4BBQA

Crystal structure of the cxxc and phd domain of human lysine-specific demethylase 2a (kdm2a)(fbxl11)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
111
structure length
111
Chain Sequence
b'MRRVRCRKCKACVQGECGVCHYCRDMKKFGGPGRMKQSCVLRQCLAPRLPHSVTCSLCGEVDQNEETQDFEKKLMECCICNEIVHPGCLQMDGEGLLNEELPNCWECPKCY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LYSINE-SPECIFIC DEMETHYLASE 2A
publication title Crystal Structure of the Cxxc and Phd Domain of Human Lysine-Specific Demethylase 2A (Kdm2A)(Fbxl11)
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 19
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16866 PHD_4 PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4bbqA01
5G0FA 5B8DA 2ECJA 2KREA 2KWOA 3KQIA 5D1KB 4GNFA 4ZDTA 3N9PA 4S3OC 3U5PA 1FP0A 3O33A 1N87A 3C6WA 5B78A 5I3LA 2KWKA 3SHBA 1JM7A 2ECIA 3U5MA 3HCSA 3O34A 1WIMA 5FB0A 2F42A 2KIZA 5TBNA 4N3WA 2KGGA 2Y1MA 2QICA 2G45A 2YW8A 1JOCA 2RSDA 4P5OB 1MM2A 4I7DA 3M62A 3ZNIA 1WGMA 2C2LA 3NG2A 2OXQC 4X3GA 1U6GB 2H0DA 1WEWA 3HTKC 4IC3A 2L75A 5TDWA 3KNVA 4AUQB 4R7EA 2L5UA 1G25A 4WZ0A 2M6MA 4FK5A 1CHCA 1Z2QA 2PUYA 4C9ZA 5FERA 2MT5A 2FUUA 5FEYA 3PURA 2KWNA 2C2VS 5KH9A 5B75A 3LQIA 5D1MB 2K4DA 4WA6A 3ZYQA 4YADA 2MIQA 3N9LA 4AYCB 4Q6FA 1X4UA 3O7AA 3KV5A 2MD7B 2UZGA 4YBSA 1HYJA 3L1XA 1VFYA 5AITA 2KR4A 2YURA 5DKAA 2ECNA 2LQ6A 2NAAA 4MSXA 3SOUA 4LJNA 2PNXA 4B7YC 1WEOA 1MM3A 4YAXA 1X4JA 3KV6A 5LKXA 2XB1A 3SOXA 4GNEA 5LKUA 3ZPV1 2YYRA 1WE9A 4R2YA 2YHNA 2M3HA 5B77A 2EODA 3PUQA 4V3LC 2MA5A 4LLBA 2YQMA 4CA1A 1WEPA 2MNYA 2XEUA 4PPEA 4YATA 5LKTA 3SOWA 4AVXA 1WEMA 4L58A 4A49A 4CCGX 5TRBA 5H1TA 2LV9A 1VD4A 4LK9A 3L11A 5LCWB 4PTBA 2M85A 5TDRA 2LXHC 2YUCA 2E6SA 2HYED 2YHOA 4V3KC 2ZETC 4YABA 4AYCA 4FJCA 5LKZA 1VYXA 4W4UA 1WESA 4FIPA 3T7LA 5B76A 3LQHA 2IDAA 4GNDA 3ASLA 2YSMA 2F6JA 3GL6A 3LQJA 2EGPA 2Y1NA 2VPDA 4S3OB 3N9MA 2JMDA 2HDPA 4YC9A 2CSZA 3EB6A 3O37A 2CKLB 3IHPA 2YU4A 5JG6A 1X4IA 1F62A 1T1HA 1IYMA 5AIUA 1V87A 2QJ0A 2RI7A 4WZ2A 3V43A 2VJEB 2JMJA 4I7BA 2LGGA 4ZQLA 4MVTA 2LGKA 4B86C 4QF2A 4I7CA 2VP7A 1RMDA 2VPGA 3M99A 5FB1A 3EB5A 3MHHA 3MHSA 2E6RA 3RPGC 2ECTA 2VPBA 5H1UA 4UI9B 3HCTA 1WEEA 2G43A 3ZVZB 2CSYA 3DQVR 3FL2A 4A0CD 3T6RA 4GB0A 4R8PK 1WEVA 2G6QA 3HCUA 2ECGA 4LADB 5J3XA 2K16A 4GNGA 5C11A 2FUIA 2ECWA 4XI1A 2M1RA 4A4BA 4BBQA 2LGLA 4WZ3B 3U5NA 4BHWA 4N4FA 2I50A 1WEQA 4YBTA 2KGIA 1XWHA 2VPEA 2VJEA 3L1ZB 2KWJA 4IC2A 1DVPA 2YQLA 3ZTGA 4ZUXU 5C13A 1HYIA 2AN6A 3LRQA 1Z60A 3U5OA 2L80A 3QZVA 4LKAA 2KYUA 4O64A 4UP5A 3VK6A 5KH3A 4A4CA 4NN2A 5TABA 1LDJB 5H9MA 4AP4A 3GV4A 2YREA 1WEUA 2KU3A 3O35A 5DINA 4QF3A 2YSJA 2LGVA 2F6NA 2K17A 2LN0A 4YBMA 2KE1A 3N9NA 2EA6A 3PHDA 2LDRA 5G05B 5H1VA 4F52B 3I2DA 1BORA 2D8SA 4TKPB 3N9QA 2LXPC 2VJFB 5B79A 2KFTA 2FSAA 2MUMA 1ZBDB 3ZVYA 2VNFA 3N9OA 4UP0A 2ECVA 2CT2A 2MA6A 1JM7B 1LDKC 3DPLR 1WILA 2Y43A 5KH7A 2LRIC 2JMIA 3RPGB 1WFKA 2K1JA 3M63A 1FBVA 3ZPVE 2MD8C 1E4UA 2JRJA 2CKLA 4FO9A 5EYAF 2QIZA 2H0DB 3O70A 3O36A 2L0BA 2L43A 3RTRB 2MNZA 1Z6UA 4L7XA 1WENA 3C5KA 1K2FA 2DX8A 2BAYA 2YT5A 5D1LB 2VJFA 5G04B
chains in the Genus database with same CATH superfamily
5G0FA 2CSVA 2ECJA 2KREA 2KWOA 5B8DA 3KQIA 5D1KB 2FFWA 4GNFA 4ZDTA 3N9PA 4S3OC 3U5PA 1FP0A 3O33A 4Z0RA 1N87A 3C6WA 4OGEA 5B78A 2DSMA 5I3LA 2KWKA 2CONA 3SHBA 1JM7A 2ECIA 4Z0OA 2DJAA 3U5MA 3HCSA 3O34A 1WIMA 5FB0A 2CRWA 2F42A 2KIZA 5TBNA 4N3WA 2KGGA 2Y1MA 2QICA 2G45A 3FJUB 2YW8A 1JOCA 2RSDA 4P5OB 1MM2A 4I7DA 3M62A 3PLWA 3ZNIA 1WGMA 2C2LA 3NG2A 2OXQC 4X3GA 5SVIA 1U6GB 2H0DA 1WEWA 3FAOA 3HTKC 3T9KA 3MDBC 4IC3A 2L75A 5TDWA 3KNVA 4AUQB 4R7EA 2L5UA 5K3QA 1G25A 2KKXA 4WZ0A 2M6MA 4FK5A 1CHCA 1Z2QA 2PUYA 4C9ZA 5FERA 2MT5A 2FUUA 5FEYA 3PURA 2KWNA 2LAUA 3FANA 2C2VS 5KH9A 5B75A 3LQIA 5D1MB 2K4DA 2EGMA 2XP0A 4WA6A 3ZYQA 4YADA 2MIQA 3N9LA 4AYCB 2M13A 1X4UA 3O7AA 4Q6FA 3KV5A 2MD7B 2UZGA 4YBSA 1HYJA 3L1XA 1VFYA 5AITA 2KR4A 2YURA 5DKAA 2ECNA 2LQ6A 3KDEC 2NAAA 4MSXA 2JM3A 3SOUA 4LJNA 2PNXA 4B7YC 1WEOA 1MM3A 4YAXA 1X4JA 3KV6A 5LKXA 2XB1A 3SOXA 4GNEA 5LKUA 3ZPV1 2YYRA 1WE9A 4R2YA 3H7HA 2YHNA 2M3HA 5B77A 2EODA 3PUQA 4V3LC 2MA5A 4LLBA 2YQMA 4CA1A 1WEPA 2MNYA 2XEUA 4PPEA 4YATA 5LKTA 3SOWA 4AVXA 1WEMA 4L58A 4A49A 4CCGX 5TRBA 5H1TA 2LV9A 1VD4A 4LK9A 3L11A 5LCWB 4PTBA 2M85A 5TDRA 2LXHC 2YUCA 2E6SA 2HYED 2YHOA 3E2DA 4V3KC 2ZETC 4YABA 3FEHA 4AYCA 3DDTA 4FJCA 5LKZA 1VYXA 4W4UA 1WESA 4FIPA 3T7LA 5B76A 3LQHA 2IDAA 4F1PA 4GNDA 3ASLA 2P57A 2YSMA 2F6JA 3GL6A 3LQJA 5SVYA 2EGPA 2Y1NA 2VPDA 4S3OB 3N9MA 2JMDA 2HDPA 4YC9A 3JUEA 2CSZA 3EB6A 3O37A 2CKLB 3IHPA 5SVXA 2YU4A 5JG6A 1X4IA 1F62A 2FD4A 1T1HA 1IYMA 5AIUA 1V87A 2QJ0A 2RI7A 4WZ2A 3DWDA 3V43A 2VJEB 2JMJA 4I7BA 2LGGA 4ZQLA 4MVTA 2LGKA 4B86C 4QF2A 4I7CA 2VP7A 3SUBA 1RMDA 2VPGA 3M99A 2XOCA 4OGCA 5FB1A 3EB5A 2D8UA 3MHHA 3MHSA 2E6RA 3RPGC 2ECTA 2VPBA 5H1UA 4UI9B 3HCTA 1WEEA 2L7PA 2G43A 3ZVZB 2CSYA 3DQVR 3FL2A 3FM8C 4A0CD 3T6RA 2E61A 4GB0A 3O47A 4R8PK 2IQJA 1WEVA 2G6QA 3HCUA 2ECGA 4LADB 5J3XA 2K16A 4GNGA 5C11A 2FUIA 2ECWA 4XI1A 2CRRA 2M1RA 4A4BA 4BBQA 1DCQA 2LGLA 4WZ3B 3U5NA 4BHWA 4N4FA 2I50A 1WEQA 4YBTA 2KGIA 1XWHA 3LDYA 2VPEA 2JUNA 2VJEA 3L1ZB 2KWJA 4IC2A 1DVPA 2YQLA 3ZTGA 4ZUXU 2XOYA 2MKEA 5C13A 1HYIA 2AN6A 3LRQA 1Z60A 3U5OA 2L80A 3QZVA 4LKAA 2KYUA 4O64A 3LJUX 4UP5A 3VK6A 5KH3A 4O62A 4A4CA 2KKYA 4NN2A 5TABA 1LDJB 5H9MA 4AP4A 3GV4A 2YREA 4QQ4A 1WEUA 2KU3A 3O35A 5DINA 4QF3A 2B0OE 2YSJA 2LGVA 2F6NA 2K17A 2LN0A 4YBMA 2KE1A 3N9NA 2EA6A 3PHDA 2LDRA 5G05B 5H1VA 4F52B 3I2DA 1BORA 2D8SA 4TKPB 3N9QA 2LXPC 2VJFB 5B79A 2KFTA 2FSAA 3LVRE 2MUMA 1ZBDB 3ZVYA 2YVRA 3M7KA 2VNFA 3N9OA 3Q1DA 4UP0A 2ECVA 2CT2A 2MA6A 1JM7B 1LDKC 2OWAA 3DPLR 1WILA 2EXUA 2Y43A 3LVQE 5KH7A 2LRIC 2JMIA 3RPGB 1WFKA 2K1JA 3M63A 1FBVA 3ZPVE 2MD8C 1E4UA 2JRJA 2CKLA 4FO9A 5EYAF 4H9DA 2QIZA 5SVIB 2H0DB 3O70A 3O36A 1MBMA 2L0BA 2L43A 3RTRB 2MNZA 1Z6UA 4L7XA 1WENA 3C5KA 1K2FA 2DX8A 2BAYA 2XOZA 2YT5A 5D1LB 2VJFA 2RR4A 5G04B
chains in the Genus database with same CATH topology
5G0FA 5B8DA 2ECJA 2KREA 2KWOA 3KQIA 5D1KB 4GNFA 4ZDTA 3N9PA 4S3OC 3U5PA 1FP0A 3O33A 1N87A 3C6WA 5B78A 5I3LA 2KWKA 3SHBA 1JM7A 2ECIA 3U5MA 3HCSA 3O34A 1WIMA 5FB0A 2F42A 2KIZA 5TBNA 4N3WA 2KGGA 2Y1MA 2QICA 2G45A 2YW8A 1JOCA 2RSDA 4P5OB 1MM2A 4I7DA 3M62A 3ZNIA 1WGMA 2C2LA 3NG2A 2OXQC 4X3GA 1U6GB 2H0DA 1WEWA 3HTKC 4IC3A 2L75A 5TDWA 3KNVA 4AUQB 4R7EA 2L5UA 1G25A 4WZ0A 2M6MA 4FK5A 1CHCA 1Z2QA 2PUYA 4C9ZA 5FERA 2MT5A 2FUUA 5FEYA 3PURA 2KWNA 2C2VS 5KH9A 5B75A 3LQIA 5D1MB 2K4DA 4WA6A 3ZYQA 4YADA 2MIQA 3N9LA 4AYCB 4Q6FA 1X4UA 3O7AA 3KV5A 2MD7B 2UZGA 4YBSA 1HYJA 3L1XA 1VFYA 5AITA 2KR4A 2YURA 5DKAA 2ECNA 2LQ6A 2NAAA 4MSXA 3SOUA 4LJNA 2PNXA 4B7YC 1WEOA 1MM3A 4YAXA 1X4JA 3KV6A 5LKXA 2XB1A 3SOXA 4GNEA 5LKUA 3ZPV1 2YYRA 1WE9A 4R2YA 2YHNA 2M3HA 5B77A 2EODA 3PUQA 4V3LC 2MA5A 4LLBA 2YQMA 4CA1A 1WEPA 2MNYA 2XEUA 4PPEA 4YATA 5LKTA 3SOWA 4AVXA 1WEMA 4L58A 4A49A 4CCGX 5TRBA 5H1TA 2LV9A 1VD4A 4LK9A 3L11A 5LCWB 4PTBA 2M85A 5TDRA 2LXHC 2YUCA 2E6SA 2HYED 2YHOA 4V3KC 2ZETC 4YABA 4AYCA 4FJCA 5LKZA 1VYXA 4W4UA 1WESA 4FIPA 3T7LA 5B76A 3LQHA 2IDAA 4GNDA 3ASLA 2YSMA 2F6JA 3GL6A 3LQJA 2EGPA 2Y1NA 2VPDA 4S3OB 3N9MA 2JMDA 2HDPA 4YC9A 2CSZA 3EB6A 3O37A 2CKLB 3IHPA 2YU4A 5JG6A 1X4IA 1F62A 1T1HA 1IYMA 5AIUA 1V87A 2QJ0A 2RI7A 4WZ2A 3V43A 2VJEB 2JMJA 4I7BA 2LGGA 4ZQLA 4MVTA 2LGKA 4B86C 4QF2A 4I7CA 2VP7A 1RMDA 2VPGA 3M99A 5FB1A 3EB5A 3MHHA 3MHSA 2E6RA 3RPGC 2ECTA 2VPBA 5H1UA 4UI9B 3HCTA 1WEEA 2G43A 3ZVZB 2CSYA 3DQVR 3FL2A 4A0CD 3T6RA 4GB0A 4R8PK 1WEVA 2G6QA 3HCUA 2ECGA 4LADB 5J3XA 2K16A 4GNGA 5C11A 2FUIA 2ECWA 4XI1A 2M1RA 4A4BA 4BBQA 2LGLA 4WZ3B 3U5NA 4BHWA 4N4FA 2I50A 1WEQA 4YBTA 2KGIA 1XWHA 2VPEA 2VJEA 3L1ZB 2KWJA 4IC2A 1DVPA 2YQLA 3ZTGA 4ZUXU 5C13A 1HYIA 2AN6A 3LRQA 1Z60A 3U5OA 2L80A 3QZVA 4LKAA 2KYUA 4O64A 4UP5A 3VK6A 5KH3A 4A4CA 4NN2A 5TABA 1LDJB 5H9MA 4AP4A 3GV4A 2YREA 1WEUA 2KU3A 3O35A 5DINA 4QF3A 2YSJA 2LGVA 2F6NA 2K17A 2LN0A 4YBMA 2KE1A 3N9NA 2EA6A 3PHDA 2LDRA 5G05B 5H1VA 4F52B 3I2DA 1BORA 2D8SA 4TKPB 3N9QA 2LXPC 2VJFB 5B79A 2KFTA 2FSAA 2MUMA 1ZBDB 3ZVYA 2VNFA 3N9OA 4UP0A 2ECVA 2CT2A 2MA6A 1JM7B 1LDKC 3DPLR 1WILA 2Y43A 5KH7A 2LRIC 2JMIA 3RPGB 1WFKA 2K1JA 3M63A 1FBVA 3ZPVE 2MD8C 1E4UA 2JRJA 2CKLA 4FO9A 5EYAF 2QIZA 2H0DB 3O70A 3O36A 2L0BA 2L43A 3RTRB 2MNZA 1Z6UA 4L7XA 1WENA 3C5KA 1K2FA 2DX8A 2BAYA 2YT5A 5D1LB 2VJFA 5G04B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G0F A;  5B8D A;  2ECJ A;  2KRE A;  2KWO A;  3KQI A;  5D1K B;  4GNF A;  4ZDT A;  3N9P A;  4S3O C;  3U5P A;  1FP0 A;  3O33 A;  1N87 A;  3C6W A;  5B78 A;  5I3L A;  2KWK A;  3SHB A;  1JM7 A;  2ECI A;  3U5M A;  3HCS A;  3O34 A;  1WIM A;  5FB0 A;  2F42 A;  2KIZ A;  5TBN A;  4N3W A;  2KGG A;  2Y1M A;  2QIC A;  2G45 A;  2YW8 A;  1JOC A;  2RSD A;  4P5O B;  1MM2 A;  4I7D A;  3M62 A;  3ZNI A;  1WGM A;  2C2L A;  3NG2 A;  2OXQ C;  4X3G A;  1U6G B;  2H0D A;  1WEW A;  3HTK C;  4IC3 A;  2L75 A;  5TDW A;  3KNV A;  4AUQ B;  4R7E A;  2L5U A;  1G25 A;  4WZ0 A;  2M6M A;  4FK5 A;  1CHC A;  1Z2Q A;  2PUY A;  4C9Z A;  5FER A;  2MT5 A;  2FUU A;  5FEY A;  3PUR A;  2KWN A;  2C2V S;  5KH9 A;  5B75 A;  3LQI A;  5D1M B;  2K4D A;  4WA6 A;  3ZYQ A;  4YAD A;  2MIQ A;  3N9L A;  4AYC B;  4Q6F A;  1X4U A;  3O7A A;  3KV5 A;  2MD7 B;  2UZG A;  4YBS A;  1HYJ A;  3L1X A;  1VFY A;  5AIT A;  2KR4 A;  2YUR A;  5DKA A;  2ECN A;  2LQ6 A;  2NAA A;  4MSX A;  3SOU A;  4LJN A;  2PNX A;  4B7Y C;  1WEO A;  1MM3 A;  4YAX A;  1X4J A;  3KV6 A;  5LKX A;  2XB1 A;  3SOX A;  4GNE A;  5LKU A;  3ZPV 1;  2YYR A;  1WE9 A;  4R2Y A;  2YHN A;  2M3H A;  5B77 A;  2EOD A;  3PUQ A;  4V3L C;  2MA5 A;  4LLB A;  2YQM A;  4CA1 A;  1WEP A;  2MNY A;  2XEU A;  4PPE A;  4YAT A;  5LKT A;  3SOW A;  4AVX A;  1WEM A;  4L58 A;  4A49 A;  4CCG X;  5TRB A;  5H1T A;  2LV9 A;  1VD4 A;  4LK9 A;  3L11 A;  5LCW B;  4PTB A;  2M85 A;  5TDR A;  2LXH C;  2YUC A;  2E6S A;  2HYE D;  2YHO A;  4V3K C;  2ZET C;  4YAB A;  4AYC A;  4FJC A;  5LKZ A;  1VYX A;  4W4U A;  1WES A;  4FIP A;  3T7L A;  5B76 A;  3LQH A;  2IDA A;  4GND A;  3ASL A;  2YSM A;  2F6J A;  3GL6 A;  3LQJ A;  2EGP A;  2Y1N A;  2VPD A;  4S3O B;  3N9M A;  2JMD A;  2HDP A;  4YC9 A;  2CSZ A;  3EB6 A;  3O37 A;  2CKL B;  3IHP A;  2YU4 A;  5JG6 A;  1X4I A;  1F62 A;  1T1H A;  1IYM A;  5AIU A;  1V87 A;  2QJ0 A;  2RI7 A;  4WZ2 A;  3V43 A;  2VJE B;  2JMJ A;  4I7B A;  2LGG A;  4ZQL A;  4MVT A;  2LGK A;  4B86 C;  4QF2 A;  4I7C A;  2VP7 A;  1RMD A;  2VPG A;  3M99 A;  5FB1 A;  3EB5 A;  3MHH A;  3MHS A;  2E6R A;  3RPG C;  2ECT A;  2VPB A;  5H1U A;  4UI9 B;  3HCT A;  1WEE A;  2G43 A;  3ZVZ B;  2CSY A;  3DQV R;  3FL2 A;  4A0C D;  3T6R A;  4GB0 A;  4R8P K;  1WEV A;  2G6Q A;  3HCU A;  2ECG A;  4LAD B;  5J3X A;  2K16 A;  4GNG A;  5C11 A;  2FUI A;  2ECW A;  4XI1 A;  2M1R A;  4A4B A;  4BBQ A;  2LGL A;  4WZ3 B;  3U5N A;  4BHW A;  4N4F A;  2I50 A;  1WEQ A;  4YBT A;  2KGI A;  1XWH A;  2VPE A;  2VJE A;  3L1Z B;  2KWJ A;  4IC2 A;  1DVP A;  2YQL A;  3ZTG A;  4ZUX U;  5C13 A;  1HYI A;  2AN6 A;  3LRQ A;  1Z60 A;  3U5O A;  2L80 A;  3QZV A;  4LKA A;  2KYU A;  4O64 A;  4UP5 A;  3VK6 A;  5KH3 A;  4A4C A;  4NN2 A;  5TAB A;  1LDJ B;  5H9M A;  4AP4 A;  3GV4 A;  2YRE A;  1WEU A;  2KU3 A;  3O35 A;  5DIN A;  4QF3 A;  2YSJ A;  2LGV A;  2F6N A;  2K17 A;  2LN0 A;  4YBM A;  2KE1 A;  3N9N A;  2EA6 A;  3PHD A;  2LDR A;  5G05 B;  5H1V A;  4F52 B;  3I2D A;  1BOR A;  2D8S A;  4TKP B;  3N9Q A;  2LXP C;  2VJF B;  5B79 A;  2KFT A;  2FSA A;  2MUM A;  1ZBD B;  3ZVY A;  2VNF A;  3N9O A;  4UP0 A;  2ECV A;  2CT2 A;  2MA6 A;  1JM7 B;  1LDK C;  3DPL R;  1WIL A;  2Y43 A;  5KH7 A;  2LRI C;  2JMI A;  3RPG B;  1WFK A;  2K1J A;  3M63 A;  1FBV A;  3ZPV E;  2MD8 C;  1E4U A;  2JRJ A;  2CKL A;  4FO9 A;  5EYA F;  2QIZ A;  2H0D B;  3O70 A;  3O36 A;  2L0B A;  2L43 A;  3RTR B;  2MNZ A;  1Z6U A;  4L7X A;  1WEN A;  3C5K A;  1K2F A;  2DX8 A;  2BAY A;  2YT5 A;  5D1L B;  2VJF A;  5G04 B; 
#chains in the Genus database with same CATH topology
 5G0F A;  2CSV A;  2ECJ A;  2KRE A;  2KWO A;  5B8D A;  3KQI A;  5D1K B;  2FFW A;  4GNF A;  4ZDT A;  3N9P A;  4S3O C;  3U5P A;  1FP0 A;  3O33 A;  4Z0R A;  1N87 A;  3C6W A;  4OGE A;  5B78 A;  2DSM A;  5I3L A;  2KWK A;  2CON A;  3SHB A;  1JM7 A;  2ECI A;  4Z0O A;  2DJA A;  3U5M A;  3HCS A;  3O34 A;  1WIM A;  5FB0 A;  2CRW A;  2F42 A;  2KIZ A;  5TBN A;  4N3W A;  2KGG A;  2Y1M A;  2QIC A;  2G45 A;  3FJU B;  2YW8 A;  1JOC A;  2RSD A;  4P5O B;  1MM2 A;  4I7D A;  3M62 A;  3PLW A;  3ZNI A;  1WGM A;  2C2L A;  3NG2 A;  2OXQ C;  4X3G A;  5SVI A;  1U6G B;  2H0D A;  1WEW A;  3FAO A;  3HTK C;  3T9K A;  3MDB C;  4IC3 A;  2L75 A;  5TDW A;  3KNV A;  4AUQ B;  4R7E A;  2L5U A;  5K3Q A;  1G25 A;  2KKX A;  4WZ0 A;  2M6M A;  4FK5 A;  1CHC A;  1Z2Q A;  2PUY A;  4C9Z A;  5FER A;  2MT5 A;  2FUU A;  5FEY A;  3PUR A;  2KWN A;  2LAU A;  3FAN A;  2C2V S;  5KH9 A;  5B75 A;  3LQI A;  5D1M B;  2K4D A;  2EGM A;  2XP0 A;  4WA6 A;  3ZYQ A;  4YAD A;  2MIQ A;  3N9L A;  4AYC B;  2M13 A;  1X4U A;  3O7A A;  4Q6F A;  3KV5 A;  2MD7 B;  2UZG A;  4YBS A;  1HYJ A;  3L1X A;  1VFY A;  5AIT A;  2KR4 A;  2YUR A;  5DKA A;  2ECN A;  2LQ6 A;  3KDE C;  2NAA A;  4MSX A;  2JM3 A;  3SOU A;  4LJN A;  2PNX A;  4B7Y C;  1WEO A;  1MM3 A;  4YAX A;  1X4J A;  3KV6 A;  5LKX A;  2XB1 A;  3SOX A;  4GNE A;  5LKU A;  3ZPV 1;  2YYR A;  1WE9 A;  4R2Y A;  3H7H A;  2YHN A;  2M3H A;  5B77 A;  2EOD A;  3PUQ A;  4V3L C;  2MA5 A;  4LLB A;  2YQM A;  4CA1 A;  1WEP A;  2MNY A;  2XEU A;  4PPE A;  4YAT A;  5LKT A;  3SOW A;  4AVX A;  1WEM A;  4L58 A;  4A49 A;  4CCG X;  5TRB A;  5H1T A;  2LV9 A;  1VD4 A;  4LK9 A;  3L11 A;  5LCW B;  4PTB A;  2M85 A;  5TDR A;  2LXH C;  2YUC A;  2E6S A;  2HYE D;  2YHO A;  3E2D A;  4V3K C;  2ZET C;  4YAB A;  3FEH A;  4AYC A;  3DDT A;  4FJC A;  5LKZ A;  1VYX A;  4W4U A;  1WES A;  4FIP A;  3T7L A;  5B76 A;  3LQH A;  2IDA A;  4F1P A;  4GND A;  3ASL A;  2P57 A;  2YSM A;  2F6J A;  3GL6 A;  3LQJ A;  5SVY A;  2EGP A;  2Y1N A;  2VPD A;  4S3O B;  3N9M A;  2JMD A;  2HDP A;  4YC9 A;  3JUE A;  2CSZ A;  3EB6 A;  3O37 A;  2CKL B;  3IHP A;  5SVX A;  2YU4 A;  5JG6 A;  1X4I A;  1F62 A;  2FD4 A;  1T1H A;  1IYM A;  5AIU A;  1V87 A;  2QJ0 A;  2RI7 A;  4WZ2 A;  3DWD A;  3V43 A;  2VJE B;  2JMJ A;  4I7B A;  2LGG A;  4ZQL A;  4MVT A;  2LGK A;  4B86 C;  4QF2 A;  4I7C A;  2VP7 A;  3SUB A;  1RMD A;  2VPG A;  3M99 A;  2XOC A;  4OGC A;  5FB1 A;  3EB5 A;  2D8U A;  3MHH A;  3MHS A;  2E6R A;  3RPG C;  2ECT A;  2VPB A;  5H1U A;  4UI9 B;  3HCT A;  1WEE A;  2L7P A;  2G43 A;  3ZVZ B;  2CSY A;  3DQV R;  3FL2 A;  3FM8 C;  4A0C D;  3T6R A;  2E61 A;  4GB0 A;  3O47 A;  4R8P K;  2IQJ A;  1WEV A;  2G6Q A;  3HCU A;  2ECG A;  4LAD B;  5J3X A;  2K16 A;  4GNG A;  5C11 A;  2FUI A;  2ECW A;  4XI1 A;  2CRR A;  2M1R A;  4A4B A;  4BBQ A;  1DCQ A;  2LGL A;  4WZ3 B;  3U5N A;  4BHW A;  4N4F A;  2I50 A;  1WEQ A;  4YBT A;  2KGI A;  1XWH A;  3LDY A;  2VPE A;  2JUN A;  2VJE A;  3L1Z B;  2KWJ A;  4IC2 A;  1DVP A;  2YQL A;  3ZTG A;  4ZUX U;  2XOY A;  2MKE A;  5C13 A;  1HYI A;  2AN6 A;  3LRQ A;  1Z60 A;  3U5O A;  2L80 A;  3QZV A;  4LKA A;  2KYU A;  4O64 A;  3LJU X;  4UP5 A;  3VK6 A;  5KH3 A;  4O62 A;  4A4C A;  2KKY A;  4NN2 A;  5TAB A;  1LDJ B;  5H9M A;  4AP4 A;  3GV4 A;  2YRE A;  4QQ4 A;  1WEU A;  2KU3 A;  3O35 A;  5DIN A;  4QF3 A;  2B0O E;  2YSJ A;  2LGV A;  2F6N A;  2K17 A;  2LN0 A;  4YBM A;  2KE1 A;  3N9N A;  2EA6 A;  3PHD A;  2LDR A;  5G05 B;  5H1V A;  4F52 B;  3I2D A;  1BOR A;  2D8S A;  4TKP B;  3N9Q A;  2LXP C;  2VJF B;  5B79 A;  2KFT A;  2FSA A;  3LVR E;  2MUM A;  1ZBD B;  3ZVY A;  2YVR A;  3M7K A;  2VNF A;  3N9O A;  3Q1D A;  4UP0 A;  2ECV A;  2CT2 A;  2MA6 A;  1JM7 B;  1LDK C;  2OWA A;  3DPL R;  1WIL A;  2EXU A;  2Y43 A;  3LVQ E;  5KH7 A;  2LRI C;  2JMI A;  3RPG B;  1WFK A;  2K1J A;  3M63 A;  1FBV A;  3ZPV E;  2MD8 C;  1E4U A;  2JRJ A;  2CKL A;  4FO9 A;  5EYA F;  4H9D A;  2QIZ A;  5SVI B;  2H0D B;  3O70 A;  3O36 A;  1MBM A;  2L0B A;  2L43 A;  3RTR B;  2MNZ A;  1Z6U A;  4L7X A;  1WEN A;  3C5K A;  1K2F A;  2DX8 A;  2BAY A;  2XOZ A;  2YT5 A;  5D1L B;  2VJF A;  2RR4 A;  5G04 B; 
#chains in the Genus database with same CATH homology
 5G0F A;  5B8D A;  2ECJ A;  2KRE A;  2KWO A;  3KQI A;  5D1K B;  4GNF A;  4ZDT A;  3N9P A;  4S3O C;  3U5P A;  1FP0 A;  3O33 A;  1N87 A;  3C6W A;  5B78 A;  5I3L A;  2KWK A;  3SHB A;  1JM7 A;  2ECI A;  3U5M A;  3HCS A;  3O34 A;  1WIM A;  5FB0 A;  2F42 A;  2KIZ A;  5TBN A;  4N3W A;  2KGG A;  2Y1M A;  2QIC A;  2G45 A;  2YW8 A;  1JOC A;  2RSD A;  4P5O B;  1MM2 A;  4I7D A;  3M62 A;  3ZNI A;  1WGM A;  2C2L A;  3NG2 A;  2OXQ C;  4X3G A;  1U6G B;  2H0D A;  1WEW A;  3HTK C;  4IC3 A;  2L75 A;  5TDW A;  3KNV A;  4AUQ B;  4R7E A;  2L5U A;  1G25 A;  4WZ0 A;  2M6M A;  4FK5 A;  1CHC A;  1Z2Q A;  2PUY A;  4C9Z A;  5FER A;  2MT5 A;  2FUU A;  5FEY A;  3PUR A;  2KWN A;  2C2V S;  5KH9 A;  5B75 A;  3LQI A;  5D1M B;  2K4D A;  4WA6 A;  3ZYQ A;  4YAD A;  2MIQ A;  3N9L A;  4AYC B;  4Q6F A;  1X4U A;  3O7A A;  3KV5 A;  2MD7 B;  2UZG A;  4YBS A;  1HYJ A;  3L1X A;  1VFY A;  5AIT A;  2KR4 A;  2YUR A;  5DKA A;  2ECN A;  2LQ6 A;  2NAA A;  4MSX A;  3SOU A;  4LJN A;  2PNX A;  4B7Y C;  1WEO A;  1MM3 A;  4YAX A;  1X4J A;  3KV6 A;  5LKX A;  2XB1 A;  3SOX A;  4GNE A;  5LKU A;  3ZPV 1;  2YYR A;  1WE9 A;  4R2Y A;  2YHN A;  2M3H A;  5B77 A;  2EOD A;  3PUQ A;  4V3L C;  2MA5 A;  4LLB A;  2YQM A;  4CA1 A;  1WEP A;  2MNY A;  2XEU A;  4PPE A;  4YAT A;  5LKT A;  3SOW A;  4AVX A;  1WEM A;  4L58 A;  4A49 A;  4CCG X;  5TRB A;  5H1T A;  2LV9 A;  1VD4 A;  4LK9 A;  3L11 A;  5LCW B;  4PTB A;  2M85 A;  5TDR A;  2LXH C;  2YUC A;  2E6S A;  2HYE D;  2YHO A;  4V3K C;  2ZET C;  4YAB A;  4AYC A;  4FJC A;  5LKZ A;  1VYX A;  4W4U A;  1WES A;  4FIP A;  3T7L A;  5B76 A;  3LQH A;  2IDA A;  4GND A;  3ASL A;  2YSM A;  2F6J A;  3GL6 A;  3LQJ A;  2EGP A;  2Y1N A;  2VPD A;  4S3O B;  3N9M A;  2JMD A;  2HDP A;  4YC9 A;  2CSZ A;  3EB6 A;  3O37 A;  2CKL B;  3IHP A;  2YU4 A;  5JG6 A;  1X4I A;  1F62 A;  1T1H A;  1IYM A;  5AIU A;  1V87 A;  2QJ0 A;  2RI7 A;  4WZ2 A;  3V43 A;  2VJE B;  2JMJ A;  4I7B A;  2LGG A;  4ZQL A;  4MVT A;  2LGK A;  4B86 C;  4QF2 A;  4I7C A;  2VP7 A;  1RMD A;  2VPG A;  3M99 A;  5FB1 A;  3EB5 A;  3MHH A;  3MHS A;  2E6R A;  3RPG C;  2ECT A;  2VPB A;  5H1U A;  4UI9 B;  3HCT A;  1WEE A;  2G43 A;  3ZVZ B;  2CSY A;  3DQV R;  3FL2 A;  4A0C D;  3T6R A;  4GB0 A;  4R8P K;  1WEV A;  2G6Q A;  3HCU A;  2ECG A;  4LAD B;  5J3X A;  2K16 A;  4GNG A;  5C11 A;  2FUI A;  2ECW A;  4XI1 A;  2M1R A;  4A4B A;  4BBQ A;  2LGL A;  4WZ3 B;  3U5N A;  4BHW A;  4N4F A;  2I50 A;  1WEQ A;  4YBT A;  2KGI A;  1XWH A;  2VPE A;  2VJE A;  3L1Z B;  2KWJ A;  4IC2 A;  1DVP A;  2YQL A;  3ZTG A;  4ZUX U;  5C13 A;  1HYI A;  2AN6 A;  3LRQ A;  1Z60 A;  3U5O A;  2L80 A;  3QZV A;  4LKA A;  2KYU A;  4O64 A;  4UP5 A;  3VK6 A;  5KH3 A;  4A4C A;  4NN2 A;  5TAB A;  1LDJ B;  5H9M A;  4AP4 A;  3GV4 A;  2YRE A;  1WEU A;  2KU3 A;  3O35 A;  5DIN A;  4QF3 A;  2YSJ A;  2LGV A;  2F6N A;  2K17 A;  2LN0 A;  4YBM A;  2KE1 A;  3N9N A;  2EA6 A;  3PHD A;  2LDR A;  5G05 B;  5H1V A;  4F52 B;  3I2D A;  1BOR A;  2D8S A;  4TKP B;  3N9Q A;  2LXP C;  2VJF B;  5B79 A;  2KFT A;  2FSA A;  2MUM A;  1ZBD B;  3ZVY A;  2VNF A;  3N9O A;  4UP0 A;  2ECV A;  2CT2 A;  2MA6 A;  1JM7 B;  1LDK C;  3DPL R;  1WIL A;  2Y43 A;  5KH7 A;  2LRI C;  2JMI A;  3RPG B;  1WFK A;  2K1J A;  3M63 A;  1FBV A;  3ZPV E;  2MD8 C;  1E4U A;  2JRJ A;  2CKL A;  4FO9 A;  5EYA F;  2QIZ A;  2H0D B;  3O70 A;  3O36 A;  2L0B A;  2L43 A;  3RTR B;  2MNZ A;  1Z6U A;  4L7X A;  1WEN A;  3C5K A;  1K2F A;  2DX8 A;  2BAY A;  2YT5 A;  5D1L B;  2VJF A;  5G04 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...