1LDJB

Structure of the cul1-rbx1-skp1-f boxskp2 scf ubiquitin ligase complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
88
structure length
88
Chain Sequence
KKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Cullin homolog 1
publication title Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF ubiquitin ligase complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 88
sequence length 88
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2002-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12678 zf-rbx1 RING-H2 zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1ldjB00
2ECGA 5EYAF 4LADB 2VNFA 4GNGA 2F42A 3V43A 1WILA 3HCSA 2G43A 1WFKA 2E6SA 3KQIA 1E4UA 2L80A 5B79A 3SHBA 4N3WA 5C11A 5D1LB 4MSXA 5JG6A 4AYCA 2FSAA 4O64A 1HYIA 2EODA 5KH7A 3I2DA 4AP4A 5B8DA 5LKXA 2H0DB 4GNDA 3RTRB 3T7LA 2M1RA 3ZYQA 1F62A 5H1TA 1ZBDB 4A4BA 1VYXA 1XWHA 3KV6A 5TRBA 4CCGX 3N9QA 2JMJA 5H1VA 2PUYA 2ZETC 2YURA 3O36A 3PURA 4I7DA 3HCUA 3DQVR 5KH3A 4S3OC 2YT5A 2KREA 4LLBA 2KGGA 4BHWA 1X4JA 2KGIA 3M99A 5H1UA 4A0CD 2YHOA 3C5KA 2C2VS 5DINA 1VFYA 4W4UA 1WE9A 2KU3A 4ZQLA 4FK5A 2HDPA 2FUUA 2RI7A 2YQMA 1DVPA 2LDRA 3ASLA 2LGGA 3SOUA 4UI9B 5LKUA 2VJFB 4B7YC 3O35A 4GB0A 5KH9A 2YW8A 3LQJA 5J3XA 2ECWA 4B86C 2MA5A 2MNZA 1Z60A 2M85A 2VJEA 5G05B 5LKZA 4LJNA 1WEUA 2K17A 2MUMA 3HCTA 1WEQA 5D1KB 2F6NA 4YBSA 3U5PA 2QIZA 2JRJA 3SOXA 2KFTA 2YQLA 2Y1MA 4YC9A 2LRIC 2YREA 2VPGA 4I7BA 1G25A 3EB5A 2PNXA 3RPGB 2VP7A 3U5OA 2KR4A 2E6RA 2LXHC 5FEYA 3MHHA 4X3GA 2MA6A 2MD8C 1JM7A 2EA6A 3LQHA 3PUQA 2MD7B 4N4FA 1WESA 4P5OB 3O34A 4R8PK 2F6JA 2KIZA 1VD4A 3ZVYA 2AN6A 4XI1A 2G6QA 4YAXA 5C13A 1X4IA 2LQ6A 4WZ3B 2FUIA 1Z2QA 5G04B 2H0DA 4FO9A 1IYMA 5FERA 1WEPA 4YABA 2VPEA 4AVXA 3RPGC 3GV4A 3T6RA 1WENA 3KNVA 5I3LA 2HYED 3ZNIA 4YATA 3L1XA 1X4UA 2YSMA 2OXQC 2UZGA 5LCWB 2L5UA 4QF3A 1K2FA 4WA6A 4I7CA 5B75A 3KV5A 3LQIA 3L1ZB 5G0FA 3ZVZB 4L7XA 3N9MA 4CA1A 4PPEA 3FL2A 2LV9A 4QF2A 2I50A 4V3KC 2VPBA 4TKPB 2L43A 4R7EA 1BORA 2CSYA 2L0BA 2DX8A 5H9MA 3MHSA 4AUQB 3N9LA 3NG2A 1WEWA 2CKLB 5FB0A 4C9ZA 3U5MA 2K4DA 2VJEB 2BAYA 1WEMA 2ECVA 1WEOA 2LGVA 2M6MA 5B77A 2VJFA 3O37A 2L75A 2G45A 2MNYA 2K16A 3ZTGA 3EB6A 4UP5A 2YU4A 1T1HA 2EGPA 2ECJA 5TDWA 1Z6UA 3QZVA 3LRQA 4YBMA 2XEUA 3M62A 3DPLR 3ZPVE 2KWKA 4GNFA 3HTKC 2MIQA 2D8SA 4UP0A 3O70A 2QICA 4R2YA 4AYCB 2K1JA 1JOCA 1U6GB 1WEVA 1N87A 2ECIA 3IHPA 3L11A 2LXPC 4YBTA 1JM7B 4ZDTA 2YSJA 2Y43A 2KWNA 4S3OB 1LDJB 5B76A 3ZPV1 2ECNA 2MT5A 2VPDA 4WZ0A 1RMDA 2IDAA 4PTBA 3PHDA 2LGLA 1V87A 2LN0A 4NN2A 3C6WA 4F52B 4IC2A 2YHNA 3O33A 2LGKA 1HYJA 5TBNA 5TDRA 1WGMA 3M63A 2C2LA 4ZUXU 1WIMA 4IC3A 2KWJA 2XB1A 4Q6FA 4FIPA 4A4CA 2QJ0A 2Y1NA 2JMDA 2KWOA 4MVTA 5AIUA 3VK6A 1LDKC 1CHCA 4GNEA 2YUCA 3GL6A 1WEEA 3N9PA 4L58A 4LK9A 5AITA 2ECTA 1MM3A 1MM2A 4BBQA 4A49A 4V3LC 4YADA 3N9OA 5FB1A 2JMIA 5B78A 2KYUA 2YYRA 3O7AA 2NAAA 3N9NA 4WZ2A 4FJCA 2CKLA 1FBVA 5D1MB 5LKTA 2RSDA 2CT2A 5DKAA 4LKAA 2M3HA 3U5NA 2CSZA 5TABA 3SOWA 1FP0A 2KE1A
chains in the Genus database with same CATH superfamily
2ECGA 5EYAF 4LADB 2VNFA 2IQJA 4GNGA 2F42A 3V43A 1WILA 3HCSA 2G43A 4F1PA 1WFKA 2E6SA 3KQIA 4QQ4A 1E4UA 2L80A 5B79A 3SHBA 5SVIA 4N3WA 5C11A 5D1LB 3FM8C 4MSXA 5JG6A 4AYCA 2FSAA 4O64A 1HYIA 2EODA 5KH7A 3I2DA 4AP4A 5B8DA 5LKXA 2H0DB 4GNDA 3RTRB 3T7LA 2M1RA 3ZYQA 1F62A 5H1TA 1ZBDB 4A4BA 1VYXA 1XWHA 3KV6A 5TRBA 4CCGX 3N9QA 2JM3A 2JMJA 5H1VA 2PUYA 2ZETC 2YURA 3O36A 2D8UA 2L7PA 3PURA 3LJUX 4I7DA 5SVYA 3HCUA 3DQVR 5KH3A 2XOCA 4S3OC 2YT5A 2KREA 4LLBA 2KGGA 4BHWA 3LVRE 1X4JA 2KGIA 3M99A 5H1UA 4A0CD 2YHOA 2E61A 3C5KA 2C2VS 2OWAA 5DINA 1VFYA 4W4UA 1WE9A 2KU3A 4ZQLA 4FK5A 2KKXA 2B0OE 2HDPA 2FUUA 2RI7A 2YQMA 2XP0A 1DVPA 2LDRA 3ASLA 2LGGA 3SOUA 4UI9B 5LKUA 2VJFB 2FD4A 4B7YC 3O35A 4GB0A 5KH9A 2YW8A 3LQJA 5J3XA 2ECWA 4B86C 2MA5A 2MNZA 1Z60A 2M85A 2VJEA 5G05B 5LKZA 2DJAA 4LJNA 1WEUA 2K17A 3FJUB 2MUMA 3HCTA 1WEQA 3LVQE 5D1KB 2F6NA 4YBSA 2DSMA 3U5PA 2QIZA 2JRJA 3SOXA 2KFTA 2YQLA 2Y1MA 4YC9A 2LRIC 2YREA 3DDTA 2VPGA 4I7BA 1G25A 3EB5A 3LDYA 2PNXA 3RPGB 4H9DA 2VP7A 3U5OA 2KR4A 2E6RA 2LXHC 5FEYA 3FEHA 3MHHA 4X3GA 2MA6A 2MD8C 1JM7A 2EA6A 3LQHA 3PUQA 2MD7B 4N4FA 1WESA 4P5OB 3O34A 4R8PK 2F6JA 2KIZA 1VD4A 3ZVYA 2AN6A 4XI1A 2G6QA 4YAXA 5C13A 1X4IA 2P57A 3DWDA 2LQ6A 1MBMA 4WZ3B 2FUIA 1Z2QA 5G04B 2H0DA 4FO9A 1IYMA 5FERA 4Z0OA 1WEPA 4YABA 2VPEA 4AVXA 3RPGC 3GV4A 3T6RA 1WENA 3KNVA 5I3LA 3PLWA 2HYED 2MKEA 3ZNIA 4YATA 3L1XA 1X4UA 3MDBC 2YSMA 2OXQC 2UZGA 5LCWB 2L5UA 4QF3A 1K2FA 4WA6A 4I7CA 5B75A 3KV5A 3LQIA 3L1ZB 5G0FA 3ZVZB 4L7XA 3N9MA 4CA1A 4PPEA 3FL2A 2LV9A 4QF2A 2I50A 2RR4A 4V3KC 3FAOA 2VPBA 4TKPB 2L43A 4R7EA 1BORA 2CSYA 4O62A 2L0BA 2DX8A 3JUEA 5H9MA 3MHSA 4AUQB 3N9LA 3NG2A 1WEWA 2CKLB 2FFWA 5FB0A 4C9ZA 3U5MA 2K4DA 2VJEB 2BAYA 1WEMA 2ECVA 1WEOA 2LGVA 2M6MA 5B77A 2VJFA 3O37A 2L75A 2G45A 2MNYA 2K16A 2M13A 3ZTGA 3EB6A 4UP5A 2YU4A 1T1HA 2EGPA 2ECJA 2JUNA 3H7HA 5TDWA 1Z6UA 3M7KA 3QZVA 3LRQA 4YBMA 2XEUA 3M62A 2KKYA 3DPLR 5SVIB 3ZPVE 2KWKA 4GNFA 3HTKC 4OGCA 2MIQA 2D8SA 4UP0A 2CSVA 3O70A 2QICA 4R2YA 4AYCB 2K1JA 1JOCA 1U6GB 1WEVA 1N87A 2ECIA 2YVRA 3IHPA 3L11A 2LXPC 2CRRA 4YBTA 1JM7B 4ZDTA 2YSJA 2Y43A 5SVXA 2KWNA 4S3OB 1LDJB 5B76A 3ZPV1 2ECNA 2MT5A 3FANA 2VPDA 3Q1DA 4WZ0A 1RMDA 1DCQA 2IDAA 4PTBA 3PHDA 2LGLA 1V87A 2LN0A 4NN2A 2EXUA 3C6WA 4F52B 4IC2A 2YHNA 3KDEC 3O33A 2CRWA 3T9KA 2LGKA 1HYJA 5TBNA 5TDRA 1WGMA 2EGMA 3M63A 2C2LA 4ZUXU 1WIMA 4IC3A 2KWJA 2XB1A 4Q6FA 4FIPA 4A4CA 2QJ0A 2Y1NA 2JMDA 2XOYA 4OGEA 2KWOA 5K3QA 2CONA 4MVTA 5AIUA 3VK6A 2LAUA 1LDKC 1CHCA 4GNEA 2XOZA 2YUCA 3GL6A 1WEEA 3N9PA 4L58A 4LK9A 5AITA 2ECTA 1MM3A 1MM2A 4BBQA 4A49A 4V3LC 4Z0RA 4YADA 3N9OA 5FB1A 3SUBA 2JMIA 5B78A 2KYUA 2YYRA 3O7AA 2NAAA 3N9NA 4WZ2A 4FJCA 3E2DA 2CKLA 1FBVA 5D1MB 5LKTA 2RSDA 2CT2A 5DKAA 4LKAA 2M3HA 3O47A 3U5NA 2CSZA 5TABA 3SOWA 1FP0A 2KE1A
chains in the Genus database with same CATH topology
2ECGA 5EYAF 4LADB 2VNFA 4GNGA 2F42A 3V43A 1WILA 3HCSA 2G43A 1WFKA 2E6SA 3KQIA 1E4UA 2L80A 5B79A 3SHBA 4N3WA 5C11A 5D1LB 4MSXA 5JG6A 4AYCA 2FSAA 4O64A 1HYIA 2EODA 5KH7A 3I2DA 4AP4A 5B8DA 5LKXA 2H0DB 4GNDA 3RTRB 3T7LA 2M1RA 3ZYQA 1F62A 5H1TA 1ZBDB 4A4BA 1VYXA 1XWHA 3KV6A 5TRBA 4CCGX 3N9QA 2JMJA 5H1VA 2PUYA 2ZETC 2YURA 3O36A 3PURA 4I7DA 3HCUA 3DQVR 5KH3A 4S3OC 2YT5A 2KREA 4LLBA 2KGGA 4BHWA 1X4JA 2KGIA 3M99A 5H1UA 4A0CD 2YHOA 3C5KA 2C2VS 5DINA 1VFYA 4W4UA 1WE9A 2KU3A 4ZQLA 4FK5A 2HDPA 2FUUA 2RI7A 2YQMA 1DVPA 2LDRA 3ASLA 2LGGA 3SOUA 4UI9B 5LKUA 2VJFB 4B7YC 3O35A 4GB0A 5KH9A 2YW8A 3LQJA 5J3XA 2ECWA 4B86C 2MA5A 2MNZA 1Z60A 2M85A 2VJEA 5G05B 5LKZA 4LJNA 1WEUA 2K17A 2MUMA 3HCTA 1WEQA 5D1KB 2F6NA 4YBSA 3U5PA 2QIZA 2JRJA 3SOXA 2KFTA 2YQLA 2Y1MA 4YC9A 2LRIC 2YREA 2VPGA 4I7BA 1G25A 3EB5A 2PNXA 3RPGB 2VP7A 3U5OA 2KR4A 2E6RA 2LXHC 5FEYA 3MHHA 4X3GA 2MA6A 2MD8C 1JM7A 2EA6A 3LQHA 3PUQA 2MD7B 4N4FA 1WESA 4P5OB 3O34A 4R8PK 2F6JA 2KIZA 1VD4A 3ZVYA 2AN6A 4XI1A 2G6QA 4YAXA 5C13A 1X4IA 2LQ6A 4WZ3B 2FUIA 1Z2QA 5G04B 2H0DA 4FO9A 1IYMA 5FERA 1WEPA 4YABA 2VPEA 4AVXA 3RPGC 3GV4A 3T6RA 1WENA 3KNVA 5I3LA 2HYED 3ZNIA 4YATA 3L1XA 1X4UA 2YSMA 2OXQC 2UZGA 5LCWB 2L5UA 4QF3A 1K2FA 4WA6A 4I7CA 5B75A 3KV5A 3LQIA 3L1ZB 5G0FA 3ZVZB 4L7XA 3N9MA 4CA1A 4PPEA 3FL2A 2LV9A 4QF2A 2I50A 4V3KC 2VPBA 4TKPB 2L43A 4R7EA 1BORA 2CSYA 2L0BA 2DX8A 5H9MA 3MHSA 4AUQB 3N9LA 3NG2A 1WEWA 2CKLB 5FB0A 4C9ZA 3U5MA 2K4DA 2VJEB 2BAYA 1WEMA 2ECVA 1WEOA 2LGVA 2M6MA 5B77A 2VJFA 3O37A 2L75A 2G45A 2MNYA 2K16A 3ZTGA 3EB6A 4UP5A 2YU4A 1T1HA 2EGPA 2ECJA 5TDWA 1Z6UA 3QZVA 3LRQA 4YBMA 2XEUA 3M62A 3DPLR 3ZPVE 2KWKA 4GNFA 3HTKC 2MIQA 2D8SA 4UP0A 3O70A 2QICA 4R2YA 4AYCB 2K1JA 1JOCA 1U6GB 1WEVA 1N87A 2ECIA 3IHPA 3L11A 2LXPC 4YBTA 1JM7B 4ZDTA 2YSJA 2Y43A 2KWNA 4S3OB 1LDJB 5B76A 3ZPV1 2ECNA 2MT5A 2VPDA 4WZ0A 1RMDA 2IDAA 4PTBA 3PHDA 2LGLA 1V87A 2LN0A 4NN2A 3C6WA 4F52B 4IC2A 2YHNA 3O33A 2LGKA 1HYJA 5TBNA 5TDRA 1WGMA 3M63A 2C2LA 4ZUXU 1WIMA 4IC3A 2KWJA 2XB1A 4Q6FA 4FIPA 4A4CA 2QJ0A 2Y1NA 2JMDA 2KWOA 4MVTA 5AIUA 3VK6A 1LDKC 1CHCA 4GNEA 2YUCA 3GL6A 1WEEA 3N9PA 4L58A 4LK9A 5AITA 2ECTA 1MM3A 1MM2A 4BBQA 4A49A 4V3LC 4YADA 3N9OA 5FB1A 2JMIA 5B78A 2KYUA 2YYRA 3O7AA 2NAAA 3N9NA 4WZ2A 4FJCA 2CKLA 1FBVA 5D1MB 5LKTA 2RSDA 2CT2A 5DKAA 4LKAA 2M3HA 3U5NA 2CSZA 5TABA 3SOWA 1FP0A 2KE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ECG A;  5EYA F;  4LAD B;  2VNF A;  4GNG A;  2F42 A;  3V43 A;  1WIL A;  3HCS A;  2G43 A;  1WFK A;  2E6S A;  3KQI A;  1E4U A;  2L80 A;  5B79 A;  3SHB A;  4N3W A;  5C11 A;  5D1L B;  4MSX A;  5JG6 A;  4AYC A;  2FSA A;  4O64 A;  1HYI A;  2EOD A;  5KH7 A;  3I2D A;  4AP4 A;  5B8D A;  5LKX A;  2H0D B;  4GND A;  3RTR B;  3T7L A;  2M1R A;  3ZYQ A;  1F62 A;  5H1T A;  1ZBD B;  4A4B A;  1VYX A;  1XWH A;  3KV6 A;  5TRB A;  4CCG X;  3N9Q A;  2JMJ A;  5H1V A;  2PUY A;  2ZET C;  2YUR A;  3O36 A;  3PUR A;  4I7D A;  3HCU A;  3DQV R;  5KH3 A;  4S3O C;  2YT5 A;  2KRE A;  4LLB A;  2KGG A;  4BHW A;  1X4J A;  2KGI A;  3M99 A;  5H1U A;  4A0C D;  2YHO A;  3C5K A;  2C2V S;  5DIN A;  1VFY A;  4W4U A;  1WE9 A;  2KU3 A;  4ZQL A;  4FK5 A;  2HDP A;  2FUU A;  2RI7 A;  2YQM A;  1DVP A;  2LDR A;  3ASL A;  2LGG A;  3SOU A;  4UI9 B;  5LKU A;  2VJF B;  4B7Y C;  3O35 A;  4GB0 A;  5KH9 A;  2YW8 A;  3LQJ A;  5J3X A;  2ECW A;  4B86 C;  2MA5 A;  2MNZ A;  1Z60 A;  2M85 A;  2VJE A;  5G05 B;  5LKZ A;  4LJN A;  1WEU A;  2K17 A;  2MUM A;  3HCT A;  1WEQ A;  5D1K B;  2F6N A;  4YBS A;  3U5P A;  2QIZ A;  2JRJ A;  3SOX A;  2KFT A;  2YQL A;  2Y1M A;  4YC9 A;  2LRI C;  2YRE A;  2VPG A;  4I7B A;  1G25 A;  3EB5 A;  2PNX A;  3RPG B;  2VP7 A;  3U5O A;  2KR4 A;  2E6R A;  2LXH C;  5FEY A;  3MHH A;  4X3G A;  2MA6 A;  2MD8 C;  1JM7 A;  2EA6 A;  3LQH A;  3PUQ A;  2MD7 B;  4N4F A;  1WES A;  4P5O B;  3O34 A;  4R8P K;  2F6J A;  2KIZ A;  1VD4 A;  3ZVY A;  2AN6 A;  4XI1 A;  2G6Q A;  4YAX A;  5C13 A;  1X4I A;  2LQ6 A;  4WZ3 B;  2FUI A;  1Z2Q A;  5G04 B;  2H0D A;  4FO9 A;  1IYM A;  5FER A;  1WEP A;  4YAB A;  2VPE A;  4AVX A;  3RPG C;  3GV4 A;  3T6R A;  1WEN A;  3KNV A;  5I3L A;  2HYE D;  3ZNI A;  4YAT A;  3L1X A;  1X4U A;  2YSM A;  2OXQ C;  2UZG A;  5LCW B;  2L5U A;  4QF3 A;  1K2F A;  4WA6 A;  4I7C A;  5B75 A;  3KV5 A;  3LQI A;  3L1Z B;  5G0F A;  3ZVZ B;  4L7X A;  3N9M A;  4CA1 A;  4PPE A;  3FL2 A;  2LV9 A;  4QF2 A;  2I50 A;  4V3K C;  2VPB A;  4TKP B;  2L43 A;  4R7E A;  1BOR A;  2CSY A;  2L0B A;  2DX8 A;  5H9M A;  3MHS A;  4AUQ B;  3N9L A;  3NG2 A;  1WEW A;  2CKL B;  5FB0 A;  4C9Z A;  3U5M A;  2K4D A;  2VJE B;  2BAY A;  1WEM A;  2ECV A;  1WEO A;  2LGV A;  2M6M A;  5B77 A;  2VJF A;  3O37 A;  2L75 A;  2G45 A;  2MNY A;  2K16 A;  3ZTG A;  3EB6 A;  4UP5 A;  2YU4 A;  1T1H A;  2EGP A;  2ECJ A;  5TDW A;  1Z6U A;  3QZV A;  3LRQ A;  4YBM A;  2XEU A;  3M62 A;  3DPL R;  3ZPV E;  2KWK A;  4GNF A;  3HTK C;  2MIQ A;  2D8S A;  4UP0 A;  3O70 A;  2QIC A;  4R2Y A;  4AYC B;  2K1J A;  1JOC A;  1U6G B;  1WEV A;  1N87 A;  2ECI A;  3IHP A;  3L11 A;  2LXP C;  4YBT A;  1JM7 B;  4ZDT A;  2YSJ A;  2Y43 A;  2KWN A;  4S3O B;  1LDJ B;  5B76 A;  3ZPV 1;  2ECN A;  2MT5 A;  2VPD A;  4WZ0 A;  1RMD A;  2IDA A;  4PTB A;  3PHD A;  2LGL A;  1V87 A;  2LN0 A;  4NN2 A;  3C6W A;  4F52 B;  4IC2 A;  2YHN A;  3O33 A;  2LGK A;  1HYJ A;  5TBN A;  5TDR A;  1WGM A;  3M63 A;  2C2L A;  4ZUX U;  1WIM A;  4IC3 A;  2KWJ A;  2XB1 A;  4Q6F A;  4FIP A;  4A4C A;  2QJ0 A;  2Y1N A;  2JMD A;  2KWO A;  4MVT A;  5AIU A;  3VK6 A;  1LDK C;  1CHC A;  4GNE A;  2YUC A;  3GL6 A;  1WEE A;  3N9P A;  4L58 A;  4LK9 A;  5AIT A;  2ECT A;  1MM3 A;  1MM2 A;  4BBQ A;  4A49 A;  4V3L C;  4YAD A;  3N9O A;  5FB1 A;  2JMI A;  5B78 A;  2KYU A;  2YYR A;  3O7A A;  2NAA A;  3N9N A;  4WZ2 A;  4FJC A;  2CKL A;  1FBV A;  5D1M B;  5LKT A;  2RSD A;  2CT2 A;  5DKA A;  4LKA A;  2M3H A;  3U5N A;  2CSZ A;  5TAB A;  3SOW A;  1FP0 A;  2KE1 A; 
#chains in the Genus database with same CATH topology
 2ECG A;  5EYA F;  4LAD B;  2VNF A;  2IQJ A;  4GNG A;  2F42 A;  3V43 A;  1WIL A;  3HCS A;  2G43 A;  4F1P A;  1WFK A;  2E6S A;  3KQI A;  4QQ4 A;  1E4U A;  2L80 A;  5B79 A;  3SHB A;  5SVI A;  4N3W A;  5C11 A;  5D1L B;  3FM8 C;  4MSX A;  5JG6 A;  4AYC A;  2FSA A;  4O64 A;  1HYI A;  2EOD A;  5KH7 A;  3I2D A;  4AP4 A;  5B8D A;  5LKX A;  2H0D B;  4GND A;  3RTR B;  3T7L A;  2M1R A;  3ZYQ A;  1F62 A;  5H1T A;  1ZBD B;  4A4B A;  1VYX A;  1XWH A;  3KV6 A;  5TRB A;  4CCG X;  3N9Q A;  2JM3 A;  2JMJ A;  5H1V A;  2PUY A;  2ZET C;  2YUR A;  3O36 A;  2D8U A;  2L7P A;  3PUR A;  3LJU X;  4I7D A;  5SVY A;  3HCU A;  3DQV R;  5KH3 A;  2XOC A;  4S3O C;  2YT5 A;  2KRE A;  4LLB A;  2KGG A;  4BHW A;  3LVR E;  1X4J A;  2KGI A;  3M99 A;  5H1U A;  4A0C D;  2YHO A;  2E61 A;  3C5K A;  2C2V S;  2OWA A;  5DIN A;  1VFY A;  4W4U A;  1WE9 A;  2KU3 A;  4ZQL A;  4FK5 A;  2KKX A;  2B0O E;  2HDP A;  2FUU A;  2RI7 A;  2YQM A;  2XP0 A;  1DVP A;  2LDR A;  3ASL A;  2LGG A;  3SOU A;  4UI9 B;  5LKU A;  2VJF B;  2FD4 A;  4B7Y C;  3O35 A;  4GB0 A;  5KH9 A;  2YW8 A;  3LQJ A;  5J3X A;  2ECW A;  4B86 C;  2MA5 A;  2MNZ A;  1Z60 A;  2M85 A;  2VJE A;  5G05 B;  5LKZ A;  2DJA A;  4LJN A;  1WEU A;  2K17 A;  3FJU B;  2MUM A;  3HCT A;  1WEQ A;  3LVQ E;  5D1K B;  2F6N A;  4YBS A;  2DSM A;  3U5P A;  2QIZ A;  2JRJ A;  3SOX A;  2KFT A;  2YQL A;  2Y1M A;  4YC9 A;  2LRI C;  2YRE A;  3DDT A;  2VPG A;  4I7B A;  1G25 A;  3EB5 A;  3LDY A;  2PNX A;  3RPG B;  4H9D A;  2VP7 A;  3U5O A;  2KR4 A;  2E6R A;  2LXH C;  5FEY A;  3FEH A;  3MHH A;  4X3G A;  2MA6 A;  2MD8 C;  1JM7 A;  2EA6 A;  3LQH A;  3PUQ A;  2MD7 B;  4N4F A;  1WES A;  4P5O B;  3O34 A;  4R8P K;  2F6J A;  2KIZ A;  1VD4 A;  3ZVY A;  2AN6 A;  4XI1 A;  2G6Q A;  4YAX A;  5C13 A;  1X4I A;  2P57 A;  3DWD A;  2LQ6 A;  1MBM A;  4WZ3 B;  2FUI A;  1Z2Q A;  5G04 B;  2H0D A;  4FO9 A;  1IYM A;  5FER A;  4Z0O A;  1WEP A;  4YAB A;  2VPE A;  4AVX A;  3RPG C;  3GV4 A;  3T6R A;  1WEN A;  3KNV A;  5I3L A;  3PLW A;  2HYE D;  2MKE A;  3ZNI A;  4YAT A;  3L1X A;  1X4U A;  3MDB C;  2YSM A;  2OXQ C;  2UZG A;  5LCW B;  2L5U A;  4QF3 A;  1K2F A;  4WA6 A;  4I7C A;  5B75 A;  3KV5 A;  3LQI A;  3L1Z B;  5G0F A;  3ZVZ B;  4L7X A;  3N9M A;  4CA1 A;  4PPE A;  3FL2 A;  2LV9 A;  4QF2 A;  2I50 A;  2RR4 A;  4V3K C;  3FAO A;  2VPB A;  4TKP B;  2L43 A;  4R7E A;  1BOR A;  2CSY A;  4O62 A;  2L0B A;  2DX8 A;  3JUE A;  5H9M A;  3MHS A;  4AUQ B;  3N9L A;  3NG2 A;  1WEW A;  2CKL B;  2FFW A;  5FB0 A;  4C9Z A;  3U5M A;  2K4D A;  2VJE B;  2BAY A;  1WEM A;  2ECV A;  1WEO A;  2LGV A;  2M6M A;  5B77 A;  2VJF A;  3O37 A;  2L75 A;  2G45 A;  2MNY A;  2K16 A;  2M13 A;  3ZTG A;  3EB6 A;  4UP5 A;  2YU4 A;  1T1H A;  2EGP A;  2ECJ A;  2JUN A;  3H7H A;  5TDW A;  1Z6U A;  3M7K A;  3QZV A;  3LRQ A;  4YBM A;  2XEU A;  3M62 A;  2KKY A;  3DPL R;  5SVI B;  3ZPV E;  2KWK A;  4GNF A;  3HTK C;  4OGC A;  2MIQ A;  2D8S A;  4UP0 A;  2CSV A;  3O70 A;  2QIC A;  4R2Y A;  4AYC B;  2K1J A;  1JOC A;  1U6G B;  1WEV A;  1N87 A;  2ECI A;  2YVR A;  3IHP A;  3L11 A;  2LXP C;  2CRR A;  4YBT A;  1JM7 B;  4ZDT A;  2YSJ A;  2Y43 A;  5SVX A;  2KWN A;  4S3O B;  1LDJ B;  5B76 A;  3ZPV 1;  2ECN A;  2MT5 A;  3FAN A;  2VPD A;  3Q1D A;  4WZ0 A;  1RMD A;  1DCQ A;  2IDA A;  4PTB A;  3PHD A;  2LGL A;  1V87 A;  2LN0 A;  4NN2 A;  2EXU A;  3C6W A;  4F52 B;  4IC2 A;  2YHN A;  3KDE C;  3O33 A;  2CRW A;  3T9K A;  2LGK A;  1HYJ A;  5TBN A;  5TDR A;  1WGM A;  2EGM A;  3M63 A;  2C2L A;  4ZUX U;  1WIM A;  4IC3 A;  2KWJ A;  2XB1 A;  4Q6F A;  4FIP A;  4A4C A;  2QJ0 A;  2Y1N A;  2JMD A;  2XOY A;  4OGE A;  2KWO A;  5K3Q A;  2CON A;  4MVT A;  5AIU A;  3VK6 A;  2LAU A;  1LDK C;  1CHC A;  4GNE A;  2XOZ A;  2YUC A;  3GL6 A;  1WEE A;  3N9P A;  4L58 A;  4LK9 A;  5AIT A;  2ECT A;  1MM3 A;  1MM2 A;  4BBQ A;  4A49 A;  4V3L C;  4Z0R A;  4YAD A;  3N9O A;  5FB1 A;  3SUB A;  2JMI A;  5B78 A;  2KYU A;  2YYR A;  3O7A A;  2NAA A;  3N9N A;  4WZ2 A;  4FJC A;  3E2D A;  2CKL A;  1FBV A;  5D1M B;  5LKT A;  2RSD A;  2CT2 A;  5DKA A;  4LKA A;  2M3H A;  3O47 A;  3U5N A;  2CSZ A;  5TAB A;  3SOW A;  1FP0 A;  2KE1 A; 
#chains in the Genus database with same CATH homology
 2ECG A;  5EYA F;  4LAD B;  2VNF A;  4GNG A;  2F42 A;  3V43 A;  1WIL A;  3HCS A;  2G43 A;  1WFK A;  2E6S A;  3KQI A;  1E4U A;  2L80 A;  5B79 A;  3SHB A;  4N3W A;  5C11 A;  5D1L B;  4MSX A;  5JG6 A;  4AYC A;  2FSA A;  4O64 A;  1HYI A;  2EOD A;  5KH7 A;  3I2D A;  4AP4 A;  5B8D A;  5LKX A;  2H0D B;  4GND A;  3RTR B;  3T7L A;  2M1R A;  3ZYQ A;  1F62 A;  5H1T A;  1ZBD B;  4A4B A;  1VYX A;  1XWH A;  3KV6 A;  5TRB A;  4CCG X;  3N9Q A;  2JMJ A;  5H1V A;  2PUY A;  2ZET C;  2YUR A;  3O36 A;  3PUR A;  4I7D A;  3HCU A;  3DQV R;  5KH3 A;  4S3O C;  2YT5 A;  2KRE A;  4LLB A;  2KGG A;  4BHW A;  1X4J A;  2KGI A;  3M99 A;  5H1U A;  4A0C D;  2YHO A;  3C5K A;  2C2V S;  5DIN A;  1VFY A;  4W4U A;  1WE9 A;  2KU3 A;  4ZQL A;  4FK5 A;  2HDP A;  2FUU A;  2RI7 A;  2YQM A;  1DVP A;  2LDR A;  3ASL A;  2LGG A;  3SOU A;  4UI9 B;  5LKU A;  2VJF B;  4B7Y C;  3O35 A;  4GB0 A;  5KH9 A;  2YW8 A;  3LQJ A;  5J3X A;  2ECW A;  4B86 C;  2MA5 A;  2MNZ A;  1Z60 A;  2M85 A;  2VJE A;  5G05 B;  5LKZ A;  4LJN A;  1WEU A;  2K17 A;  2MUM A;  3HCT A;  1WEQ A;  5D1K B;  2F6N A;  4YBS A;  3U5P A;  2QIZ A;  2JRJ A;  3SOX A;  2KFT A;  2YQL A;  2Y1M A;  4YC9 A;  2LRI C;  2YRE A;  2VPG A;  4I7B A;  1G25 A;  3EB5 A;  2PNX A;  3RPG B;  2VP7 A;  3U5O A;  2KR4 A;  2E6R A;  2LXH C;  5FEY A;  3MHH A;  4X3G A;  2MA6 A;  2MD8 C;  1JM7 A;  2EA6 A;  3LQH A;  3PUQ A;  2MD7 B;  4N4F A;  1WES A;  4P5O B;  3O34 A;  4R8P K;  2F6J A;  2KIZ A;  1VD4 A;  3ZVY A;  2AN6 A;  4XI1 A;  2G6Q A;  4YAX A;  5C13 A;  1X4I A;  2LQ6 A;  4WZ3 B;  2FUI A;  1Z2Q A;  5G04 B;  2H0D A;  4FO9 A;  1IYM A;  5FER A;  1WEP A;  4YAB A;  2VPE A;  4AVX A;  3RPG C;  3GV4 A;  3T6R A;  1WEN A;  3KNV A;  5I3L A;  2HYE D;  3ZNI A;  4YAT A;  3L1X A;  1X4U A;  2YSM A;  2OXQ C;  2UZG A;  5LCW B;  2L5U A;  4QF3 A;  1K2F A;  4WA6 A;  4I7C A;  5B75 A;  3KV5 A;  3LQI A;  3L1Z B;  5G0F A;  3ZVZ B;  4L7X A;  3N9M A;  4CA1 A;  4PPE A;  3FL2 A;  2LV9 A;  4QF2 A;  2I50 A;  4V3K C;  2VPB A;  4TKP B;  2L43 A;  4R7E A;  1BOR A;  2CSY A;  2L0B A;  2DX8 A;  5H9M A;  3MHS A;  4AUQ B;  3N9L A;  3NG2 A;  1WEW A;  2CKL B;  5FB0 A;  4C9Z A;  3U5M A;  2K4D A;  2VJE B;  2BAY A;  1WEM A;  2ECV A;  1WEO A;  2LGV A;  2M6M A;  5B77 A;  2VJF A;  3O37 A;  2L75 A;  2G45 A;  2MNY A;  2K16 A;  3ZTG A;  3EB6 A;  4UP5 A;  2YU4 A;  1T1H A;  2EGP A;  2ECJ A;  5TDW A;  1Z6U A;  3QZV A;  3LRQ A;  4YBM A;  2XEU A;  3M62 A;  3DPL R;  3ZPV E;  2KWK A;  4GNF A;  3HTK C;  2MIQ A;  2D8S A;  4UP0 A;  3O70 A;  2QIC A;  4R2Y A;  4AYC B;  2K1J A;  1JOC A;  1U6G B;  1WEV A;  1N87 A;  2ECI A;  3IHP A;  3L11 A;  2LXP C;  4YBT A;  1JM7 B;  4ZDT A;  2YSJ A;  2Y43 A;  2KWN A;  4S3O B;  1LDJ B;  5B76 A;  3ZPV 1;  2ECN A;  2MT5 A;  2VPD A;  4WZ0 A;  1RMD A;  2IDA A;  4PTB A;  3PHD A;  2LGL A;  1V87 A;  2LN0 A;  4NN2 A;  3C6W A;  4F52 B;  4IC2 A;  2YHN A;  3O33 A;  2LGK A;  1HYJ A;  5TBN A;  5TDR A;  1WGM A;  3M63 A;  2C2L A;  4ZUX U;  1WIM A;  4IC3 A;  2KWJ A;  2XB1 A;  4Q6F A;  4FIP A;  4A4C A;  2QJ0 A;  2Y1N A;  2JMD A;  2KWO A;  4MVT A;  5AIU A;  3VK6 A;  1LDK C;  1CHC A;  4GNE A;  2YUC A;  3GL6 A;  1WEE A;  3N9P A;  4L58 A;  4LK9 A;  5AIT A;  2ECT A;  1MM3 A;  1MM2 A;  4BBQ A;  4A49 A;  4V3L C;  4YAD A;  3N9O A;  5FB1 A;  2JMI A;  5B78 A;  2KYU A;  2YYR A;  3O7A A;  2NAA A;  3N9N A;  4WZ2 A;  4FJC A;  2CKL A;  1FBV A;  5D1M B;  5LKT A;  2RSD A;  2CT2 A;  5DKA A;  4LKA A;  2M3H A;  3U5N A;  2CSZ A;  5TAB A;  3SOW A;  1FP0 A;  2KE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...