H1U A;  2ECJ A;  2D8S A;  3N9O A;  3LVR E;  3HCS A;  4YBM A;  2Y1M A;  3HTK C;  3VK6 A;  4B7Y C;  2MKE A;  3U5M A;  2MUM A;  2YHO A;  2YRE A;  4LKA A;  2L43 A;  5LKX A;  3ZNI A;  4GB0 A;  2BAY A;  2EA6 A;  2KWN A;  4WZ2 A;  1VYX A;  4Q6F A;  5KH9 A;  2D8U A;  2KE1 A;  1WEQ A;  4A4B A;  3KV6 A;  2DSM A;  5B8D A;  3GL6 A;  4FO9 A;  2ECN A;  2LV9 A;  2M6M A;  2AN6 A;  2F6J A;  4UP5 A;  2FD4 A;  3O33 A;  2YU4 A;  4V3K C;  2VJE A;  2ZET C;  2KWO A;  4A4C A;  2QIC A;  5JG6 A;  4F1P A;  3KQI A;  5G05 B;  5C13 A;  5FB0 A;  3MHH A;  1Z60 A;  3JUE A;  3N9M A;  3MDB C;  3O34 A;  2YQM A;  2LXP C;  3SHB A;  4ZDT A;  2MIQ A;  1HYI A;  5EYA F;  2LRI C;  5LCW B;  4LLB A;  1VD4 A;  2CSV A;  2HDP A;  2PNX A;  5G0F A;  4WZ3 B;  2L5U A;  1WEN A;  2LGG A;  3H7H A;  5B78 A;  2ECW A;  2LDR A;  4W4U A;  5TDR A;  2RR4 A;  2VJE B;  1XWH A;  1MM3 A;  5H1V A;  3KDE C;  3EB6 A;  1X4J A;  3ZYQ A;  2MT5 A;  5H9M A;  3IHP A;  2FSA A;  3FEH A;  3FM8 C;  2YVR A;  4I7D A;  3ZPV 1;  4PTB A;  3PHD A;  2KFT A;  1Z2Q A;  2K16 A;  4CCG X;  5LKU A;  4LJN A;  4WZ0 A;  2VPG A;  3V43 A;  2LAU A;  1X4U A;  5FER A;  2EGP A;  2LXH C;  2B0O E;  3GV4 A;  5AIT A;  2QIZ A;  2YSM A;  2H0D A;  2C2V S;  2JMD A;  4R2Y A;  1WIL A;  4OGC A;  2ECV A;  5I3L A;  3FJU B;  3ZPV E;  5D1K B;  2RI7 A;  2LGL A;  2OXQ C;  4YAD A;  4YBT A;  1WE9 A;  4GND A;  4UP0 A;  3FL2 A;  3T7L A;  4YC9 A;  2YUR A;  4F52 B;  3O70 A;  2XOC A;  4AP4 A;  3O7A A;  3DQV R;  5SVX A;  5FEY A;  5TAB A;  1JOC A;  3LRQ A;  2E6R A;  2LGK A;  4GNF A;  1Z6U A;  2YHN A;  2Y43 A;  2YYR A;  3SOW A;  3U5N A;  3DDT A;  5J3X A;  1WEP A;  3O35 A;  1MM2 A;  3RPG B;  3PUR A;  4L7X A;  2I50 A;  4YBS A;  4UI9 B;  2H0D B;  5TRB A;  1WFK A;  3N9P A;  2M13 A;  2Y1N A;  2YSJ A;  1BOR A;  4BHW A;  2K17 A;  3Q1D A;  2L0B A;  2LN0 A;  5D1L B;  2IDA A;  4A0C D;  2JUN A;  3C5K A;  2EGM A;  2YW8 A;  2G43 A;  4N3W A;  2XP0 A;  4FJC A;  2DJA A;  2KR4 A;  4V3L C;  2KGG A;  3ZVY A;  3O36 A;  5SVI A;  4ZUX U;  2JMJ A;  4QF2 A;  4MSX A;  2ECG A;  2YT5 A;  2ECI A;  2NAA A;  2KYU A;  4QF3 A;  2CON A;  5TBN A;  3L11 A;  2F42 A;  2E6S A;  2KWK A;  3O47 A;  2F6N A;  2VJF A;  1JM7 A;  1CHC A;  1WEM A;  4CA1 A;  5DIN A;  4YAT A;  3DPL R;  4OGE A;  2VPD A;  4A49 A;  2FUU A;  2VPE A;  2CSZ A;  3NG2 A;  1DCQ A;  2ECT A;  4IC2 A;  2M3H A;  5TDW A;  2KU3 A;  2K1J A;  4WA6 A;  5LKZ A;  1G25 A;  5KH3 A;  3M63 A;  3ZVZ B;  3U5O A;  5G04 B;  5K3Q A;  1WEU A;  2EXU A;  1WGM A;  4YAB A;  5SVI B;  2CKL A;  3N9N A;  3M62 A;  3EB5 A;  3RPG C;  2P57 A;  2YUC A;  1RMD A;  5AIU A;  1N87 A;  4PPE A;  1JM7 B;  2E61 A;  2KGI A;  2JRJ A;  1ZBD B;  3LVQ E;  2KWJ A;  4Z0O A;  3T6R A;  2CT2 A;  3LQI A;  2M85 A;  2MNZ A;  5SVY A;  2XEU A;  2MD8 C;  2HYE D;  1IYM A;  4LAD B;  3T9K A;  1WEV A;  4R7E A;  4S3O B;  5B79 A;  2XOZ A;  2PUY A;  3QZV A;  2QJ0 A;  3L1X A;  2MD7 B;  3SUB A;  1FBV A;  5B77 A;  2G6Q A;  4TKP B;  4C9Z A;  4Z0R A;  3O37 A;  4O62 A;  2CKL B;  2K4D A;  2VNF A;  3N9L A;  2M1R A;  4IC3 A;  3SOX A;  3MHS A;  2MA5 A;  1MBM A;  2XOY A;  4YAX A;  1F62 A;  3LDY A;  1DVP A;  5KH7 A;  2XB1 A;  3LJU X;  4AVX A;  4AUQ B;  3KV5 A;  1WIM A;  2MNY A;  2RSD A;  3M99 A;  2YQL A;  5B76 A;  3FAN A;  1FP0 A;  5C11 A;  3U5P A;  4GNE A;  2KKY A;  2FUI A;  5B75 A;  2OWA A;  1K2F A;  4AYC A;  1WEE A;  4BBQ A;  3FAO A;  3N9Q A;  4N4F A;  2DX8 A;  4XI1 A;  1WEO A;  1LDK C;  4I7B A;  4H9D A;  3LQJ A;  2L80 A;  1VFY A;  3HCT A;  1HYJ A;  3C6W A;  2CRW A;  3HCU A;  3SOU A;  2EOD A;  5FB1 A;  4FK5 A;  3RTR B;  4X3G A;  2IQJ A;  3PUQ A;  2JM3 A;  2KKX A;  2L7P A;  1T1H A;  3ZTG A;  3M7K A;  1WES A;  2FFW A;  2MA6 A;  2KIZ A;  1WEW A;  2LQ6 A;  4ZQL A;  4NN2 A;  5LKT A; 
#chains in the Genus database with same CATH homology
 4S3O C;  2UZG A;  4L58 A;  4I7C A;  5D1M B;  4P5O B;  4AYC B;  3KNV A;  5DKA A;  4R8P K;  2JMI A;  2KRE A;  4MVT A;  3LQH A;  2G45 A;  2VJF B;  4GNG A;  2L75 A;  1E4U A;  3ASL A;  1V87 A;  4O64 A;  1U6G B;  2CSY A;  4B86 C;  2C2L A;  3L1Z B;  4FIP A;  2VP7 A;  2LGV A;  3I2D A;  1LDJ B;  2VPB A;  5H1T A;  4LK9 A;  1X4I A;  5H1U A;  2ECJ A;  2D8S A;  3N9O A;  3HCS A;  4YBM A;  2Y1M A;  3HTK C;  3VK6 A;  4B7Y C;  3U5M A;  2MUM A;  2YHO A;  2YRE A;  4LKA A;  2L43 A;  5LKX A;  3ZNI A;  4GB0 A;  2BAY A;  2EA6 A;  2KWN A;  4WZ2 A;  1VYX A;  4Q6F A;  5KH9 A;  2KE1 A;  1WEQ A;  4A4B A;  3KV6 A;  5B8D A;  3GL6 A;  4FO9 A;  2ECN A;  2LV9 A;  2M6M A;  2AN6 A;  2F6J A;  4UP5 A;  3O33 A;  2YU4 A;  4V3K C;  2VJE A;  2ZET C;  2KWO A;  4A4C A;  2QIC A;  5JG6 A;  3KQI A;  5G05 B;  5C13 A;  5FB0 A;  3MHH A;  1Z60 A;  3N9M A;  3O34 A;  2YQM A;  2LXP C;  3SHB A;  4ZDT A;  2MIQ A;  1HYI A;  5EYA F;  2LRI C;  5LCW B;  4LLB A;  1VD4 A;  2HDP A;  2PNX A;  5G0F A;  4WZ3 B;  2L5U A;  1WEN A;  2LGG A;  5B78 A;  2ECW A;  2LDR A;  4W4U A;  5TDR A;  2VJE B;  1XWH A;  1MM3 A;  5H1V A;  3EB6 A;  1X4J A;  3ZYQ A;  2MT5 A;  5H9M A;  3IHP A;  2FSA A;  4I7D A;  3ZPV 1;  4PTB A;  3PHD A;  2KFT A;  1Z2Q A;  2K16 A;  4CCG X;  5LKU A;  4LJN A;  4WZ0 A;  2VPG A;  3V43 A;  5FER A;  1X4U A;  2EGP A;  2LXH C;  3GV4 A;  5AIT A;  2QIZ A;  2YSM A;  2H0D A;  2C2V S;  2JMD A;  4R2Y A;  1WIL A;  2ECV A;  5I3L A;  3ZPV E;  5D1K B;  2RI7 A;  2LGL A;  2OXQ C;  4YAD A;  4YBT A;  1WE9 A;  4GND A;  4UP0 A;  3FL2 A;  3T7L A;  4YC9 A;  2YUR A;  4F52 B;  3O70 A;  4AP4 A;  3O7A A;  3DQV R;  5FEY A;  5TAB A;  1JOC A;  3LRQ A;  2E6R A;  2LGK A;  4GNF A;  1Z6U A;  2YHN A;  2Y43 A;  2YYR A;  3SOW A;  3U5N A;  5J3X A;  1WEP A;  3O35 A;  1MM2 A;  3RPG B;  3PUR A;  4L7X A;  2I50 A;  4YBS A;  4UI9 B;  2H0D B;  5TRB A;  1WFK A;  3N9P A;  2Y1N A;  2YSJ A;  1BOR A;  4BHW A;  2K17 A;  2L0B A;  2LN0 A;  5D1L B;  2IDA A;  4A0C D;  3C5K A;  2YW8 A;  2G43 A;  4N3W A;  4FJC A;  2KR4 A;  4V3L C;  2KGG A;  3ZVY A;  3O36 A;  4ZUX U;  2JMJ A;  4QF2 A;  4MSX A;  2ECG A;  2YT5 A;  2ECI A;  2NAA A;  2KYU A;  4QF3 A;  5TBN A;  3L11 A;  2F42 A;  2E6S A;  2KWK A;  2F6N A;  2VJF A;  1JM7 A;  1CHC A;  1WEM A;  4CA1 A;  5DIN A;  4YAT A;  3DPL R;  2VPD A;  4A49 A;  2FUU A;  2VPE A;  2CSZ A;  3NG2 A;  2ECT A;  4IC2 A;  2M3H A;  5TDW A;  2KU3 A;  2K1J A;  4WA6 A;  5LKZ A;  1G25 A;  5KH3 A;  3M63 A;  3ZVZ B;  3U5O A;  5G04 B;  1WEU A;  1WGM A;  4YAB A;  2CKL A;  3N9N A;  3M62 A;  3EB5 A;  3RPG C;  2YUC A;  1RMD A;  5AIU A;  1N87 A;  4PPE A;  1JM7 B;  2KGI A;  2JRJ A;  1ZBD B;  2KWJ A;  3T6R A;  2CT2 A;  3LQI A;  2M85 A;  2MNZ A;  2XEU A;  2MD8 C;  2HYE D;  1IYM A;  4LAD B;  1WEV A;  4R7E A;  4S3O B;  5B79 A;  2PUY A;  3QZV A;  2QJ0 A;  3L1X A;  2MD7 B;  1FBV A;  5B77 A;  2G6Q A;  4TKP B;  4C9Z A;  3O37 A;  2CKL B;  2K4D A;  2VNF A;  3N9L A;  2M1R A;  4IC3 A;  3SOX A;  3MHS A;  2MA5 A;  4YAX A;  1F62 A;  1DVP A;  5KH7 A;  2XB1 A;  4AVX A;  4AUQ B;  3KV5 A;  1WIM A;  2MNY A;  2RSD A;  3M99 A;  2YQL A;  5B76 A;  1FP0 A;  5C11 A;  3U5P A;  4GNE A;  2FUI A;  5B75 A;  1K2F A;  4AYC A;  1WEE A;  4BBQ A;  3N9Q A;  4N4F A;  2DX8 A;  4XI1 A;  1WEO A;  1LDK C;  4I7B A;  3LQJ A;  2L80 A;  1VFY A;  3HCT A;  1HYJ A;  3C6W A;  3HCU A;  3SOU A;  2EOD A;  5FB1 A;  4FK5 A;  3RTR B;  4X3G A;  3PUQ A;  1T1H A;  3ZTG A;  1WES A;  2MA6 A;  2KIZ A;  1WEW A;  2LQ6 A;  4ZQL A;  4NN2 A;  5LKT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...