4BBQA

Crystal structure of the cxxc and phd domain of human lysine-specific demethylase 2a (kdm2a)(fbxl11)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
111
structure length
111
Chain Sequence
MRRVRCRKCKACVQGECGVCHYCRDMKKFGGPGRMKQSCVLRQCLAPRLPHSVTCSLCGEVDQNEETQDFEKKLMECCICNEIVHPGCLQMDGEGLLNEELPNCWECPKCY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LYSINE-SPECIFIC DEMETHYLASE 2A
publication title Crystal Structure of the Cxxc and Phd Domain of Human Lysine-Specific Demethylase 2A (Kdm2A)(Fbxl11)
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 19
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16866 PHD_4 PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4bbqA01
1WEMA 5EYAF 1Z2QA 3ZVYA 2ECTA 5TDRA 4R7EA 3LQHA 2PNXA 5C13A 2F6NA 2YSMA 4YC9A 5TRBA 3T6RA 2KWNA 4WZ3B 4IC3A 3U5PA 2CT2A 1MM3A 2G45A 4QF3A 4UP0A 3U5MA 3HCUA 2AN6A 2FSAA 1K2FA 3HCTA 2MIQA 5TDWA 4PPEA 4L58A 4LADB 3O37A 3U5OA 3LQIA 4MVTA 2F42A 5LCWB 2VJFB 3M62A 2M3HA 3SOUA 5D1KB 5JG6A 3N9MA 1ZBDB 2G43A 1V87A 2VJFA 2K1JA 4CA1A 1RMDA 3O33A 1WIMA 3N9NA 5H1TA 2VPBA 2EODA 1F62A 1LDJB 2L0BA 3O70A 3N9LA 5H1VA 3HTKC 2KE1A 4A4CA 3KV6A 2L75A 4P5OB 4N4FA 3DQVR 2XB1A 3N9PA 3NG2A 4FO9A 5KH3A 2KYUA 1HYIA 2YREA 2ECVA 4FIPA 2E6RA 2LQ6A 3I2DA 5I3LA 2IDAA 5B8DA 4V3LC 3T7LA 2K4DA 4UI9B 5LKTA 2E6SA 2LRIC 2QJ0A 1FP0A 2DX8A 3O35A 1WEWA 4LK9A 3HCSA 2QIZA 2FUUA 4UP5A 4LJNA 5DKAA 5B76A 5FB0A 3L1ZB 2KWJA 5AITA 1XWHA 2M85A 5LKUA 2C2VS 3PUQA 3SHBA 3O36A 4MSXA 4ZDTA 4YADA 3ZNIA 3IHPA 5D1MB 5H1UA 4F52B 2LXPC 2VJEB 4FJCA 2VPEA 1JM7B 2KGGA 4XI1A 2HYED 5D1LB 1HYJA 4Q6FA 2ZETC 2HDPA 3ZTGA 2YHNA 1WFKA 2VJEA 4C9ZA 3MHSA 2YYRA 1JM7A 2KWOA 4GB0A 4PTBA 1WEVA 2L5UA 3SOXA 2MA5A 4YATA 4NN2A 4QF2A 4A4BA 3MHHA 3DPLR 2MA6A 1WEOA 3C5KA 5B75A 1VFYA 2VNFA 3GL6A 3ZPVE 4TKPB 5C11A 4AP4A 3RPGB 5AIUA 2CKLB 3N9QA 1N87A 4I7DA 1X4UA 2LGVA 2CKLA 1MM2A 5H9MA 2OXQC 3QZVA 4YAXA 1X4JA 1WE9A 4YABA 1CHCA 3M63A 4B86C 2K16A 3L1XA 5B77A 1Z6UA 4AVXA 4L7XA 2CSYA 2PUYA 2L80A 1JOCA 1VD4A 4B7YC 4GNEA 4YBSA 2FUIA 2ECNA 2LV9A 3GV4A 2RSDA 4X3GA 5TBNA 3PHDA 3ZPV1 2LDRA 2KFTA 4O64A 2YHOA 3RPGC 5KH7A 1FBVA 4W4UA 2MD8C 4R2YA 4WZ0A 1Z60A 2MT5A 4ZUXU 2JMDA 2LN0A 5FERA 2EA6A 2UZGA 2ECIA 5B78A 4I7CA 2YUCA 3ZYQA 4WZ2A 2KREA 2YW8A 1WEUA 2MNYA 2K17A 1WENA 3PURA 1WESA 5FEYA 2C2LA 2M6MA 4BBQA 1WEPA 2KU3A 2D8SA 5FB1A 2MD7B 4LKAA 2ECGA 2I50A 4A0CD 2YQMA 3SOWA 4A49A 2QICA 2ECJA 3N9OA 2Y1MA 3LQJA 4ZQLA 3KNVA 2KR4A 4WA6A 1X4IA 3L11A 5J3XA 3ZVZB 1E4UA 3EB5A 3U5NA 1LDKC 5B79A 2Y43A 5G05B 3RTRB 3EB6A 4AYCB 1IYMA 2KWKA 2JMIA 4AYCA 2BAYA 5DINA 4GNFA 4V3KC 4S3OC 4YBMA 4CCGX 2ECWA 2JMJA 3O34A 4R8PK 5LKXA 2LGLA 4I7BA 2H0DB 2F6JA 2VP7A 2G6QA 2NAAA 4N3WA 3ASLA 2JRJA 4GNDA 3M99A 3VK6A 2H0DA 2M1RA 4FK5A 2RI7A 1U6GB 2MUMA 5G0FA 3V43A 2YU4A 4GNGA 3FL2A 2VPDA 1WILA 4BHWA 1DVPA 4YBTA 1WEEA 2LGKA 2LGGA 2L43A 1T1HA 5LKZA 2CSZA 2YSJA 3KQIA 4IC2A 1BORA 5TABA 2MNZA 1VYXA 2YQLA 1WEQA 1G25A 2YT5A 2YURA 3C6WA 3KV5A 5G04B 3LRQA 1WGMA 4AUQB 2KIZA 4LLBA 5KH9A 3O7AA 2XEUA 4S3OB 2LXHC 2Y1NA 2VPGA 2KGIA 2EGPA
chains in the Genus database with same CATH superfamily
1WEMA 3M7KA 5EYAF 1Z2QA 3ZVYA 2ECTA 5TDRA 4R7EA 3LQHA 2PNXA 5C13A 2F6NA 2YSMA 4YC9A 5TRBA 3T6RA 2KWNA 4WZ3B 4IC3A 3U5PA 2CT2A 1MM3A 2G45A 4QF3A 4UP0A 3U5MA 3HCUA 2AN6A 2FSAA 1K2FA 3HCTA 2MIQA 5TDWA 4PPEA 4L58A 4LADB 3O37A 3U5OA 3LQIA 4MVTA 2IQJA 2F42A 5LCWB 2VJFB 3M62A 2M3HA 4QQ4A 3SOUA 5D1KB 5JG6A 3N9MA 1ZBDB 2G43A 1V87A 2VJFA 2K1JA 4CA1A 1RMDA 3O33A 1WIMA 3N9NA 5H1TA 2VPBA 2EODA 1F62A 1LDJB 2L0BA 3O70A 3N9LA 5H1VA 3HTKC 2KE1A 4A4CA 3KV6A 2L75A 4P5OB 4N4FA 3DQVR 2XB1A 3N9PA 3NG2A 4FO9A 5KH3A 2KYUA 1HYIA 2EGMA 2YREA 2ECVA 4FIPA 2E6RA 2LQ6A 3I2DA 5I3LA 2IDAA 5B8DA 4V3LC 3T7LA 2K4DA 4UI9B 5LKTA 2E6SA 2LRIC 2QJ0A 1FP0A 2DX8A 3O35A 1WEWA 4LK9A 3HCSA 2QIZA 2FUUA 2CSVA 4UP5A 4LJNA 5DKAA 5B76A 5FB0A 3L1ZB 2KWJA 5AITA 1XWHA 3FM8C 3FEHA 2M85A 2MKEA 2JUNA 5LKUA 2C2VS 2DSMA 3PUQA 3SHBA 3O36A 4MSXA 4ZDTA 4YADA 3ZNIA 2YVRA 3IHPA 5D1MB 5H1UA 4F52B 2LXPC 2VJEB 4FJCA 2CRWA 2VPEA 2D8UA 1JM7B 1DCQA 2KGGA 4XI1A 2HYED 5D1LB 1HYJA 2RR4A 2ZETC 2HDPA 4Q6FA 3ZTGA 2YHNA 1WFKA 2VJEA 4C9ZA 3MHSA 2YYRA 3T9KA 1JM7A 2KWOA 4GB0A 4PTBA 1WEVA 2L5UA 3H7HA 3SOXA 2MA5A 4YATA 4NN2A 4QF2A 4A4BA 3MHHA 3DPLR 2MA6A 1WEOA 3C5KA 5B75A 1VFYA 2VNFA 3GL6A 3ZPVE 4TKPB 5C11A 2CRRA 4AP4A 3RPGB 5AIUA 2CKLB 3N9QA 1N87A 4I7DA 1X4UA 2LGVA 2CKLA 2FFWA 1MM2A 5H9MA 2OXQC 3QZVA 2DJAA 4YAXA 1X4JA 1WE9A 4YABA 1CHCA 3M63A 4B86C 2K16A 1MBMA 3L1XA 5B77A 1Z6UA 4AVXA 4L7XA 2LAUA 2CSYA 2PUYA 2L80A 3MDBC 1JOCA 1VD4A 2FD4A 2M13A 3JUEA 4B7YC 4GNEA 5SVIB 4YBSA 2FUIA 2ECNA 2B0OE 2LV9A 5SVIA 3GV4A 2RSDA 3E2DA 4X3GA 4F1PA 5TBNA 3PHDA 3ZPV1 2LDRA 2KFTA 4O64A 2YHOA 3RPGC 5KH7A 1FBVA 4W4UA 2MD8C 4R2YA 4WZ0A 1Z60A 3FAOA 2MT5A 3SUBA 4ZUXU 2JMDA 2LN0A 5FERA 2EA6A 2UZGA 2ECIA 5B78A 3KDEC 4I7CA 5SVYA 2YUCA 3ZYQA 4WZ2A 2XOCA 3FJUB 2KREA 2YW8A 1WEUA 2MNYA 4O62A 2K17A 3O47A 1WENA 3PURA 1WESA 2JM3A 5FEYA 2KKXA 2C2LA 2M6MA 4BBQA 1WEPA 2KU3A 2D8SA 5FB1A 2MD7B 4LKAA 2ECGA 2I50A 4A0CD 3LVQE 2YQMA 4H9DA 3SOWA 4A49A 2QICA 2ECJA 3N9OA 2Y1MA 3LQJA 2L7PA 4ZQLA 3KNVA 2KR4A 4WA6A 1X4IA 3L11A 5J3XA 3ZVZB 1E4UA 4Z0RA 3Q1DA 3EB5A 3U5NA 4OGEA 1LDKC 5B79A 2Y43A 2EXUA 3DWDA 5G05B 3RTRB 3EB6A 2E61A 4AYCB 1IYMA 2KWKA 3LDYA 2JMIA 3LVRE 4Z0OA 4AYCA 2BAYA 5DINA 4GNFA 4V3KC 4S3OC 4YBMA 4CCGX 2ECWA 2JMJA 3O34A 4R8PK 5LKXA 3LJUX 2LGLA 4I7BA 2H0DB 2F6JA 2VP7A 2G6QA 2NAAA 3FANA 4N3WA 2P57A 3ASLA 2JRJA 4GNDA 3M99A 3VK6A 2H0DA 2M1RA 4FK5A 2RI7A 1U6GB 2MUMA 5G0FA 3V43A 2KKYA 3DDTA 2YU4A 4GNGA 3FL2A 2VPDA 1WILA 4BHWA 1DVPA 4YBTA 4OGCA 1WEEA 2LGKA 2LGGA 2L43A 1T1HA 5LKZA 2CSZA 2YSJA 3KQIA 4IC2A 1BORA 2MNZA 5TABA 1VYXA 2YQLA 1WEQA 2XOZA 1G25A 2OWAA 5SVXA 2YT5A 2XOYA 2YURA 3C6WA 3KV5A 5G04B 3LRQA 2CONA 2XP0A 1WGMA 4AUQB 2KIZA 4LLBA 5K3QA 5KH9A 3O7AA 2XEUA 3PLWA 4S3OB 2LXHC 2Y1NA 2VPGA 2KGIA 2EGPA
chains in the Genus database with same CATH topology
1WEMA 5EYAF 1Z2QA 3ZVYA 2ECTA 5TDRA 4R7EA 3LQHA 2PNXA 5C13A 2F6NA 2YSMA 4YC9A 5TRBA 3T6RA 2KWNA 4WZ3B 4IC3A 3U5PA 2CT2A 1MM3A 2G45A 4QF3A 4UP0A 3U5MA 3HCUA 2AN6A 2FSAA 1K2FA 3HCTA 2MIQA 5TDWA 4PPEA 4L58A 4LADB 3O37A 3U5OA 3LQIA 4MVTA 2F42A 5LCWB 2VJFB 3M62A 2M3HA 3SOUA 5D1KB 5JG6A 3N9MA 1ZBDB 2G43A 1V87A 2VJFA 2K1JA 4CA1A 1RMDA 3O33A 1WIMA 3N9NA 5H1TA 2VPBA 2EODA 1F62A 1LDJB 2L0BA 3O70A 3N9LA 5H1VA 3HTKC 2KE1A 4A4CA 3KV6A 2L75A 4P5OB 4N4FA 3DQVR 2XB1A 3N9PA 3NG2A 4FO9A 5KH3A 2KYUA 1HYIA 2YREA 2ECVA 4FIPA 2E6RA 2LQ6A 3I2DA 5I3LA 2IDAA 5B8DA 4V3LC 3T7LA 2K4DA 4UI9B 5LKTA 2E6SA 2LRIC 2QJ0A 1FP0A 2DX8A 3O35A 1WEWA 4LK9A 3HCSA 2QIZA 2FUUA 4UP5A 4LJNA 5DKAA 5B76A 5FB0A 3L1ZB 2KWJA 5AITA 1XWHA 2M85A 5LKUA 2C2VS 3PUQA 3SHBA 3O36A 4MSXA 4ZDTA 4YADA 3ZNIA 3IHPA 5D1MB 5H1UA 4F52B 2LXPC 2VJEB 4FJCA 2VPEA 1JM7B 2KGGA 4XI1A 2HYED 5D1LB 1HYJA 4Q6FA 2ZETC 2HDPA 3ZTGA 2YHNA 1WFKA 2VJEA 4C9ZA 3MHSA 2YYRA 1JM7A 2KWOA 4GB0A 4PTBA 1WEVA 2L5UA 3SOXA 2MA5A 4YATA 4NN2A 4QF2A 4A4BA 3MHHA 3DPLR 2MA6A 1WEOA 3C5KA 5B75A 1VFYA 2VNFA 3GL6A 3ZPVE 4TKPB 5C11A 4AP4A 3RPGB 5AIUA 2CKLB 3N9QA 1N87A 4I7DA 1X4UA 2LGVA 2CKLA 1MM2A 5H9MA 2OXQC 3QZVA 4YAXA 1X4JA 1WE9A 4YABA 1CHCA 3M63A 4B86C 2K16A 3L1XA 5B77A 1Z6UA 4AVXA 4L7XA 2CSYA 2PUYA 2L80A 1JOCA 1VD4A 4B7YC 4GNEA 4YBSA 2FUIA 2ECNA 2LV9A 3GV4A 2RSDA 4X3GA 5TBNA 3PHDA 3ZPV1 2LDRA 2KFTA 4O64A 2YHOA 3RPGC 5KH7A 1FBVA 4W4UA 2MD8C 4R2YA 4WZ0A 1Z60A 2MT5A 4ZUXU 2JMDA 2LN0A 5FERA 2EA6A 2UZGA 2ECIA 5B78A 4I7CA 2YUCA 3ZYQA 4WZ2A 2KREA 2YW8A 1WEUA 2MNYA 2K17A 1WENA 3PURA 1WESA 5FEYA 2C2LA 2M6MA 4BBQA 1WEPA 2KU3A 2D8SA 5FB1A 2MD7B 4LKAA 2ECGA 2I50A 4A0CD 2YQMA 3SOWA 4A49A 2QICA 2ECJA 3N9OA 2Y1MA 3LQJA 4ZQLA 3KNVA 2KR4A 4WA6A 1X4IA 3L11A 5J3XA 3ZVZB 1E4UA 3EB5A 3U5NA 1LDKC 5B79A 2Y43A 5G05B 3RTRB 3EB6A 4AYCB 1IYMA 2KWKA 2JMIA 4AYCA 2BAYA 5DINA 4GNFA 4V3KC 4S3OC 4YBMA 4CCGX 2ECWA 2JMJA 3O34A 4R8PK 5LKXA 2LGLA 4I7BA 2H0DB 2F6JA 2VP7A 2G6QA 2NAAA 4N3WA 3ASLA 2JRJA 4GNDA 3M99A 3VK6A 2H0DA 2M1RA 4FK5A 2RI7A 1U6GB 2MUMA 5G0FA 3V43A 2YU4A 4GNGA 3FL2A 2VPDA 1WILA 4BHWA 1DVPA 4YBTA 1WEEA 2LGKA 2LGGA 2L43A 1T1HA 5LKZA 2CSZA 2YSJA 3KQIA 4IC2A 1BORA 5TABA 2MNZA 1VYXA 2YQLA 1WEQA 1G25A 2YT5A 2YURA 3C6WA 3KV5A 5G04B 3LRQA 1WGMA 4AUQB 2KIZA 4LLBA 5KH9A 3O7AA 2XEUA 4S3OB 2LXHC 2Y1NA 2VPGA 2KGIA 2EGPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WEM A;  5EYA F;  1Z2Q A;  3ZVY A;  2ECT A;  5TDR A;  4R7E A;  3LQH A;  2PNX A;  5C13 A;  2F6N A;  2YSM A;  4YC9 A;  5TRB A;  3T6R A;  2KWN A;  4WZ3 B;  4IC3 A;  3U5P A;  2CT2 A;  1MM3 A;  2G45 A;  4QF3 A;  4UP0 A;  3U5M A;  3HCU A;  2AN6 A;  2FSA A;  1K2F A;  3HCT A;  2MIQ A;  5TDW A;  4PPE A;  4L58 A;  4LAD B;  3O37 A;  3U5O A;  3LQI A;  4MVT A;  2F42 A;  5LCW B;  2VJF B;  3M62 A;  2M3H A;  3SOU A;  5D1K B;  5JG6 A;  3N9M A;  1ZBD B;  2G43 A;  1V87 A;  2VJF A;  2K1J A;  4CA1 A;  1RMD A;  3O33 A;  1WIM A;  3N9N A;  5H1T A;  2VPB A;  2EOD A;  1F62 A;  1LDJ B;  2L0B A;  3O70 A;  3N9L A;  5H1V A;  3HTK C;  2KE1 A;  4A4C A;  3KV6 A;  2L75 A;  4P5O B;  4N4F A;  3DQV R;  2XB1 A;  3N9P A;  3NG2 A;  4FO9 A;  5KH3 A;  2KYU A;  1HYI A;  2YRE A;  2ECV A;  4FIP A;  2E6R A;  2LQ6 A;  3I2D A;  5I3L A;  2IDA A;  5B8D A;  4V3L C;  3T7L A;  2K4D A;  4UI9 B;  5LKT A;  2E6S A;  2LRI C;  2QJ0 A;  1FP0 A;  2DX8 A;  3O35 A;  1WEW A;  4LK9 A;  3HCS A;  2QIZ A;  2FUU A;  4UP5 A;  4LJN A;  5DKA A;  5B76 A;  5FB0 A;  3L1Z B;  2KWJ A;  5AIT A;  1XWH A;  2M85 A;  5LKU A;  2C2V S;  3PUQ A;  3SHB A;  3O36 A;  4MSX A;  4ZDT A;  4YAD A;  3ZNI A;  3IHP A;  5D1M B;  5H1U A;  4F52 B;  2LXP C;  2VJE B;  4FJC A;  2VPE A;  1JM7 B;  2KGG A;  4XI1 A;  2HYE D;  5D1L B;  1HYJ A;  4Q6F A;  2ZET C;  2HDP A;  3ZTG A;  2YHN A;  1WFK A;  2VJE A;  4C9Z A;  3MHS A;  2YYR A;  1JM7 A;  2KWO A;  4GB0 A;  4PTB A;  1WEV A;  2L5U A;  3SOX A;  2MA5 A;  4YAT A;  4NN2 A;  4QF2 A;  4A4B A;  3MHH A;  3DPL R;  2MA6 A;  1WEO A;  3C5K A;  5B75 A;  1VFY A;  2VNF A;  3GL6 A;  3ZPV E;  4TKP B;  5C11 A;  4AP4 A;  3RPG B;  5AIU A;  2CKL B;  3N9Q A;  1N87 A;  4I7D A;  1X4U A;  2LGV A;  2CKL A;  1MM2 A;  5H9M A;  2OXQ C;  3QZV A;  4YAX A;  1X4J A;  1WE9 A;  4YAB A;  1CHC A;  3M63 A;  4B86 C;  2K16 A;  3L1X A;  5B77 A;  1Z6U A;  4AVX A;  4L7X A;  2CSY A;  2PUY A;  2L80 A;  1JOC A;  1VD4 A;  4B7Y C;  4GNE A;  4YBS A;  2FUI A;  2ECN A;  2LV9 A;  3GV4 A;  2RSD A;  4X3G A;  5TBN A;  3PHD A;  3ZPV 1;  2LDR A;  2KFT A;  4O64 A;  2YHO A;  3RPG C;  5KH7 A;  1FBV A;  4W4U A;  2MD8 C;  4R2Y A;  4WZ0 A;  1Z60 A;  2MT5 A;  4ZUX U;  2JMD A;  2LN0 A;  5FER A;  2EA6 A;  2UZG A;  2ECI A;  5B78 A;  4I7C A;  2YUC A;  3ZYQ A;  4WZ2 A;  2KRE A;  2YW8 A;  1WEU A;  2MNY A;  2K17 A;  1WEN A;  3PUR A;  1WES A;  5FEY A;  2C2L A;  2M6M A;  4BBQ A;  1WEP A;  2KU3 A;  2D8S A;  5FB1 A;  2MD7 B;  4LKA A;  2ECG A;  2I50 A;  4A0C D;  2YQM A;  3SOW A;  4A49 A;  2QIC A;  2ECJ A;  3N9O A;  2Y1M A;  3LQJ A;  4ZQL A;  3KNV A;  2KR4 A;  4WA6 A;  1X4I A;  3L11 A;  5J3X A;  3ZVZ B;  1E4U A;  3EB5 A;  3U5N A;  1LDK C;  5B79 A;  2Y43 A;  5G05 B;  3RTR B;  3EB6 A;  4AYC B;  1IYM A;  2KWK A;  2JMI A;  4AYC A;  2BAY A;  5DIN A;  4GNF A;  4V3K C;  4S3O C;  4YBM A;  4CCG X;  2ECW A;  2JMJ A;  3O34 A;  4R8P K;  5LKX A;  2LGL A;  4I7B A;  2H0D B;  2F6J A;  2VP7 A;  2G6Q A;  2NAA A;  4N3W A;  3ASL A;  2JRJ A;  4GND A;  3M99 A;  3VK6 A;  2H0D A;  2M1R A;  4FK5 A;  2RI7 A;  1U6G B;  2MUM A;  5G0F A;  3V43 A;  2YU4 A;  4GNG A;  3FL2 A;  2VPD A;  1WIL A;  4BHW A;  1DVP A;  4YBT A;  1WEE A;  2LGK A;  2LGG A;  2L43 A;  1T1H A;  5LKZ A;  2CSZ A;  2YSJ A;  3KQI A;  4IC2 A;  1BOR A;  5TAB A;  2MNZ A;  1VYX A;  2YQL A;  1WEQ A;  1G25 A;  2YT5 A;  2YUR A;  3C6W A;  3KV5 A;  5G04 B;  3LRQ A;  1WGM A;  4AUQ B;  2KIZ A;  4LLB A;  5KH9 A;  3O7A A;  2XEU A;  4S3O B;  2LXH C;  2Y1N A;  2VPG A;  2KGI A;  2EGP A; 
#chains in the Genus database with same CATH topology
 1WEM A;  3M7K A;  5EYA F;  1Z2Q A;  3ZVY A;  2ECT A;  5TDR A;  4R7E A;  3LQH A;  2PNX A;  5C13 A;  2F6N A;  2YSM A;  4YC9 A;  5TRB A;  3T6R A;  2KWN A;  4WZ3 B;  4IC3 A;  3U5P A;  2CT2 A;  1MM3 A;  2G45 A;  4QF3 A;  4UP0 A;  3U5M A;  3HCU A;  2AN6 A;  2FSA A;  1K2F A;  3HCT A;  2MIQ A;  5TDW A;  4PPE A;  4L58 A;  4LAD B;  3O37 A;  3U5O A;  3LQI A;  4MVT A;  2IQJ A;  2F42 A;  5LCW B;  2VJF B;  3M62 A;  2M3H A;  4QQ4 A;  3SOU A;  5D1K B;  5JG6 A;  3N9M A;  1ZBD B;  2G43 A;  1V87 A;  2VJF A;  2K1J A;  4CA1 A;  1RMD A;  3O33 A;  1WIM A;  3N9N A;  5H1T A;  2VPB A;  2EOD A;  1F62 A;  1LDJ B;  2L0B A;  3O70 A;  3N9L A;  5H1V A;  3HTK C;  2KE1 A;  4A4C A;  3KV6 A;  2L75 A;  4P5O B;  4N4F A;  3DQV R;  2XB1 A;  3N9P A;  3NG2 A;  4FO9 A;  5KH3 A;  2KYU A;  1HYI A;  2EGM A;  2YRE A;  2ECV A;  4FIP A;  2E6R A;  2LQ6 A;  3I2D A;  5I3L A;  2IDA A;  5B8D A;  4V3L C;  3T7L A;  2K4D A;  4UI9 B;  5LKT A;  2E6S A;  2LRI C;  2QJ0 A;  1FP0 A;  2DX8 A;  3O35 A;  1WEW A;  4LK9 A;  3HCS A;  2QIZ A;  2FUU A;  2CSV A;  4UP5 A;  4LJN A;  5DKA A;  5B76 A;  5FB0 A;  3L1Z B;  2KWJ A;  5AIT A;  1XWH A;  3FM8 C;  3FEH A;  2M85 A;  2MKE A;  2JUN A;  5LKU A;  2C2V S;  2DSM A;  3PUQ A;  3SHB A;  3O36 A;  4MSX A;  4ZDT A;  4YAD A;  3ZNI A;  2YVR A;  3IHP A;  5D1M B;  5H1U A;  4F52 B;  2LXP C;  2VJE B;  4FJC A;  2CRW A;  2VPE A;  2D8U A;  1JM7 B;  1DCQ A;  2KGG A;  4XI1 A;  2HYE D;  5D1L B;  1HYJ A;  2RR4 A;  2ZET C;  2HDP A;  4Q6F A;  3ZTG A;  2YHN A;  1WFK A;  2VJE A;  4C9Z A;  3MHS A;  2YYR A;  3T9K A;  1JM7 A;  2KWO A;  4GB0 A;  4PTB A;  1WEV A;  2L5U A;  3H7H A;  3SOX A;  2MA5 A;  4YAT A;  4NN2 A;  4QF2 A;  4A4B A;  3MHH A;  3DPL R;  2MA6 A;  1WEO A;  3C5K A;  5B75 A;  1VFY A;  2VNF A;  3GL6 A;  3ZPV E;  4TKP B;  5C11 A;  2CRR A;  4AP4 A;  3RPG B;  5AIU A;  2CKL B;  3N9Q A;  1N87 A;  4I7D A;  1X4U A;  2LGV A;  2CKL A;  2FFW A;  1MM2 A;  5H9M A;  2OXQ C;  3QZV A;  2DJA A;  4YAX A;  1X4J A;  1WE9 A;  4YAB A;  1CHC A;  3M63 A;  4B86 C;  2K16 A;  1MBM A;  3L1X A;  5B77 A;  1Z6U A;  4AVX A;  4L7X A;  2LAU A;  2CSY A;  2PUY A;  2L80 A;  3MDB C;  1JOC A;  1VD4 A;  2FD4 A;  2M13 A;  3JUE A;  4B7Y C;  4GNE A;  5SVI B;  4YBS A;  2FUI A;  2ECN A;  2B0O E;  2LV9 A;  5SVI A;  3GV4 A;  2RSD A;  3E2D A;  4X3G A;  4F1P A;  5TBN A;  3PHD A;  3ZPV 1;  2LDR A;  2KFT A;  4O64 A;  2YHO A;  3RPG C;  5KH7 A;  1FBV A;  4W4U A;  2MD8 C;  4R2Y A;  4WZ0 A;  1Z60 A;  3FAO A;  2MT5 A;  3SUB A;  4ZUX U;  2JMD A;  2LN0 A;  5FER A;  2EA6 A;  2UZG A;  2ECI A;  5B78 A;  3KDE C;  4I7C A;  5SVY A;  2YUC A;  3ZYQ A;  4WZ2 A;  2XOC A;  3FJU B;  2KRE A;  2YW8 A;  1WEU A;  2MNY A;  4O62 A;  2K17 A;  3O47 A;  1WEN A;  3PUR A;  1WES A;  2JM3 A;  5FEY A;  2KKX A;  2C2L A;  2M6M A;  4BBQ A;  1WEP A;  2KU3 A;  2D8S A;  5FB1 A;  2MD7 B;  4LKA A;  2ECG A;  2I50 A;  4A0C D;  3LVQ E;  2YQM A;  4H9D A;  3SOW A;  4A49 A;  2QIC A;  2ECJ A;  3N9O A;  2Y1M A;  3LQJ A;  2L7P A;  4ZQL A;  3KNV A;  2KR4 A;  4WA6 A;  1X4I A;  3L11 A;  5J3X A;  3ZVZ B;  1E4U A;  4Z0R A;  3Q1D A;  3EB5 A;  3U5N A;  4OGE A;  1LDK C;  5B79 A;  2Y43 A;  2EXU A;  3DWD A;  5G05 B;  3RTR B;  3EB6 A;  2E61 A;  4AYC B;  1IYM A;  2KWK A;  3LDY A;  2JMI A;  3LVR E;  4Z0O A;  4AYC A;  2BAY A;  5DIN A;  4GNF A;  4V3K C;  4S3O C;  4YBM A;  4CCG X;  2ECW A;  2JMJ A;  3O34 A;  4R8P K;  5LKX A;  3LJU X;  2LGL A;  4I7B A;  2H0D B;  2F6J A;  2VP7 A;  2G6Q A;  2NAA A;  3FAN A;  4N3W A;  2P57 A;  3ASL A;  2JRJ A;  4GND A;  3M99 A;  3VK6 A;  2H0D A;  2M1R A;  4FK5 A;  2RI7 A;  1U6G B;  2MUM A;  5G0F A;  3V43 A;  2KKY A;  3DDT A;  2YU4 A;  4GNG A;  3FL2 A;  2VPD A;  1WIL A;  4BHW A;  1DVP A;  4YBT A;  4OGC A;  1WEE A;  2LGK A;  2LGG A;  2L43 A;  1T1H A;  5LKZ A;  2CSZ A;  2YSJ A;  3KQI A;  4IC2 A;  1BOR A;  2MNZ A;  5TAB A;  1VYX A;  2YQL A;  1WEQ A;  2XOZ A;  1G25 A;  2OWA A;  5SVX A;  2YT5 A;  2XOY A;  2YUR A;  3C6W A;  3KV5 A;  5G04 B;  3LRQ A;  2CON A;  2XP0 A;  1WGM A;  4AUQ B;  2KIZ A;  4LLB A;  5K3Q A;  5KH9 A;  3O7A A;  2XEU A;  3PLW A;  4S3O B;  2LXH C;  2Y1N A;  2VPG A;  2KGI A;  2EGP A; 
#chains in the Genus database with same CATH homology
 1WEM A;  5EYA F;  1Z2Q A;  3ZVY A;  2ECT A;  5TDR A;  4R7E A;  3LQH A;  2PNX A;  5C13 A;  2F6N A;  2YSM A;  4YC9 A;  5TRB A;  3T6R A;  2KWN A;  4WZ3 B;  4IC3 A;  3U5P A;  2CT2 A;  1MM3 A;  2G45 A;  4QF3 A;  4UP0 A;  3U5M A;  3HCU A;  2AN6 A;  2FSA A;  1K2F A;  3HCT A;  2MIQ A;  5TDW A;  4PPE A;  4L58 A;  4LAD B;  3O37 A;  3U5O A;  3LQI A;  4MVT A;  2F42 A;  5LCW B;  2VJF B;  3M62 A;  2M3H A;  3SOU A;  5D1K B;  5JG6 A;  3N9M A;  1ZBD B;  2G43 A;  1V87 A;  2VJF A;  2K1J A;  4CA1 A;  1RMD A;  3O33 A;  1WIM A;  3N9N A;  5H1T A;  2VPB A;  2EOD A;  1F62 A;  1LDJ B;  2L0B A;  3O70 A;  3N9L A;  5H1V A;  3HTK C;  2KE1 A;  4A4C A;  3KV6 A;  2L75 A;  4P5O B;  4N4F A;  3DQV R;  2XB1 A;  3N9P A;  3NG2 A;  4FO9 A;  5KH3 A;  2KYU A;  1HYI A;  2YRE A;  2ECV A;  4FIP A;  2E6R A;  2LQ6 A;  3I2D A;  5I3L A;  2IDA A;  5B8D A;  4V3L C;  3T7L A;  2K4D A;  4UI9 B;  5LKT A;  2E6S A;  2LRI C;  2QJ0 A;  1FP0 A;  2DX8 A;  3O35 A;  1WEW A;  4LK9 A;  3HCS A;  2QIZ A;  2FUU A;  4UP5 A;  4LJN A;  5DKA A;  5B76 A;  5FB0 A;  3L1Z B;  2KWJ A;  5AIT A;  1XWH A;  2M85 A;  5LKU A;  2C2V S;  3PUQ A;  3SHB A;  3O36 A;  4MSX A;  4ZDT A;  4YAD A;  3ZNI A;  3IHP A;  5D1M B;  5H1U A;  4F52 B;  2LXP C;  2VJE B;  4FJC A;  2VPE A;  1JM7 B;  2KGG A;  4XI1 A;  2HYE D;  5D1L B;  1HYJ A;  4Q6F A;  2ZET C;  2HDP A;  3ZTG A;  2YHN A;  1WFK A;  2VJE A;  4C9Z A;  3MHS A;  2YYR A;  1JM7 A;  2KWO A;  4GB0 A;  4PTB A;  1WEV A;  2L5U A;  3SOX A;  2MA5 A;  4YAT A;  4NN2 A;  4QF2 A;  4A4B A;  3MHH A;  3DPL R;  2MA6 A;  1WEO A;  3C5K A;  5B75 A;  1VFY A;  2VNF A;  3GL6 A;  3ZPV E;  4TKP B;  5C11 A;  4AP4 A;  3RPG B;  5AIU A;  2CKL B;  3N9Q A;  1N87 A;  4I7D A;  1X4U A;  2LGV A;  2CKL A;  1MM2 A;  5H9M A;  2OXQ C;  3QZV A;  4YAX A;  1X4J A;  1WE9 A;  4YAB A;  1CHC A;  3M63 A;  4B86 C;  2K16 A;  3L1X A;  5B77 A;  1Z6U A;  4AVX A;  4L7X A;  2CSY A;  2PUY A;  2L80 A;  1JOC A;  1VD4 A;  4B7Y C;  4GNE A;  4YBS A;  2FUI A;  2ECN A;  2LV9 A;  3GV4 A;  2RSD A;  4X3G A;  5TBN A;  3PHD A;  3ZPV 1;  2LDR A;  2KFT A;  4O64 A;  2YHO A;  3RPG C;  5KH7 A;  1FBV A;  4W4U A;  2MD8 C;  4R2Y A;  4WZ0 A;  1Z60 A;  2MT5 A;  4ZUX U;  2JMD A;  2LN0 A;  5FER A;  2EA6 A;  2UZG A;  2ECI A;  5B78 A;  4I7C A;  2YUC A;  3ZYQ A;  4WZ2 A;  2KRE A;  2YW8 A;  1WEU A;  2MNY A;  2K17 A;  1WEN A;  3PUR A;  1WES A;  5FEY A;  2C2L A;  2M6M A;  4BBQ A;  1WEP A;  2KU3 A;  2D8S A;  5FB1 A;  2MD7 B;  4LKA A;  2ECG A;  2I50 A;  4A0C D;  2YQM A;  3SOW A;  4A49 A;  2QIC A;  2ECJ A;  3N9O A;  2Y1M A;  3LQJ A;  4ZQL A;  3KNV A;  2KR4 A;  4WA6 A;  1X4I A;  3L11 A;  5J3X A;  3ZVZ B;  1E4U A;  3EB5 A;  3U5N A;  1LDK C;  5B79 A;  2Y43 A;  5G05 B;  3RTR B;  3EB6 A;  4AYC B;  1IYM A;  2KWK A;  2JMI A;  4AYC A;  2BAY A;  5DIN A;  4GNF A;  4V3K C;  4S3O C;  4YBM A;  4CCG X;  2ECW A;  2JMJ A;  3O34 A;  4R8P K;  5LKX A;  2LGL A;  4I7B A;  2H0D B;  2F6J A;  2VP7 A;  2G6Q A;  2NAA A;  4N3W A;  3ASL A;  2JRJ A;  4GND A;  3M99 A;  3VK6 A;  2H0D A;  2M1R A;  4FK5 A;  2RI7 A;  1U6G B;  2MUM A;  5G0F A;  3V43 A;  2YU4 A;  4GNG A;  3FL2 A;  2VPD A;  1WIL A;  4BHW A;  1DVP A;  4YBT A;  1WEE A;  2LGK A;  2LGG A;  2L43 A;  1T1H A;  5LKZ A;  2CSZ A;  2YSJ A;  3KQI A;  4IC2 A;  1BOR A;  5TAB A;  2MNZ A;  1VYX A;  2YQL A;  1WEQ A;  1G25 A;  2YT5 A;  2YUR A;  3C6W A;  3KV5 A;  5G04 B;  3LRQ A;  1WGM A;  4AUQ B;  2KIZ A;  4LLB A;  5KH9 A;  3O7A A;  2XEU A;  4S3O B;  2LXH C;  2Y1N A;  2VPG A;  2KGI A;  2EGP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...