1LDJB

Structure of the cul1-rbx1-skp1-f boxskp2 scf ubiquitin ligase complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
88
structure length
88
Chain Sequence
b'KKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cullin homolog 1
publication title Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF ubiquitin ligase complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 14
structure length 88
sequence length 88
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2002-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12678 zf-rbx1 RING-H2 zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1ldjB00
2YREA 2ZETC 5LKTA 3O34A 5EYAF 4ZUXU 2LGKA 2Y1NA 5TDWA 4ZQLA 2VPGA 3ZVYA 5G05B 2VPDA 3EB5A 4R2YA 3LQHA 2VP7A 2C2VS 5C11A 1K2FA 2FUIA 4C9ZA 3M63A 2KR4A 1IYMA 5TDRA 5DKAA 4F52B 3FL2A 2KE1A 4CCGX 2ECJA 4V3LC 3HTKC 4TKPB 3PURA 3ZPVE 2D8SA 1WEUA 3SOXA 4A4BA 4WZ0A 2MNZA 2PNXA 2EA6A 2VPBA 2FUUA 4BBQA 4FO9A 2HYED 4MSXA 1WEVA 2L80A 2ECVA 1X4UA 1VFYA 2XB1A 3U5NA 4UI9B 1WFKA 1WEPA 4IC3A 4Q6FA 3U5OA 2JMJA 2K1JA 4A4CA 2K16A 2LN0A 1FBVA 2MA6A 5KH7A 4N4FA 3LQIA 1VYXA 1WEOA 1WENA 3N9QA 4FK5A 5B78A 3KNVA 3L11A 2VPEA 3LRQA 3GV4A 2PUYA 2YW8A 2RI7A 3O36A 2CKLA 3KV5A 3L1ZB 2YT5A 3KV6A 2K4DA 3N9PA 1Z2QA 4AYCB 5J3XA 5LKUA 5JG6A 1MM3A 3HCSA 2AN6A 4WZ2A 3MHHA 3N9LA 4YAXA 2H0DA 4P5OB 2KIZA 3U5PA 2CT2A 3VK6A 4FJCA 3N9NA 5I3LA 4QF2A 3ZTGA 1T1HA 1JM7A 3DPLR 2VJEA 1LDKC 1X4JA 2LV9A 1N87A 4LADB 2HDPA 2UZGA 1ZBDB 1WIMA 4YC9A 5AIUA 4GB0A 2LXPC 2BAYA 2EODA 2VNFA 4IC2A 4PTBA 5B76A 3T6RA 4LKAA 3O70A 3C6WA 2KWNA 3N9OA 2KWJA 4YBMA 4NN2A 2G6QA 2LQ6A 3SHBA 3M99A 4N3WA 4UP5A 3RPGB 2VJFA 2IDAA 2L0BA 1MM2A 4A0CD 2LGVA 2QICA 1CHCA 2CSZA 2YSJA 1Z60A 2ECNA 2RSDA 1WEMA 1RMDA 4X3GA 5DINA 4LLBA 1FP0A 2ECIA 5LCWB 2MNYA 3IHPA 2G43A 4L58A 4PPEA 4YABA 5H1TA 4AUQB 4I7BA 1BORA 2JMIA 3KQIA 5KH9A 2DX8A 2EGPA 1X4IA 2YYRA 5B75A 1WGMA 2MD8C 3HCUA 2LXHC 4LJNA 4I7CA 4GNFA 3O35A 2QIZA 2KWOA 4L7XA 2YQMA 4WA6A 2MT5A 3U5MA 5B77A 2F42A 4O64A 2E6RA 3C5KA 4CA1A 4GNDA 4R7EA 2LDRA 5LKXA 1WEEA 1HYIA 2MUMA 1WESA 2KWKA 1U6GB 5H1UA 3PHDA 1WEWA 2JRJA 3RPGC 1WE9A 1HYJA 3NG2A 2VJFB 3O7AA 3L1XA 5H1VA 2OXQC 4S3OC 5G04B 3O33A 2L5UA 2F6NA 4QF3A 4AVXA 2M3HA 4GNGA 2ECGA 3T7LA 2NAAA 2YQLA 3HCTA 1E4UA 4YADA 3EB6A 4GNEA 1XWHA 4AYCA 4YATA 2I50A 2MD7B 2LGGA 2XEUA 3QZVA 5FERA 5B79A 1F62A 4LK9A 2KYUA 5KH3A 2CKLB 2MIQA 4YBSA 5D1LB 5FB1A 4YBTA 3ZNIA 5H9MA 1DVPA 4S3OB 3SOWA 4XI1A 1VD4A 2ECWA 2M6MA 3M62A 2L75A 1JOCA 2FSAA 2YSMA 2MA5A 2YURA 2Y43A 5D1MB 2KREA 2H0DB 2KU3A 4I7DA 3I2DA 3ZVZB 4B86C 2G45A 2JMDA 4A49A 1WILA 4V3KC 1G25A 1Z6UA 3ASLA 1WEQA 2YHNA 4ZDTA 3ZYQA 2YUCA 1LDJB 3PUQA 5TRBA 1JM7B 3ZPV1 2VJEB 3V43A 2M85A 4W4UA 2M1RA 3DQVR 3MHSA 4B7YC 5G0FA 2KGIA 2YHOA 2F6JA 2L43A 2LRIC 2Y1MA 5LKZA 5D1KB 5TABA 3RTRB 3LQJA 5TBNA 4UP0A 3GL6A 2LGLA 5B8DA 2C2LA 2QJ0A 3O37A 5AITA 1V87A 3SOUA 2E6SA 4MVTA 4BHWA 2ECTA 5FEYA 4WZ3B 2KGGA 2K17A 2KFTA 4AP4A 5FB0A 4R8PK 5C13A 2CSYA 4FIPA 2YU4A 3N9MA
chains in the Genus database with same CATH superfamily
2YREA 2ZETC 5LKTA 3O34A 2D8UA 5EYAF 4ZUXU 2LGKA 2Y1NA 5TDWA 4ZQLA 2VPGA 3ZVYA 5G05B 4OGCA 2VPDA 3EB5A 3H7HA 4R2YA 3LQHA 3M7KA 2VP7A 2C2VS 2KKYA 5C11A 1K2FA 2FUIA 4C9ZA 3M63A 2KR4A 1IYMA 5TDRA 5DKAA 4F52B 3FL2A 2KE1A 4CCGX 2ECJA 4V3LC 4O62A 3HTKC 4TKPB 3PURA 3ZPVE 2D8SA 1WEUA 3SOXA 4A4BA 4WZ0A 3T9KA 2MNZA 2PNXA 2EA6A 2VPBA 2FUUA 4BBQA 4FO9A 2HYED 4MSXA 1WEVA 4F1PA 2L80A 2ECVA 1X4UA 1VFYA 2XB1A 3U5NA 4UI9B 1WFKA 1WEPA 4IC3A 4Q6FA 3U5OA 2JMJA 2K1JA 4A4CA 2L7PA 2K16A 2LN0A 3LDYA 1FBVA 2MA6A 5KH7A 4N4FA 3LQIA 1VYXA 1WEOA 1WENA 3N9QA 4FK5A 2XOZA 5B78A 2EXUA 2P57A 3KNVA 3L11A 2VPEA 3LRQA 3GV4A 3E2DA 2PUYA 2YW8A 2RI7A 3O36A 2CKLA 3KV5A 3L1ZB 2YT5A 3KV6A 2K4DA 3N9PA 2DJAA 1Z2QA 2CRWA 4AYCB 3SUBA 5J3XA 5LKUA 5JG6A 1MM3A 3HCSA 2AN6A 4WZ2A 3LVRE 3MHHA 3N9LA 4YAXA 5SVYA 2H0DA 4P5OB 2KIZA 3U5PA 2CT2A 3VK6A 4FJCA 3N9NA 5I3LA 4QF2A 3ZTGA 1T1HA 1JM7A 3DPLR 2OWAA 2VJEA 1LDKC 3FM8C 1X4JA 2LV9A 1N87A 4LADB 2HDPA 2UZGA 2MKEA 1ZBDB 1WIMA 4YC9A 3LVQE 5AIUA 4GB0A 2LXPC 2BAYA 2EODA 2VNFA 4IC2A 4PTBA 5B76A 3T6RA 4LKAA 3O70A 3C6WA 2KWNA 3N9OA 2KWJA 4YBMA 4NN2A 2G6QA 2LQ6A 3SHBA 3M99A 4N3WA 4UP5A 3RPGB 2VJFA 2CSVA 2IDAA 2L0BA 1MM2A 4A0CD 2LGVA 2QICA 1CHCA 2CSZA 2YSJA 2XP0A 1Z60A 2ECNA 2RSDA 1WEMA 1RMDA 4X3GA 5DINA 4LLBA 1FP0A 2ECIA 5LCWB 2MNYA 3IHPA 2G43A 4L58A 4PPEA 3LJUX 5SVIA 4YABA 5H1TA 3JUEA 2B0OE 4AUQB 4I7BA 1BORA 2JMIA 3KQIA 5KH9A 2DX8A 3O47A 2EGPA 1X4IA 2YYRA 5B75A 1WGMA 2MD8C 3HCUA 2LXHC 4LJNA 4I7CA 3PLWA 4GNFA 3O35A 2QIZA 2KWOA 4L7XA 2YQMA 2XOYA 4WA6A 2MT5A 3U5MA 5B77A 2F42A 4H9DA 4O64A 2JUNA 2E6RA 3C5KA 4OGEA 4CA1A 4GNDA 4R7EA 4Z0OA 2LDRA 5K3QA 5LKXA 1WEEA 1HYIA 2MUMA 1WESA 2KWKA 1U6GB 5H1UA 3PHDA 1WEWA 2JRJA 3RPGC 1WE9A 3DDTA 3NG2A 2VJFB 2YVRA 1HYJA 3O7AA 3L1XA 5H1VA 2XOCA 2OXQC 4S3OC 5G04B 3O33A 2L5UA 3FJUB 2F6NA 4QF3A 2CRRA 4AVXA 2M3HA 4GNGA 2ECGA 3T7LA 2NAAA 2CONA 2YQLA 3HCTA 3KDEC 1E4UA 4YADA 3EB6A 4GNEA 1XWHA 5SVIB 4AYCA 2I50A 2XEUA 2MD7B 2LGGA 4YATA 3QZVA 5FERA 5B79A 1F62A 4LK9A 2KYUA 3FANA 5KH3A 2CKLB 1DCQA 2MIQA 4YBSA 5D1LB 5FB1A 4YBTA 3ZNIA 5H9MA 1DVPA 4S3OB 3SOWA 4XI1A 1VD4A 2ECWA 2M6MA 3M62A 2L75A 1JOCA 1MBMA 2FSAA 2DSMA 2KKXA 2YSMA 2MA5A 2YURA 5SVXA 2Y43A 5D1MB 2KREA 2H0DB 2IQJA 2KU3A 4I7DA 3I2DA 4Z0RA 3ZVZB 4B86C 2G45A 2JMDA 4A49A 1WILA 4V3KC 1G25A 1Z6UA 3DWDA 3ASLA 1WEQA 2YHNA 4ZDTA 3ZYQA 2YUCA 1LDJB 3PUQA 5TRBA 3FAOA 1JM7B 3ZPV1 2FD4A 2VJEB 3V43A 2M85A 4W4UA 2M13A 2M1RA 2E61A 3DQVR 3MHSA 4B7YC 5G0FA 2KGIA 2YHOA 2RR4A 2F6JA 2L43A 2LRIC 2FFWA 2Y1MA 5D1KB 5LKZA 5TABA 3RTRB 3LQJA 5TBNA 4UP0A 3GL6A 2LGLA 5B8DA 3FEHA 2LAUA 2C2LA 2QJ0A 3O37A 5AITA 1V87A 3Q1DA 3SOUA 2E6SA 4MVTA 4BHWA 2ECTA 2EGMA 4QQ4A 2JM3A 5FEYA 4WZ3B 3MDBC 2KGGA 2K17A 2KFTA 4AP4A 5FB0A 4R8PK 5C13A 2CSYA 4FIPA 2YU4A 3N9MA
chains in the Genus database with same CATH topology
2YREA 2ZETC 5LKTA 3O34A 5EYAF 4ZUXU 2LGKA 2Y1NA 5TDWA 4ZQLA 2VPGA 3ZVYA 5G05B 2VPDA 3EB5A 4R2YA 3LQHA 2VP7A 2C2VS 5C11A 1K2FA 2FUIA 4C9ZA 3M63A 2KR4A 1IYMA 5TDRA 5DKAA 4F52B 3FL2A 2KE1A 4CCGX 2ECJA 4V3LC 3HTKC 4TKPB 3PURA 3ZPVE 2D8SA 1WEUA 3SOXA 4A4BA 4WZ0A 2MNZA 2PNXA 2EA6A 2VPBA 2FUUA 4BBQA 4FO9A 2HYED 4MSXA 1WEVA 2L80A 2ECVA 1X4UA 1VFYA 2XB1A 3U5NA 4UI9B 1WFKA 1WEPA 4IC3A 4Q6FA 3U5OA 2JMJA 2K1JA 4A4CA 2K16A 2LN0A 1FBVA 2MA6A 5KH7A 4N4FA 3LQIA 1VYXA 1WEOA 1WENA 3N9QA 4FK5A 5B78A 3KNVA 3L11A 2VPEA 3LRQA 3GV4A 2PUYA 2YW8A 2RI7A 3O36A 2CKLA 3KV5A 3L1ZB 2YT5A 3KV6A 2K4DA 3N9PA 1Z2QA 4AYCB 5J3XA 5LKUA 5JG6A 1MM3A 3HCSA 2AN6A 4WZ2A 3MHHA 3N9LA 4YAXA 2H0DA 4P5OB 2KIZA 3U5PA 2CT2A 3VK6A 4FJCA 3N9NA 5I3LA 4QF2A 3ZTGA 1T1HA 1JM7A 3DPLR 2VJEA 1LDKC 1X4JA 2LV9A 1N87A 4LADB 2HDPA 2UZGA 1ZBDB 1WIMA 4YC9A 5AIUA 4GB0A 2LXPC 2BAYA 2EODA 2VNFA 4IC2A 4PTBA 5B76A 3T6RA 4LKAA 3O70A 3C6WA 2KWNA 3N9OA 2KWJA 4YBMA 4NN2A 2G6QA 2LQ6A 3SHBA 3M99A 4N3WA 4UP5A 3RPGB 2VJFA 2IDAA 2L0BA 1MM2A 4A0CD 2LGVA 2QICA 1CHCA 2CSZA 2YSJA 1Z60A 2ECNA 2RSDA 1WEMA 1RMDA 4X3GA 5DINA 4LLBA 1FP0A 2ECIA 5LCWB 2MNYA 3IHPA 2G43A 4L58A 4PPEA 4YABA 5H1TA 4AUQB 4I7BA 1BORA 2JMIA 3KQIA 5KH9A 2DX8A 2EGPA 1X4IA 2YYRA 5B75A 1WGMA 2MD8C 3HCUA 2LXHC 4LJNA 4I7CA 4GNFA 3O35A 2QIZA 2KWOA 4L7XA 2YQMA 4WA6A 2MT5A 3U5MA 5B77A 2F42A 4O64A 2E6RA 3C5KA 4CA1A 4GNDA 4R7EA 2LDRA 5LKXA 1WEEA 1HYIA 2MUMA 1WESA 2KWKA 1U6GB 5H1UA 3PHDA 1WEWA 2JRJA 3RPGC 1WE9A 1HYJA 3NG2A 2VJFB 3O7AA 3L1XA 5H1VA 2OXQC 4S3OC 5G04B 3O33A 2L5UA 2F6NA 4QF3A 4AVXA 2M3HA 4GNGA 2ECGA 3T7LA 2NAAA 2YQLA 3HCTA 1E4UA 4YADA 3EB6A 4GNEA 1XWHA 4AYCA 4YATA 2I50A 2MD7B 2LGGA 2XEUA 3QZVA 5FERA 5B79A 1F62A 4LK9A 2KYUA 5KH3A 2CKLB 2MIQA 4YBSA 5D1LB 5FB1A 4YBTA 3ZNIA 5H9MA 1DVPA 4S3OB 3SOWA 4XI1A 1VD4A 2ECWA 2M6MA 3M62A 2L75A 1JOCA 2FSAA 2YSMA 2MA5A 2YURA 2Y43A 5D1MB 2KREA 2H0DB 2KU3A 4I7DA 3I2DA 3ZVZB 4B86C 2G45A 2JMDA 4A49A 1WILA 4V3KC 1G25A 1Z6UA 3ASLA 1WEQA 2YHNA 4ZDTA 3ZYQA 2YUCA 1LDJB 3PUQA 5TRBA 1JM7B 3ZPV1 2VJEB 3V43A 2M85A 4W4UA 2M1RA 3DQVR 3MHSA 4B7YC 5G0FA 2KGIA 2YHOA 2F6JA 2L43A 2LRIC 2Y1MA 5LKZA 5D1KB 5TABA 3RTRB 3LQJA 5TBNA 4UP0A 3GL6A 2LGLA 5B8DA 2C2LA 2QJ0A 3O37A 5AITA 1V87A 3SOUA 2E6SA 4MVTA 4BHWA 2ECTA 5FEYA 4WZ3B 2KGGA 2K17A 2KFTA 4AP4A 5FB0A 4R8PK 5C13A 2CSYA 4FIPA 2YU4A 3N9MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YRE A;  2ZET C;  5LKT A;  3O34 A;  5EYA F;  4ZUX U;  2LGK A;  2Y1N A;  5TDW A;  4ZQL A;  2VPG A;  3ZVY A;  5G05 B;  2VPD A;  3EB5 A;  4R2Y A;  3LQH A;  2VP7 A;  2C2V S;  5C11 A;  1K2F A;  2FUI A;  4C9Z A;  3M63 A;  2KR4 A;  1IYM A;  5TDR A;  5DKA A;  4F52 B;  3FL2 A;  2KE1 A;  4CCG X;  2ECJ A;  4V3L C;  3HTK C;  4TKP B;  3PUR A;  3ZPV E;  2D8S A;  1WEU A;  3SOX A;  4A4B A;  4WZ0 A;  2MNZ A;  2PNX A;  2EA6 A;  2VPB A;  2FUU A;  4BBQ A;  4FO9 A;  2HYE D;  4MSX A;  1WEV A;  2L80 A;  2ECV A;  1X4U A;  1VFY A;  2XB1 A;  3U5N A;  4UI9 B;  1WFK A;  1WEP A;  4IC3 A;  4Q6F A;  3U5O A;  2JMJ A;  2K1J A;  4A4C A;  2K16 A;  2LN0 A;  1FBV A;  2MA6 A;  5KH7 A;  4N4F A;  3LQI A;  1VYX A;  1WEO A;  1WEN A;  3N9Q A;  4FK5 A;  5B78 A;  3KNV A;  3L11 A;  2VPE A;  3LRQ A;  3GV4 A;  2PUY A;  2YW8 A;  2RI7 A;  3O36 A;  2CKL A;  3KV5 A;  3L1Z B;  2YT5 A;  3KV6 A;  2K4D A;  3N9P A;  1Z2Q A;  4AYC B;  5J3X A;  5LKU A;  5JG6 A;  1MM3 A;  3HCS A;  2AN6 A;  4WZ2 A;  3MHH A;  3N9L A;  4YAX A;  2H0D A;  4P5O B;  2KIZ A;  3U5P A;  2CT2 A;  3VK6 A;  4FJC A;  3N9N A;  5I3L A;  4QF2 A;  3ZTG A;  1T1H A;  1JM7 A;  3DPL R;  2VJE A;  1LDK C;  1X4J A;  2LV9 A;  1N87 A;  4LAD B;  2HDP A;  2UZG A;  1ZBD B;  1WIM A;  4YC9 A;  5AIU A;  4GB0 A;  2LXP C;  2BAY A;  2EOD A;  2VNF A;  4IC2 A;  4PTB A;  5B76 A;  3T6R A;  4LKA A;  3O70 A;  3C6W A;  2KWN A;  3N9O A;  2KWJ A;  4YBM A;  4NN2 A;  2G6Q A;  2LQ6 A;  3SHB A;  3M99 A;  4N3W A;  4UP5 A;  3RPG B;  2VJF A;  2IDA A;  2L0B A;  1MM2 A;  4A0C D;  2LGV A;  2QIC A;  1CHC A;  2CSZ A;  2YSJ A;  1Z60 A;  2ECN A;  2RSD A;  1WEM A;  1RMD A;  4X3G A;  5DIN A;  4LLB A;  1FP0 A;  2ECI A;  5LCW B;  2MNY A;  3IHP A;  2G43 A;  4L58 A;  4PPE A;  4YAB A;  5H1T A;  4AUQ B;  4I7B A;  1BOR A;  2JMI A;  3KQI A;  5KH9 A;  2DX8 A;  2EGP A;  1X4I A;  2YYR A;  5B75 A;  1WGM A;  2MD8 C;  3HCU A;  2LXH C;  4LJN A;  4I7C A;  4GNF A;  3O35 A;  2QIZ A;  2KWO A;  4L7X A;  2YQM A;  4WA6 A;  2MT5 A;  3U5M A;  5B77 A;  2F42 A;  4O64 A;  2E6R A;  3C5K A;  4CA1 A;  4GND A;  4R7E A;  2LDR A;  5LKX A;  1WEE A;  1HYI A;  2MUM A;  1WES A;  2KWK A;  1U6G B;  5H1U A;  3PHD A;  1WEW A;  2JRJ A;  3RPG C;  1WE9 A;  1HYJ A;  3NG2 A;  2VJF B;  3O7A A;  3L1X A;  5H1V A;  2OXQ C;  4S3O C;  5G04 B;  3O33 A;  2L5U A;  2F6N A;  4QF3 A;  4AVX A;  2M3H A;  4GNG A;  2ECG A;  3T7L A;  2NAA A;  2YQL A;  3HCT A;  1E4U A;  4YAD A;  3EB6 A;  4GNE A;  1XWH A;  4AYC A;  4YAT A;  2I50 A;  2MD7 B;  2LGG A;  2XEU A;  3QZV A;  5FER A;  5B79 A;  1F62 A;  4LK9 A;  2KYU A;  5KH3 A;  2CKL B;  2MIQ A;  4YBS A;  5D1L B;  5FB1 A;  4YBT A;  3ZNI A;  5H9M A;  1DVP A;  4S3O B;  3SOW A;  4XI1 A;  1VD4 A;  2ECW A;  2M6M A;  3M62 A;  2L75 A;  1JOC A;  2FSA A;  2YSM A;  2MA5 A;  2YUR A;  2Y43 A;  5D1M B;  2KRE A;  2H0D B;  2KU3 A;  4I7D A;  3I2D A;  3ZVZ B;  4B86 C;  2G45 A;  2JMD A;  4A49 A;  1WIL A;  4V3K C;  1G25 A;  1Z6U A;  3ASL A;  1WEQ A;  2YHN A;  4ZDT A;  3ZYQ A;  2YUC A;  1LDJ B;  3PUQ A;  5TRB A;  1JM7 B;  3ZPV 1;  2VJE B;  3V43 A;  2M85 A;  4W4U A;  2M1R A;  3DQV R;  3MHS A;  4B7Y C;  5G0F A;  2KGI A;  2YHO A;  2F6J A;  2L43 A;  2LRI C;  2Y1M A;  5LKZ A;  5D1K B;  5TAB A;  3RTR B;  3LQJ A;  5TBN A;  4UP0 A;  3GL6 A;  2LGL A;  5B8D A;  2C2L A;  2QJ0 A;  3O37 A;  5AIT A;  1V87 A;  3SOU A;  2E6S A;  4MVT A;  4BHW A;  2ECT A;  5FEY A;  4WZ3 B;  2KGG A;  2K17 A;  2KFT A;  4AP4 A;  5FB0 A;  4R8P K;  5C13 A;  2CSY A;  4FIP A;  2YU4 A;  3N9M A; 
#chains in the Genus database with same CATH topology
 2YRE A;  2ZET C;  5LKT A;  3O34 A;  2D8U A;  5EYA F;  4ZUX U;  2LGK A;  2Y1N A;  5TDW A;  4ZQL A;  2VPG A;  3ZVY A;  5G05 B;  4OGC A;  2VPD A;  3EB5 A;  3H7H A;  4R2Y A;  3LQH A;  3M7K A;  2VP7 A;  2C2V S;  2KKY A;  5C11 A;  1K2F A;  2FUI A;  4C9Z A;  3M63 A;  2KR4 A;  1IYM A;  5TDR A;  5DKA A;  4F52 B;  3FL2 A;  2KE1 A;  4CCG X;  2ECJ A;  4V3L C;  4O62 A;  3HTK C;  4TKP B;  3PUR A;  3ZPV E;  2D8S A;  1WEU A;  3SOX A;  4A4B A;  4WZ0 A;  3T9K A;  2MNZ A;  2PNX A;  2EA6 A;  2VPB A;  2FUU A;  4BBQ A;  4FO9 A;  2HYE D;  4MSX A;  1WEV A;  4F1P A;  2L80 A;  2ECV A;  1X4U A;  1VFY A;  2XB1 A;  3U5N A;  4UI9 B;  1WFK A;  1WEP A;  4IC3 A;  4Q6F A;  3U5O A;  2JMJ A;  2K1J A;  4A4C A;  2L7P A;  2K16 A;  2LN0 A;  3LDY A;  1FBV A;  2MA6 A;  5KH7 A;  4N4F A;  3LQI A;  1VYX A;  1WEO A;  1WEN A;  3N9Q A;  4FK5 A;  2XOZ A;  5B78 A;  2EXU A;  2P57 A;  3KNV A;  3L11 A;  2VPE A;  3LRQ A;  3GV4 A;  3E2D A;  2PUY A;  2YW8 A;  2RI7 A;  3O36 A;  2CKL A;  3KV5 A;  3L1Z B;  2YT5 A;  3KV6 A;  2K4D A;  3N9P A;  2DJA A;  1Z2Q A;  2CRW A;  4AYC B;  3SUB A;  5J3X A;  5LKU A;  5JG6 A;  1MM3 A;  3HCS A;  2AN6 A;  4WZ2 A;  3LVR E;  3MHH A;  3N9L A;  4YAX A;  5SVY A;  2H0D A;  4P5O B;  2KIZ A;  3U5P A;  2CT2 A;  3VK6 A;  4FJC A;  3N9N A;  5I3L A;  4QF2 A;  3ZTG A;  1T1H A;  1JM7 A;  3DPL R;  2OWA A;  2VJE A;  1LDK C;  3FM8 C;  1X4J A;  2LV9 A;  1N87 A;  4LAD B;  2HDP A;  2UZG A;  2MKE A;  1ZBD B;  1WIM A;  4YC9 A;  3LVQ E;  5AIU A;  4GB0 A;  2LXP C;  2BAY A;  2EOD A;  2VNF A;  4IC2 A;  4PTB A;  5B76 A;  3T6R A;  4LKA A;  3O70 A;  3C6W A;  2KWN A;  3N9O A;  2KWJ A;  4YBM A;  4NN2 A;  2G6Q A;  2LQ6 A;  3SHB A;  3M99 A;  4N3W A;  4UP5 A;  3RPG B;  2VJF A;  2CSV A;  2IDA A;  2L0B A;  1MM2 A;  4A0C D;  2LGV A;  2QIC A;  1CHC A;  2CSZ A;  2YSJ A;  2XP0 A;  1Z60 A;  2ECN A;  2RSD A;  1WEM A;  1RMD A;  4X3G A;  5DIN A;  4LLB A;  1FP0 A;  2ECI A;  5LCW B;  2MNY A;  3IHP A;  2G43 A;  4L58 A;  4PPE A;  3LJU X;  5SVI A;  4YAB A;  5H1T A;  3JUE A;  2B0O E;  4AUQ B;  4I7B A;  1BOR A;  2JMI A;  3KQI A;  5KH9 A;  2DX8 A;  3O47 A;  2EGP A;  1X4I A;  2YYR A;  5B75 A;  1WGM A;  2MD8 C;  3HCU A;  2LXH C;  4LJN A;  4I7C A;  3PLW A;  4GNF A;  3O35 A;  2QIZ A;  2KWO A;  4L7X A;  2YQM A;  2XOY A;  4WA6 A;  2MT5 A;  3U5M A;  5B77 A;  2F42 A;  4H9D A;  4O64 A;  2JUN A;  2E6R A;  3C5K A;  4OGE A;  4CA1 A;  4GND A;  4R7E A;  4Z0O A;  2LDR A;  5K3Q A;  5LKX A;  1WEE A;  1HYI A;  2MUM A;  1WES A;  2KWK A;  1U6G B;  5H1U A;  3PHD A;  1WEW A;  2JRJ A;  3RPG C;  1WE9 A;  3DDT A;  3NG2 A;  2VJF B;  2YVR A;  1HYJ A;  3O7A A;  3L1X A;  5H1V A;  2XOC A;  2OXQ C;  4S3O C;  5G04 B;  3O33 A;  2L5U A;  3FJU B;  2F6N A;  4QF3 A;  2CRR A;  4AVX A;  2M3H A;  4GNG A;  2ECG A;  3T7L A;  2NAA A;  2CON A;  2YQL A;  3HCT A;  3KDE C;  1E4U A;  4YAD A;  3EB6 A;  4GNE A;  1XWH A;  5SVI B;  4AYC A;  2I50 A;  2XEU A;  2MD7 B;  2LGG A;  4YAT A;  3QZV A;  5FER A;  5B79 A;  1F62 A;  4LK9 A;  2KYU A;  3FAN A;  5KH3 A;  2CKL B;  1DCQ A;  2MIQ A;  4YBS A;  5D1L B;  5FB1 A;  4YBT A;  3ZNI A;  5H9M A;  1DVP A;  4S3O B;  3SOW A;  4XI1 A;  1VD4 A;  2ECW A;  2M6M A;  3M62 A;  2L75 A;  1JOC A;  1MBM A;  2FSA A;  2DSM A;  2KKX A;  2YSM A;  2MA5 A;  2YUR A;  5SVX A;  2Y43 A;  5D1M B;  2KRE A;  2H0D B;  2IQJ A;  2KU3 A;  4I7D A;  3I2D A;  4Z0R A;  3ZVZ B;  4B86 C;  2G45 A;  2JMD A;  4A49 A;  1WIL A;  4V3K C;  1G25 A;  1Z6U A;  3DWD A;  3ASL A;  1WEQ A;  2YHN A;  4ZDT A;  3ZYQ A;  2YUC A;  1LDJ B;  3PUQ A;  5TRB A;  3FAO A;  1JM7 B;  3ZPV 1;  2FD4 A;  2VJE B;  3V43 A;  2M85 A;  4W4U A;  2M13 A;  2M1R A;  2E61 A;  3DQV R;  3MHS A;  4B7Y C;  5G0F A;  2KGI A;  2YHO A;  2RR4 A;  2F6J A;  2L43 A;  2LRI C;  2FFW A;  2Y1M A;  5D1K B;  5LKZ A;  5TAB A;  3RTR B;  3LQJ A;  5TBN A;  4UP0 A;  3GL6 A;  2LGL A;  5B8D A;  3FEH A;  2LAU A;  2C2L A;  2QJ0 A;  3O37 A;  5AIT A;  1V87 A;  3Q1D A;  3SOU A;  2E6S A;  4MVT A;  4BHW A;  2ECT A;  2EGM A;  4QQ4 A;  2JM3 A;  5FEY A;  4WZ3 B;  3MDB C;  2KGG A;  2K17 A;  2KFT A;  4AP4 A;  5FB0 A;  4R8P K;  5C13 A;  2CSY A;  4FIP A;  2YU4 A;  3N9M A; 
#chains in the Genus database with same CATH homology
 2YRE A;  2ZET C;  5LKT A;  3O34 A;  5EYA F;  4ZUX U;  2LGK A;  2Y1N A;  5TDW A;  4ZQL A;  2VPG A;  3ZVY A;  5G05 B;  2VPD A;  3EB5 A;  4R2Y A;  3LQH A;  2VP7 A;  2C2V S;  5C11 A;  1K2F A;  2FUI A;  4C9Z A;  3M63 A;  2KR4 A;  1IYM A;  5TDR A;  5DKA A;  4F52 B;  3FL2 A;  2KE1 A;  4CCG X;  2ECJ A;  4V3L C;  3HTK C;  4TKP B;  3PUR A;  3ZPV E;  2D8S A;  1WEU A;  3SOX A;  4A4B A;  4WZ0 A;  2MNZ A;  2PNX A;  2EA6 A;  2VPB A;  2FUU A;  4BBQ A;  4FO9 A;  2HYE D;  4MSX A;  1WEV A;  2L80 A;  2ECV A;  1X4U A;  1VFY A;  2XB1 A;  3U5N A;  4UI9 B;  1WFK A;  1WEP A;  4IC3 A;  4Q6F A;  3U5O A;  2JMJ A;  2K1J A;  4A4C A;  2K16 A;  2LN0 A;  1FBV A;  2MA6 A;  5KH7 A;  4N4F A;  3LQI A;  1VYX A;  1WEO A;  1WEN A;  3N9Q A;  4FK5 A;  5B78 A;  3KNV A;  3L11 A;  2VPE A;  3LRQ A;  3GV4 A;  2PUY A;  2YW8 A;  2RI7 A;  3O36 A;  2CKL A;  3KV5 A;  3L1Z B;  2YT5 A;  3KV6 A;  2K4D A;  3N9P A;  1Z2Q A;  4AYC B;  5J3X A;  5LKU A;  5JG6 A;  1MM3 A;  3HCS A;  2AN6 A;  4WZ2 A;  3MHH A;  3N9L A;  4YAX A;  2H0D A;  4P5O B;  2KIZ A;  3U5P A;  2CT2 A;  3VK6 A;  4FJC A;  3N9N A;  5I3L A;  4QF2 A;  3ZTG A;  1T1H A;  1JM7 A;  3DPL R;  2VJE A;  1LDK C;  1X4J A;  2LV9 A;  1N87 A;  4LAD B;  2HDP A;  2UZG A;  1ZBD B;  1WIM A;  4YC9 A;  5AIU A;  4GB0 A;  2LXP C;  2BAY A;  2EOD A;  2VNF A;  4IC2 A;  4PTB A;  5B76 A;  3T6R A;  4LKA A;  3O70 A;  3C6W A;  2KWN A;  3N9O A;  2KWJ A;  4YBM A;  4NN2 A;  2G6Q A;  2LQ6 A;  3SHB A;  3M99 A;  4N3W A;  4UP5 A;  3RPG B;  2VJF A;  2IDA A;  2L0B A;  1MM2 A;  4A0C D;  2LGV A;  2QIC A;  1CHC A;  2CSZ A;  2YSJ A;  1Z60 A;  2ECN A;  2RSD A;  1WEM A;  1RMD A;  4X3G A;  5DIN A;  4LLB A;  1FP0 A;  2ECI A;  5LCW B;  2MNY A;  3IHP A;  2G43 A;  4L58 A;  4PPE A;  4YAB A;  5H1T A;  4AUQ B;  4I7B A;  1BOR A;  2JMI A;  3KQI A;  5KH9 A;  2DX8 A;  2EGP A;  1X4I A;  2YYR A;  5B75 A;  1WGM A;  2MD8 C;  3HCU A;  2LXH C;  4LJN A;  4I7C A;  4GNF A;  3O35 A;  2QIZ A;  2KWO A;  4L7X A;  2YQM A;  4WA6 A;  2MT5 A;  3U5M A;  5B77 A;  2F42 A;  4O64 A;  2E6R A;  3C5K A;  4CA1 A;  4GND A;  4R7E A;  2LDR A;  5LKX A;  1WEE A;  1HYI A;  2MUM A;  1WES A;  2KWK A;  1U6G B;  5H1U A;  3PHD A;  1WEW A;  2JRJ A;  3RPG C;  1WE9 A;  1HYJ A;  3NG2 A;  2VJF B;  3O7A A;  3L1X A;  5H1V A;  2OXQ C;  4S3O C;  5G04 B;  3O33 A;  2L5U A;  2F6N A;  4QF3 A;  4AVX A;  2M3H A;  4GNG A;  2ECG A;  3T7L A;  2NAA A;  2YQL A;  3HCT A;  1E4U A;  4YAD A;  3EB6 A;  4GNE A;  1XWH A;  4AYC A;  4YAT A;  2I50 A;  2MD7 B;  2LGG A;  2XEU A;  3QZV A;  5FER A;  5B79 A;  1F62 A;  4LK9 A;  2KYU A;  5KH3 A;  2CKL B;  2MIQ A;  4YBS A;  5D1L B;  5FB1 A;  4YBT A;  3ZNI A;  5H9M A;  1DVP A;  4S3O B;  3SOW A;  4XI1 A;  1VD4 A;  2ECW A;  2M6M A;  3M62 A;  2L75 A;  1JOC A;  2FSA A;  2YSM A;  2MA5 A;  2YUR A;  2Y43 A;  5D1M B;  2KRE A;  2H0D B;  2KU3 A;  4I7D A;  3I2D A;  3ZVZ B;  4B86 C;  2G45 A;  2JMD A;  4A49 A;  1WIL A;  4V3K C;  1G25 A;  1Z6U A;  3ASL A;  1WEQ A;  2YHN A;  4ZDT A;  3ZYQ A;  2YUC A;  1LDJ B;  3PUQ A;  5TRB A;  1JM7 B;  3ZPV 1;  2VJE B;  3V43 A;  2M85 A;  4W4U A;  2M1R A;  3DQV R;  3MHS A;  4B7Y C;  5G0F A;  2KGI A;  2YHO A;  2F6J A;  2L43 A;  2LRI C;  2Y1M A;  5LKZ A;  5D1K B;  5TAB A;  3RTR B;  3LQJ A;  5TBN A;  4UP0 A;  3GL6 A;  2LGL A;  5B8D A;  2C2L A;  2QJ0 A;  3O37 A;  5AIT A;  1V87 A;  3SOU A;  2E6S A;  4MVT A;  4BHW A;  2ECT A;  5FEY A;  4WZ3 B;  2KGG A;  2K17 A;  2KFT A;  4AP4 A;  5FB0 A;  4R8P K;  5C13 A;  2CSY A;  4FIP A;  2YU4 A;  3N9M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...