4IC2A

Crystal structure of the xiap ring domain
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
62
structure length
62
Chain Sequence
ISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDKCPMCYTVITFKQKIFM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase XIAP
publication title Regulation of ubiquitin transfer by XIAP, a dimeric RING E3 ligase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 15
structure length 62
sequence length 62
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4ic2A00
1Z2QA 3DQVR 3KQIA 1T1HA 2H0DB 2KWKA 2E6RA 1MM3A 5LKTA 3LQIA 4PPEA 2MD8C 4A4BA 5LKUA 2M1RA 4WZ3B 2VJFB 5H9MA 2F42A 2IDAA 4LLBA 4L7XA 2YSMA 4MSXA 2D8SA 2YHNA 3ZVZB 3O35A 3O36A 5FEYA 2LN0A 4A4CA 3LQJA 2K17A 1K2FA 5J3XA 4FIPA 3I2DA 3V43A 4S3OC 1WIMA 2YU4A 2HYED 2PNXA 5TRBA 2VPBA 1LDKC 5H1UA 3U5NA 2QIZA 4O64A 2JMIA 3RPGC 5D1LB 2HDPA 2EODA 3C6WA 4R8PK 1WEMA 3N9PA 1N87A 4LK9A 3L1ZB 2VJEA 3M99A 3PHDA 2C2VS 1LDJB 2MD7B 2G45A 2VP7A 3SOXA 2RSDA 2KGIA 1Z60A 2JRJA 5LKZA 4UP0A 3KNVA 3NG2A 3GV4A 1RMDA 3IHPA 5KH9A 3SHBA 4YABA 2MUMA 5FB1A 4CA1A 1JM7B 4ZUXU 3O33A 3O37A 2YHOA 3ZPV1 4BBQA 1WE9A 3N9QA 4BHWA 3ZYQA 4N4FA 3N9MA 2M6MA 5DINA 4TKPB 2ECGA 2YQLA 3N9NA 5C13A 5C11A 2YW8A 4F52B 3LQHA 4NN2A 2ECWA 4P5OB 4GNGA 4YADA 4PTBA 3DPLR 3T7LA 3PURA 2K4DA 1F62A 2YURA 4ZDTA 5I3LA 2C2LA 1HYIA 3U5OA 1JOCA 1VYXA 4R7EA 3SOUA 2K16A 1BORA 4ZQLA 5LKXA 2XB1A 3GL6A 2LGKA 5B78A 5TABA 4YBSA 4WZ2A 1HYJA 3ZTGA 2YSJA 3RTRB 1JM7A 1E4UA 3HTKC 2G43A 3L11A 4FJCA 1X4JA 2M85A 5B8DA 2YREA 1WENA 2L75A 2ECIA 2ZETC 4Q6FA 1WEQA 2YQMA 4LKAA 2ECJA 2L0BA 2JMJA 2YYRA 2YUCA 3ZPVE 3O7AA 3MHHA 3ASLA 2H0DA 1WESA 5TDRA 5G05B 4N3WA 5DKAA 2VNFA 3M62A 2LGGA 4I7BA 2CKLB 2JMDA 2ECTA 2MIQA 5G04B 2VJFA 1ZBDB 4UI9B 1WILA 4QF2A 2LXPC 2KFTA 4AUQB 2M3HA 3FL2A 3KV5A 1WFKA 2KREA 5AITA 5KH3A 1VFYA 2Y43A 2CT2A 2CSZA 3PUQA 4L58A 4YBMA 4I7CA 3U5MA 3N9LA 4AVXA 2MA5A 2KU3A 2QJ0A 2LGLA 5G0FA 2G6QA 2LGVA 4GNFA 2QICA 3HCUA 1V87A 1IYMA 2LRIC 3VK6A 1WEUA 2KGGA 1X4IA 2XEUA 4UP5A 2CKLA 2BAYA 2ECNA 4LJNA 4C9ZA 2LV9A 5FERA 1WEWA 4MVTA 4AP4A 2RI7A 2LXHC 3QZVA 2F6JA 4YBTA 3O70A 2KR4A 1X4UA 5D1MB 2I50A 1WEOA 5B76A 4WZ0A 5B77A 3EB5A 3KV6A 4IC3A 4S3OB 4YAXA 1G25A 4AYCB 2KWJA 3SOWA 2VPDA 1U6GB 3L1XA 4QF3A 3RPGB 1WEEA 2MA6A 2FUUA 3O34A 2KYUA 2L80A 2F6NA 5JG6A 2Y1MA 3ZNIA 2NAAA 2FSAA 1FBVA 2LQ6A 4GB0A 4WA6A 4B7YC 5LCWB 1WEPA 3M63A 2EA6A 4IC2A 4FO9A 2VJEB 4V3LC 4LADB 1WEVA 3T6RA 4AYCA 2MNYA 2PUYA 2VPGA 4CCGX 4GNDA 5TBNA 2K1JA 3U5PA 5B75A 2E6SA 1CHCA 2L43A 5AIUA 2MT5A 2KWOA 1DVPA 5H1TA 3HCSA 2KIZA 5B79A 4YC9A 3ZVYA 3HCTA 4I7DA 2EGPA 5D1KB 2ECVA 1XWHA 5H1VA 4A0CD 2KWNA 4X3GA 2YT5A 4XI1A 4B86C 2LDRA 4A49A 2CSYA 3EB6A 2UZGA 2OXQC 4FK5A 3C5KA 2AN6A 2Y1NA 3MHSA 5KH7A 3LRQA 2KE1A 2MNZA 1Z6UA 4W4UA 2DX8A 4YATA 1FP0A 4V3KC 5TDWA 2VPEA 1MM2A 5EYAF 3N9OA 2L5UA 4R2YA 1WGMA 2FUIA 1VD4A 4GNEA 5FB0A
chains in the Genus database with same CATH superfamily
1Z2QA 3DQVR 3KQIA 2DJAA 1T1HA 2H0DB 2KWKA 2FD4A 2E6RA 1MM3A 4Z0OA 5LKTA 3FAOA 3LQIA 4PPEA 2MD8C 4A4BA 5LKUA 2M1RA 4WZ3B 2VJFB 5H9MA 2YVRA 2F42A 5SVYA 2IDAA 4H9DA 4LLBA 4L7XA 2YSMA 4MSXA 5SVIB 2D8SA 2YHNA 3ZVZB 3O35A 3O36A 5FEYA 2LN0A 2XP0A 4A4CA 3LQJA 2K17A 1K2FA 5J3XA 4FIPA 3I2DA 3V43A 4S3OC 1WIMA 2YU4A 2HYED 2PNXA 5TRBA 2VPBA 1LDKC 2OWAA 5H1UA 3U5NA 2QIZA 3FANA 4O64A 2JMIA 3RPGC 3LVQE 4QQ4A 3LJUX 2E61A 2KKYA 5D1LB 2HDPA 2EODA 3C6WA 2RR4A 4R8PK 1WEMA 4Z0RA 3N9PA 1N87A 4LK9A 3L1ZB 2VJEA 3M99A 3PHDA 2C2VS 1LDJB 2MD7B 2EGMA 2G45A 2VP7A 2CONA 2M13A 2RSDA 2KGIA 3SOXA 1Z60A 2JRJA 5LKZA 4UP0A 3KNVA 3NG2A 3GV4A 1RMDA 3IHPA 5KH9A 3SHBA 4YABA 2MUMA 5FB1A 4CA1A 1JM7B 4ZUXU 3O33A 3O37A 2YHOA 3ZPV1 4BBQA 1WE9A 3N9QA 4BHWA 2FFWA 3ZYQA 4N4FA 3N9MA 2M6MA 5DINA 4TKPB 2ECGA 2YQLA 3N9NA 5C13A 5C11A 2YW8A 4F52B 3LQHA 1DCQA 4NN2A 2ECWA 4P5OB 4GNGA 4YADA 3DWDA 4PTBA 3DPLR 3T7LA 3PURA 2K4DA 1F62A 2YURA 4ZDTA 5I3LA 2C2LA 1HYIA 3U5OA 1JOCA 1VYXA 3LVRE 4R7EA 3SOUA 4OGCA 2K16A 1BORA 4ZQLA 5LKXA 2XB1A 3GL6A 2LGKA 5B78A 5TABA 4YBSA 4WZ2A 1HYJA 3ZTGA 2YSJA 3RTRB 1JM7A 1E4UA 3HTKC 2G43A 3L11A 4FJCA 1X4JA 2M85A 5B8DA 2YREA 1WENA 2L75A 2ECIA 2CSVA 2ZETC 4Q6FA 1WEQA 2YQMA 4LKAA 2ECJA 2L0BA 2L7PA 2JMJA 2YYRA 2YUCA 3ZPVE 2IQJA 3SUBA 3O7AA 3MHHA 3ASLA 3MDBC 2H0DA 1WESA 5TDRA 4OGEA 2EXUA 5G05B 4N3WA 3M62A 2VNFA 5DKAA 2LGGA 4I7BA 2CKLB 2JMDA 2ECTA 2MIQA 5G04B 2VJFA 1ZBDB 4UI9B 1WILA 4QF2A 2LXPC 5SVIA 2KFTA 4AUQB 2M3HA 3FL2A 3KV5A 1WFKA 2KREA 5AITA 3FEHA 3E2DA 5KH3A 1VFYA 2Y43A 2CT2A 2CSZA 3PUQA 3H7HA 4L58A 4YBMA 4I7CA 3U5MA 3N9LA 4AVXA 2MA5A 2KU3A 2QJ0A 2LGLA 5G0FA 2G6QA 2LGVA 4GNFA 2QICA 3HCUA 1V87A 1IYMA 2LRIC 3M7KA 1MBMA 3VK6A 1WEUA 2KGGA 3JUEA 1X4IA 2XEUA 4UP5A 2CKLA 2BAYA 2ECNA 4LJNA 4C9ZA 2LV9A 5FERA 1WEWA 4MVTA 4AP4A 2RI7A 2KKXA 2LAUA 2LXHC 3QZVA 2F6JA 4O62A 3DDTA 4YBTA 3O70A 2KR4A 1X4UA 2B0OE 3LDYA 5D1MB 2I50A 1WEOA 5B76A 4WZ0A 5B77A 3EB5A 4F1PA 3Q1DA 3KV6A 4IC3A 4S3OB 4YAXA 1G25A 4AYCB 2KWJA 3SOWA 2JM3A 2VPDA 1U6GB 3L1XA 4QF3A 3RPGB 2D8UA 2JUNA 1WEEA 2MA6A 3FM8C 2DSMA 2FUUA 3O34A 2KYUA 2L80A 2F6NA 5JG6A 2Y1MA 3ZNIA 2NAAA 3O47A 2FSAA 1FBVA 2LQ6A 4GB0A 4WA6A 3T9KA 4B7YC 2XOYA 5LCWB 1WEPA 3M63A 2EA6A 4IC2A 4FO9A 2VJEB 4V3LC 4LADB 1WEVA 3T6RA 4AYCA 2MNYA 2PUYA 2VPGA 4CCGX 4GNDA 5TBNA 2K1JA 3U5PA 5B75A 2E6SA 1CHCA 2L43A 5AIUA 2P57A 2XOCA 2MT5A 2MKEA 2KWOA 1DVPA 5H1TA 3HCSA 2KIZA 5B79A 4YC9A 3ZVYA 3KDEC 3HCTA 4I7DA 2EGPA 5D1KB 2ECVA 1XWHA 5H1VA 5K3QA 4A0CD 2KWNA 4X3GA 2YT5A 4XI1A 3FJUB 4B86C 2LDRA 4A49A 2CSYA 3PLWA 3EB6A 2UZGA 2OXQC 4FK5A 3C5KA 2AN6A 2Y1NA 3MHSA 5SVXA 5KH7A 2XOZA 3LRQA 2KE1A 2MNZA 1Z6UA 4W4UA 2DX8A 4YATA 1FP0A 4V3KC 5TDWA 2VPEA 1MM2A 5EYAF 3N9OA 2L5UA 4R2YA 1WGMA 2FUIA 1VD4A 2CRWA 2CRRA 4GNEA 5FB0A
chains in the Genus database with same CATH topology
1Z2QA 3DQVR 3KQIA 1T1HA 2H0DB 2KWKA 2E6RA 1MM3A 5LKTA 3LQIA 4PPEA 2MD8C 4A4BA 5LKUA 2M1RA 4WZ3B 2VJFB 5H9MA 2F42A 2IDAA 4LLBA 4L7XA 2YSMA 4MSXA 2D8SA 2YHNA 3ZVZB 3O35A 3O36A 5FEYA 2LN0A 4A4CA 3LQJA 2K17A 1K2FA 5J3XA 4FIPA 3I2DA 3V43A 4S3OC 1WIMA 2YU4A 2HYED 2PNXA 5TRBA 2VPBA 1LDKC 5H1UA 3U5NA 2QIZA 4O64A 2JMIA 3RPGC 5D1LB 2HDPA 2EODA 3C6WA 4R8PK 1WEMA 3N9PA 1N87A 4LK9A 3L1ZB 2VJEA 3M99A 3PHDA 2C2VS 1LDJB 2MD7B 2G45A 2VP7A 3SOXA 2RSDA 2KGIA 1Z60A 2JRJA 5LKZA 4UP0A 3KNVA 3NG2A 3GV4A 1RMDA 3IHPA 5KH9A 3SHBA 4YABA 2MUMA 5FB1A 4CA1A 1JM7B 4ZUXU 3O33A 3O37A 2YHOA 3ZPV1 4BBQA 1WE9A 3N9QA 4BHWA 3ZYQA 4N4FA 3N9MA 2M6MA 5DINA 4TKPB 2ECGA 2YQLA 3N9NA 5C13A 5C11A 2YW8A 4F52B 3LQHA 4NN2A 2ECWA 4P5OB 4GNGA 4YADA 4PTBA 3DPLR 3T7LA 3PURA 2K4DA 1F62A 2YURA 4ZDTA 5I3LA 2C2LA 1HYIA 3U5OA 1JOCA 1VYXA 4R7EA 3SOUA 2K16A 1BORA 4ZQLA 5LKXA 2XB1A 3GL6A 2LGKA 5B78A 5TABA 4YBSA 4WZ2A 1HYJA 3ZTGA 2YSJA 3RTRB 1JM7A 1E4UA 3HTKC 2G43A 3L11A 4FJCA 1X4JA 2M85A 5B8DA 2YREA 1WENA 2L75A 2ECIA 2ZETC 4Q6FA 1WEQA 2YQMA 4LKAA 2ECJA 2L0BA 2JMJA 2YYRA 2YUCA 3ZPVE 3O7AA 3MHHA 3ASLA 2H0DA 1WESA 5TDRA 5G05B 4N3WA 5DKAA 2VNFA 3M62A 2LGGA 4I7BA 2CKLB 2JMDA 2ECTA 2MIQA 5G04B 2VJFA 1ZBDB 4UI9B 1WILA 4QF2A 2LXPC 2KFTA 4AUQB 2M3HA 3FL2A 3KV5A 1WFKA 2KREA 5AITA 5KH3A 1VFYA 2Y43A 2CT2A 2CSZA 3PUQA 4L58A 4YBMA 4I7CA 3U5MA 3N9LA 4AVXA 2MA5A 2KU3A 2QJ0A 2LGLA 5G0FA 2G6QA 2LGVA 4GNFA 2QICA 3HCUA 1V87A 1IYMA 2LRIC 3VK6A 1WEUA 2KGGA 1X4IA 2XEUA 4UP5A 2CKLA 2BAYA 2ECNA 4LJNA 4C9ZA 2LV9A 5FERA 1WEWA 4MVTA 4AP4A 2RI7A 2LXHC 3QZVA 2F6JA 4YBTA 3O70A 2KR4A 1X4UA 5D1MB 2I50A 1WEOA 5B76A 4WZ0A 5B77A 3EB5A 3KV6A 4IC3A 4S3OB 4YAXA 1G25A 4AYCB 2KWJA 3SOWA 2VPDA 1U6GB 3L1XA 4QF3A 3RPGB 1WEEA 2MA6A 2FUUA 3O34A 2KYUA 2L80A 2F6NA 5JG6A 2Y1MA 3ZNIA 2NAAA 2FSAA 1FBVA 2LQ6A 4GB0A 4WA6A 4B7YC 5LCWB 1WEPA 3M63A 2EA6A 4IC2A 4FO9A 2VJEB 4V3LC 4LADB 1WEVA 3T6RA 4AYCA 2MNYA 2PUYA 2VPGA 4CCGX 4GNDA 5TBNA 2K1JA 3U5PA 5B75A 2E6SA 1CHCA 2L43A 5AIUA 2MT5A 2KWOA 1DVPA 5H1TA 3HCSA 2KIZA 5B79A 4YC9A 3ZVYA 3HCTA 4I7DA 2EGPA 5D1KB 2ECVA 1XWHA 5H1VA 4A0CD 2KWNA 4X3GA 2YT5A 4XI1A 4B86C 2LDRA 4A49A 2CSYA 3EB6A 2UZGA 2OXQC 4FK5A 3C5KA 2AN6A 2Y1NA 3MHSA 5KH7A 3LRQA 2KE1A 2MNZA 1Z6UA 4W4UA 2DX8A 4YATA 1FP0A 4V3KC 5TDWA 2VPEA 1MM2A 5EYAF 3N9OA 2L5UA 4R2YA 1WGMA 2FUIA 1VD4A 4GNEA 5FB0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z2Q A;  3DQV R;  3KQI A;  1T1H A;  2H0D B;  2KWK A;  2E6R A;  1MM3 A;  5LKT A;  3LQI A;  4PPE A;  2MD8 C;  4A4B A;  5LKU A;  2M1R A;  4WZ3 B;  2VJF B;  5H9M A;  2F42 A;  2IDA A;  4LLB A;  4L7X A;  2YSM A;  4MSX A;  2D8S A;  2YHN A;  3ZVZ B;  3O35 A;  3O36 A;  5FEY A;  2LN0 A;  4A4C A;  3LQJ A;  2K17 A;  1K2F A;  5J3X A;  4FIP A;  3I2D A;  3V43 A;  4S3O C;  1WIM A;  2YU4 A;  2HYE D;  2PNX A;  5TRB A;  2VPB A;  1LDK C;  5H1U A;  3U5N A;  2QIZ A;  4O64 A;  2JMI A;  3RPG C;  5D1L B;  2HDP A;  2EOD A;  3C6W A;  4R8P K;  1WEM A;  3N9P A;  1N87 A;  4LK9 A;  3L1Z B;  2VJE A;  3M99 A;  3PHD A;  2C2V S;  1LDJ B;  2MD7 B;  2G45 A;  2VP7 A;  3SOX A;  2RSD A;  2KGI A;  1Z60 A;  2JRJ A;  5LKZ A;  4UP0 A;  3KNV A;  3NG2 A;  3GV4 A;  1RMD A;  3IHP A;  5KH9 A;  3SHB A;  4YAB A;  2MUM A;  5FB1 A;  4CA1 A;  1JM7 B;  4ZUX U;  3O33 A;  3O37 A;  2YHO A;  3ZPV 1;  4BBQ A;  1WE9 A;  3N9Q A;  4BHW A;  3ZYQ A;  4N4F A;  3N9M A;  2M6M A;  5DIN A;  4TKP B;  2ECG A;  2YQL A;  3N9N A;  5C13 A;  5C11 A;  2YW8 A;  4F52 B;  3LQH A;  4NN2 A;  2ECW A;  4P5O B;  4GNG A;  4YAD A;  4PTB A;  3DPL R;  3T7L A;  3PUR A;  2K4D A;  1F62 A;  2YUR A;  4ZDT A;  5I3L A;  2C2L A;  1HYI A;  3U5O A;  1JOC A;  1VYX A;  4R7E A;  3SOU A;  2K16 A;  1BOR A;  4ZQL A;  5LKX A;  2XB1 A;  3GL6 A;  2LGK A;  5B78 A;  5TAB A;  4YBS A;  4WZ2 A;  1HYJ A;  3ZTG A;  2YSJ A;  3RTR B;  1JM7 A;  1E4U A;  3HTK C;  2G43 A;  3L11 A;  4FJC A;  1X4J A;  2M85 A;  5B8D A;  2YRE A;  1WEN A;  2L75 A;  2ECI A;  2ZET C;  4Q6F A;  1WEQ A;  2YQM A;  4LKA A;  2ECJ A;  2L0B A;  2JMJ A;  2YYR A;  2YUC A;  3ZPV E;  3O7A A;  3MHH A;  3ASL A;  2H0D A;  1WES A;  5TDR A;  5G05 B;  4N3W A;  5DKA A;  2VNF A;  3M62 A;  2LGG A;  4I7B A;  2CKL B;  2JMD A;  2ECT A;  2MIQ A;  5G04 B;  2VJF A;  1ZBD B;  4UI9 B;  1WIL A;  4QF2 A;  2LXP C;  2KFT A;  4AUQ B;  2M3H A;  3FL2 A;  3KV5 A;  1WFK A;  2KRE A;  5AIT A;  5KH3 A;  1VFY A;  2Y43 A;  2CT2 A;  2CSZ A;  3PUQ A;  4L58 A;  4YBM A;  4I7C A;  3U5M A;  3N9L A;  4AVX A;  2MA5 A;  2KU3 A;  2QJ0 A;  2LGL A;  5G0F A;  2G6Q A;  2LGV A;  4GNF A;  2QIC A;  3HCU A;  1V87 A;  1IYM A;  2LRI C;  3VK6 A;  1WEU A;  2KGG A;  1X4I A;  2XEU A;  4UP5 A;  2CKL A;  2BAY A;  2ECN A;  4LJN A;  4C9Z A;  2LV9 A;  5FER A;  1WEW A;  4MVT A;  4AP4 A;  2RI7 A;  2LXH C;  3QZV A;  2F6J A;  4YBT A;  3O70 A;  2KR4 A;  1X4U A;  5D1M B;  2I50 A;  1WEO A;  5B76 A;  4WZ0 A;  5B77 A;  3EB5 A;  3KV6 A;  4IC3 A;  4S3O B;  4YAX A;  1G25 A;  4AYC B;  2KWJ A;  3SOW A;  2VPD A;  1U6G B;  3L1X A;  4QF3 A;  3RPG B;  1WEE A;  2MA6 A;  2FUU A;  3O34 A;  2KYU A;  2L80 A;  2F6N A;  5JG6 A;  2Y1M A;  3ZNI A;  2NAA A;  2FSA A;  1FBV A;  2LQ6 A;  4GB0 A;  4WA6 A;  4B7Y C;  5LCW B;  1WEP A;  3M63 A;  2EA6 A;  4IC2 A;  4FO9 A;  2VJE B;  4V3L C;  4LAD B;  1WEV A;  3T6R A;  4AYC A;  2MNY A;  2PUY A;  2VPG A;  4CCG X;  4GND A;  5TBN A;  2K1J A;  3U5P A;  5B75 A;  2E6S A;  1CHC A;  2L43 A;  5AIU A;  2MT5 A;  2KWO A;  1DVP A;  5H1T A;  3HCS A;  2KIZ A;  5B79 A;  4YC9 A;  3ZVY A;  3HCT A;  4I7D A;  2EGP A;  5D1K B;  2ECV A;  1XWH A;  5H1V A;  4A0C D;  2KWN A;  4X3G A;  2YT5 A;  4XI1 A;  4B86 C;  2LDR A;  4A49 A;  2CSY A;  3EB6 A;  2UZG A;  2OXQ C;  4FK5 A;  3C5K A;  2AN6 A;  2Y1N A;  3MHS A;  5KH7 A;  3LRQ A;  2KE1 A;  2MNZ A;  1Z6U A;  4W4U A;  2DX8 A;  4YAT A;  1FP0 A;  4V3K C;  5TDW A;  2VPE A;  1MM2 A;  5EYA F;  3N9O A;  2L5U A;  4R2Y A;  1WGM A;  2FUI A;  1VD4 A;  4GNE A;  5FB0 A; 
#chains in the Genus database with same CATH topology
 1Z2Q A;  3DQV R;  3KQI A;  2DJA A;  1T1H A;  2H0D B;  2KWK A;  2FD4 A;  2E6R A;  1MM3 A;  4Z0O A;  5LKT A;  3FAO A;  3LQI A;  4PPE A;  2MD8 C;  4A4B A;  5LKU A;  2M1R A;  4WZ3 B;  2VJF B;  5H9M A;  2YVR A;  2F42 A;  5SVY A;  2IDA A;  4H9D A;  4LLB A;  4L7X A;  2YSM A;  4MSX A;  5SVI B;  2D8S A;  2YHN A;  3ZVZ B;  3O35 A;  3O36 A;  5FEY A;  2LN0 A;  2XP0 A;  4A4C A;  3LQJ A;  2K17 A;  1K2F A;  5J3X A;  4FIP A;  3I2D A;  3V43 A;  4S3O C;  1WIM A;  2YU4 A;  2HYE D;  2PNX A;  5TRB A;  2VPB A;  1LDK C;  2OWA A;  5H1U A;  3U5N A;  2QIZ A;  3FAN A;  4O64 A;  2JMI A;  3RPG C;  3LVQ E;  4QQ4 A;  3LJU X;  2E61 A;  2KKY A;  5D1L B;  2HDP A;  2EOD A;  3C6W A;  2RR4 A;  4R8P K;  1WEM A;  4Z0R A;  3N9P A;  1N87 A;  4LK9 A;  3L1Z B;  2VJE A;  3M99 A;  3PHD A;  2C2V S;  1LDJ B;  2MD7 B;  2EGM A;  2G45 A;  2VP7 A;  2CON A;  2M13 A;  2RSD A;  2KGI A;  3SOX A;  1Z60 A;  2JRJ A;  5LKZ A;  4UP0 A;  3KNV A;  3NG2 A;  3GV4 A;  1RMD A;  3IHP A;  5KH9 A;  3SHB A;  4YAB A;  2MUM A;  5FB1 A;  4CA1 A;  1JM7 B;  4ZUX U;  3O33 A;  3O37 A;  2YHO A;  3ZPV 1;  4BBQ A;  1WE9 A;  3N9Q A;  4BHW A;  2FFW A;  3ZYQ A;  4N4F A;  3N9M A;  2M6M A;  5DIN A;  4TKP B;  2ECG A;  2YQL A;  3N9N A;  5C13 A;  5C11 A;  2YW8 A;  4F52 B;  3LQH A;  1DCQ A;  4NN2 A;  2ECW A;  4P5O B;  4GNG A;  4YAD A;  3DWD A;  4PTB A;  3DPL R;  3T7L A;  3PUR A;  2K4D A;  1F62 A;  2YUR A;  4ZDT A;  5I3L A;  2C2L A;  1HYI A;  3U5O A;  1JOC A;  1VYX A;  3LVR E;  4R7E A;  3SOU A;  4OGC A;  2K16 A;  1BOR A;  4ZQL A;  5LKX A;  2XB1 A;  3GL6 A;  2LGK A;  5B78 A;  5TAB A;  4YBS A;  4WZ2 A;  1HYJ A;  3ZTG A;  2YSJ A;  3RTR B;  1JM7 A;  1E4U A;  3HTK C;  2G43 A;  3L11 A;  4FJC A;  1X4J A;  2M85 A;  5B8D A;  2YRE A;  1WEN A;  2L75 A;  2ECI A;  2CSV A;  2ZET C;  4Q6F A;  1WEQ A;  2YQM A;  4LKA A;  2ECJ A;  2L0B A;  2L7P A;  2JMJ A;  2YYR A;  2YUC A;  3ZPV E;  2IQJ A;  3SUB A;  3O7A A;  3MHH A;  3ASL A;  3MDB C;  2H0D A;  1WES A;  5TDR A;  4OGE A;  2EXU A;  5G05 B;  4N3W A;  3M62 A;  2VNF A;  5DKA A;  2LGG A;  4I7B A;  2CKL B;  2JMD A;  2ECT A;  2MIQ A;  5G04 B;  2VJF A;  1ZBD B;  4UI9 B;  1WIL A;  4QF2 A;  2LXP C;  5SVI A;  2KFT A;  4AUQ B;  2M3H A;  3FL2 A;  3KV5 A;  1WFK A;  2KRE A;  5AIT A;  3FEH A;  3E2D A;  5KH3 A;  1VFY A;  2Y43 A;  2CT2 A;  2CSZ A;  3PUQ A;  3H7H A;  4L58 A;  4YBM A;  4I7C A;  3U5M A;  3N9L A;  4AVX A;  2MA5 A;  2KU3 A;  2QJ0 A;  2LGL A;  5G0F A;  2G6Q A;  2LGV A;  4GNF A;  2QIC A;  3HCU A;  1V87 A;  1IYM A;  2LRI C;  3M7K A;  1MBM A;  3VK6 A;  1WEU A;  2KGG A;  3JUE A;  1X4I A;  2XEU A;  4UP5 A;  2CKL A;  2BAY A;  2ECN A;  4LJN A;  4C9Z A;  2LV9 A;  5FER A;  1WEW A;  4MVT A;  4AP4 A;  2RI7 A;  2KKX A;  2LAU A;  2LXH C;  3QZV A;  2F6J A;  4O62 A;  3DDT A;  4YBT A;  3O70 A;  2KR4 A;  1X4U A;  2B0O E;  3LDY A;  5D1M B;  2I50 A;  1WEO A;  5B76 A;  4WZ0 A;  5B77 A;  3EB5 A;  4F1P A;  3Q1D A;  3KV6 A;  4IC3 A;  4S3O B;  4YAX A;  1G25 A;  4AYC B;  2KWJ A;  3SOW A;  2JM3 A;  2VPD A;  1U6G B;  3L1X A;  4QF3 A;  3RPG B;  2D8U A;  2JUN A;  1WEE A;  2MA6 A;  3FM8 C;  2DSM A;  2FUU A;  3O34 A;  2KYU A;  2L80 A;  2F6N A;  5JG6 A;  2Y1M A;  3ZNI A;  2NAA A;  3O47 A;  2FSA A;  1FBV A;  2LQ6 A;  4GB0 A;  4WA6 A;  3T9K A;  4B7Y C;  2XOY A;  5LCW B;  1WEP A;  3M63 A;  2EA6 A;  4IC2 A;  4FO9 A;  2VJE B;  4V3L C;  4LAD B;  1WEV A;  3T6R A;  4AYC A;  2MNY A;  2PUY A;  2VPG A;  4CCG X;  4GND A;  5TBN A;  2K1J A;  3U5P A;  5B75 A;  2E6S A;  1CHC A;  2L43 A;  5AIU A;  2P57 A;  2XOC A;  2MT5 A;  2MKE A;  2KWO A;  1DVP A;  5H1T A;  3HCS A;  2KIZ A;  5B79 A;  4YC9 A;  3ZVY A;  3KDE C;  3HCT A;  4I7D A;  2EGP A;  5D1K B;  2ECV A;  1XWH A;  5H1V A;  5K3Q A;  4A0C D;  2KWN A;  4X3G A;  2YT5 A;  4XI1 A;  3FJU B;  4B86 C;  2LDR A;  4A49 A;  2CSY A;  3PLW A;  3EB6 A;  2UZG A;  2OXQ C;  4FK5 A;  3C5K A;  2AN6 A;  2Y1N A;  3MHS A;  5SVX A;  5KH7 A;  2XOZ A;  3LRQ A;  2KE1 A;  2MNZ A;  1Z6U A;  4W4U A;  2DX8 A;  4YAT A;  1FP0 A;  4V3K C;  5TDW A;  2VPE A;  1MM2 A;  5EYA F;  3N9O A;  2L5U A;  4R2Y A;  1WGM A;  2FUI A;  1VD4 A;  2CRW A;  2CRR A;  4GNE A;  5FB0 A; 
#chains in the Genus database with same CATH homology
 1Z2Q A;  3DQV R;  3KQI A;  1T1H A;  2H0D B;  2KWK A;  2E6R A;  1MM3 A;  5LKT A;  3LQI A;  4PPE A;  2MD8 C;  4A4B A;  5LKU A;  2M1R A;  4WZ3 B;  2VJF B;  5H9M A;  2F42 A;  2IDA A;  4LLB A;  4L7X A;  2YSM A;  4MSX A;  2D8S A;  2YHN A;  3ZVZ B;  3O35 A;  3O36 A;  5FEY A;  2LN0 A;  4A4C A;  3LQJ A;  2K17 A;  1K2F A;  5J3X A;  4FIP A;  3I2D A;  3V43 A;  4S3O C;  1WIM A;  2YU4 A;  2HYE D;  2PNX A;  5TRB A;  2VPB A;  1LDK C;  5H1U A;  3U5N A;  2QIZ A;  4O64 A;  2JMI A;  3RPG C;  5D1L B;  2HDP A;  2EOD A;  3C6W A;  4R8P K;  1WEM A;  3N9P A;  1N87 A;  4LK9 A;  3L1Z B;  2VJE A;  3M99 A;  3PHD A;  2C2V S;  1LDJ B;  2MD7 B;  2G45 A;  2VP7 A;  3SOX A;  2RSD A;  2KGI A;  1Z60 A;  2JRJ A;  5LKZ A;  4UP0 A;  3KNV A;  3NG2 A;  3GV4 A;  1RMD A;  3IHP A;  5KH9 A;  3SHB A;  4YAB A;  2MUM A;  5FB1 A;  4CA1 A;  1JM7 B;  4ZUX U;  3O33 A;  3O37 A;  2YHO A;  3ZPV 1;  4BBQ A;  1WE9 A;  3N9Q A;  4BHW A;  3ZYQ A;  4N4F A;  3N9M A;  2M6M A;  5DIN A;  4TKP B;  2ECG A;  2YQL A;  3N9N A;  5C13 A;  5C11 A;  2YW8 A;  4F52 B;  3LQH A;  4NN2 A;  2ECW A;  4P5O B;  4GNG A;  4YAD A;  4PTB A;  3DPL R;  3T7L A;  3PUR A;  2K4D A;  1F62 A;  2YUR A;  4ZDT A;  5I3L A;  2C2L A;  1HYI A;  3U5O A;  1JOC A;  1VYX A;  4R7E A;  3SOU A;  2K16 A;  1BOR A;  4ZQL A;  5LKX A;  2XB1 A;  3GL6 A;  2LGK A;  5B78 A;  5TAB A;  4YBS A;  4WZ2 A;  1HYJ A;  3ZTG A;  2YSJ A;  3RTR B;  1JM7 A;  1E4U A;  3HTK C;  2G43 A;  3L11 A;  4FJC A;  1X4J A;  2M85 A;  5B8D A;  2YRE A;  1WEN A;  2L75 A;  2ECI A;  2ZET C;  4Q6F A;  1WEQ A;  2YQM A;  4LKA A;  2ECJ A;  2L0B A;  2JMJ A;  2YYR A;  2YUC A;  3ZPV E;  3O7A A;  3MHH A;  3ASL A;  2H0D A;  1WES A;  5TDR A;  5G05 B;  4N3W A;  5DKA A;  2VNF A;  3M62 A;  2LGG A;  4I7B A;  2CKL B;  2JMD A;  2ECT A;  2MIQ A;  5G04 B;  2VJF A;  1ZBD B;  4UI9 B;  1WIL A;  4QF2 A;  2LXP C;  2KFT A;  4AUQ B;  2M3H A;  3FL2 A;  3KV5 A;  1WFK A;  2KRE A;  5AIT A;  5KH3 A;  1VFY A;  2Y43 A;  2CT2 A;  2CSZ A;  3PUQ A;  4L58 A;  4YBM A;  4I7C A;  3U5M A;  3N9L A;  4AVX A;  2MA5 A;  2KU3 A;  2QJ0 A;  2LGL A;  5G0F A;  2G6Q A;  2LGV A;  4GNF A;  2QIC A;  3HCU A;  1V87 A;  1IYM A;  2LRI C;  3VK6 A;  1WEU A;  2KGG A;  1X4I A;  2XEU A;  4UP5 A;  2CKL A;  2BAY A;  2ECN A;  4LJN A;  4C9Z A;  2LV9 A;  5FER A;  1WEW A;  4MVT A;  4AP4 A;  2RI7 A;  2LXH C;  3QZV A;  2F6J A;  4YBT A;  3O70 A;  2KR4 A;  1X4U A;  5D1M B;  2I50 A;  1WEO A;  5B76 A;  4WZ0 A;  5B77 A;  3EB5 A;  3KV6 A;  4IC3 A;  4S3O B;  4YAX A;  1G25 A;  4AYC B;  2KWJ A;  3SOW A;  2VPD A;  1U6G B;  3L1X A;  4QF3 A;  3RPG B;  1WEE A;  2MA6 A;  2FUU A;  3O34 A;  2KYU A;  2L80 A;  2F6N A;  5JG6 A;  2Y1M A;  3ZNI A;  2NAA A;  2FSA A;  1FBV A;  2LQ6 A;  4GB0 A;  4WA6 A;  4B7Y C;  5LCW B;  1WEP A;  3M63 A;  2EA6 A;  4IC2 A;  4FO9 A;  2VJE B;  4V3L C;  4LAD B;  1WEV A;  3T6R A;  4AYC A;  2MNY A;  2PUY A;  2VPG A;  4CCG X;  4GND A;  5TBN A;  2K1J A;  3U5P A;  5B75 A;  2E6S A;  1CHC A;  2L43 A;  5AIU A;  2MT5 A;  2KWO A;  1DVP A;  5H1T A;  3HCS A;  2KIZ A;  5B79 A;  4YC9 A;  3ZVY A;  3HCT A;  4I7D A;  2EGP A;  5D1K B;  2ECV A;  1XWH A;  5H1V A;  4A0C D;  2KWN A;  4X3G A;  2YT5 A;  4XI1 A;  4B86 C;  2LDR A;  4A49 A;  2CSY A;  3EB6 A;  2UZG A;  2OXQ C;  4FK5 A;  3C5K A;  2AN6 A;  2Y1N A;  3MHS A;  5KH7 A;  3LRQ A;  2KE1 A;  2MNZ A;  1Z6U A;  4W4U A;  2DX8 A;  4YAT A;  1FP0 A;  4V3K C;  5TDW A;  2VPE A;  1MM2 A;  5EYA F;  3N9O A;  2L5U A;  4R2Y A;  1WGM A;  2FUI A;  1VD4 A;  4GNE A;  5FB0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...