4IC2A

Crystal structure of the xiap ring domain
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
62
structure length
62
Chain Sequence
ISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDKCPMCYTVITFKQKIFM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase XIAP
publication title Regulation of ubiquitin transfer by XIAP, a dimeric RING E3 ligase
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 62
sequence length 62
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4ic2A00
2M3HA 3ZNIA 2VPDA 3U5OA 5B77A 4YBMA 2M85A 2KR4A 2CKLA 3O70A 2YT5A 1MM2A 2Y1MA 4PTBA 2ECTA 2QJ0A 2K4DA 5AITA 4MSXA 2L43A 2LGKA 2K17A 4B7YC 1FBVA 4WA6A 4TKPB 5H1VA 2M1RA 4LK9A 2H0DB 5B8DA 2OXQC 2KGGA 4WZ3B 2HDPA 4ZUXU 4S3OB 3MHSA 3RPGB 2ZETC 3LQJA 2FUUA 3KNVA 3O36A 3NG2A 2KIZA 2YW8A 4GNDA 3N9MA 2CSZA 4AUQB 1HYIA 4A4CA 4UP0A 4IC3A 3IHPA 5H1UA 2EGPA 3U5PA 2RI7A 4B86C 1K2FA 4P5OB 2BAYA 2PNXA 2K1JA 2I50A 4FJCA 2G6QA 3M63A 2EA6A 3SOWA 2ECIA 3PUQA 4I7BA 1DVPA 2KGIA 5EYAF 2EODA 1MM3A 2E6RA 4R7EA 3ASLA 5KH3A 2YREA 4S3OC 5TDWA 5DINA 3RPGC 5FERA 4QF2A 1Z60A 5TABA 2MT5A 3GL6A 2QICA 4AYCA 3DQVR 2RSDA 3U5MA 2Y1NA 2YHOA 1WEVA 2YSJA 2HYED 2C2VS 2DX8A 4L58A 2YSMA 2JMJA 4FO9A 4W4UA 2L0BA 2MD8C 2YQLA 4BHWA 1WEPA 2MD7B 3SHBA 4I7DA 2CSYA 1IYMA 5B79A 3LRQA 4LLBA 2CT2A 1F62A 2IDAA 2MNYA 4PPEA 3O33A 1VFYA 3C6WA 3U5NA 2YQMA 4XI1A 3I2DA 3DPLR 4X3GA 4BBQA 2VJEA 2VPEA 1X4IA 1WENA 2VJFA 2K16A 3O7AA 2KWJA 1X4UA 5H1TA 4YBSA 3PHDA 1T1HA 3ZTGA 3KQIA 4AYCB 3RTRB 3N9OA 4IC2A 3T7LA 5D1LB 2FUIA 4AVXA 4GNEA 3PURA 4YBTA 1XWHA 1LDJB 3L1XA 5H9MA 2LDRA 1E4UA 1JM7A 1RMDA 2CKLB 2F6JA 2KYUA 4A0CD 2ECWA 2JMDA 3VK6A 5FB0A 1WFKA 2D8SA 1HYJA 3N9PA 3L1ZB 4NN2A 5AIUA 4O64A 4YABA 1FP0A 1WEQA 2MA6A 3KV6A 5FB1A 2KU3A 2PUYA 4V3KC 4CA1A 1WESA 2MIQA 2LV9A 4LJNA 2LQ6A 1WGMA 1LDKC 1WEUA 4LKAA 3ZVZB 2MUMA 1WILA 2LRIC 5LCWB 3V43A 1Z2QA 3N9NA 1ZBDB 1VYXA 2LGLA 4N4FA 5FEYA 1VD4A 5TRBA 3ZYQA 4YATA 2VNFA 3EB6A 3N9LA 3GV4A 2MA5A 2H0DA 3KV5A 1WIMA 2F42A 5TDRA 4MVTA 5JG6A 1U6GB 2KWOA 1WEOA 4F52B 3FL2A 4GNGA 3HCUA 1X4JA 3ZPV1 4FIPA 2LGGA 2VP7A 2ECNA 1WE9A 1JM7B 2JRJA 1V87A 5B75A 3O35A 1CHCA 2YYRA 2LGVA 3HCSA 5B76A 1N87A 5J3XA 4GB0A 5B78A 4R8PK 4L7XA 4I7CA 1WEWA 4ZDTA 1G25A 2MNZA 3O34A 4ZQLA 3HCTA 3M62A 4WZ0A 5KH7A 4AP4A 4Q6FA 3ZPVE 4R2YA 5G04B 4C9ZA 2M6MA 2ECJA 2G43A 5LKXA 5LKUA 2KFTA 5KH9A 2LXPC 3N9QA 5DKAA 3LQHA 5LKTA 2ECGA 2LXHC 2QIZA 2XB1A 5C13A 2XEUA 3T6RA 1JOCA 2KREA 2KWKA 4UP5A 3M99A 4A49A 3SOUA 5I3LA 5D1KB 4LADB 3SOXA 1BORA 2F6NA 2YHNA 4QF3A 5G05B 3HTKC 3O37A 2JMIA 2KE1A 2VPBA 2Y43A 5C11A 3L11A 4GNFA 4YC9A 5LKZA 2LN0A 2L75A 3ZVYA 5G0FA 3QZVA 2NAAA 2G45A 2VJEB 2VJFB 2VPGA 5TBNA 3LQIA 1Z6UA 2L5UA 3MHHA 2UZGA 2YUCA 2C2LA 2YU4A 2L80A 4FK5A 4WZ2A 4N3WA 2YURA 5D1MB 4V3LC 2KWNA 3EB5A 2ECVA 4YADA 4YAXA 1WEEA 4CCGX 4A4BA 3C5KA 2AN6A 2E6SA 4UI9B 2FSAA 1WEMA
chains in the Genus database with same CATH superfamily
2M3HA 2E61A 3ZNIA 2VPDA 3U5OA 5SVYA 5B77A 4YBMA 3FAOA 2M85A 2XOYA 2KR4A 2CKLA 3O70A 2YT5A 1MM2A 2D8UA 2Y1MA 4PTBA 2ECTA 2QJ0A 3LDYA 2K4DA 5AITA 4MSXA 2CONA 2L43A 2LGKA 2K17A 4B7YC 1FBVA 4WA6A 4TKPB 5H1VA 2M1RA 4LK9A 2H0DB 5B8DA 2OXQC 2KGGA 3LJUX 4WZ3B 2HDPA 2DJAA 4ZUXU 2FFWA 4S3OB 3MHSA 3RPGB 2ZETC 3LQJA 2FUUA 3KNVA 3O36A 3NG2A 2KIZA 2YW8A 1DCQA 4OGEA 4GNDA 3N9MA 2CSZA 1MBMA 4AUQB 1HYIA 4A4CA 4UP0A 4IC3A 3IHPA 5H1UA 2CSVA 2EGPA 4Z0OA 3U5PA 2RI7A 4B86C 1K2FA 4P5OB 2BAYA 2PNXA 2K1JA 2I50A 4FJCA 2G6QA 3M63A 2EA6A 3SOWA 2ECIA 3PUQA 2CRWA 4I7BA 1DVPA 2KGIA 2EODA 5EYAF 3H7HA 1MM3A 2E6RA 3FM8C 4R7EA 3ASLA 3SUBA 5KH3A 2EGMA 2YREA 3PLWA 4S3OC 5TDWA 5DINA 3RPGC 5FERA 4QF2A 1Z60A 5TABA 2MT5A 2CRRA 3GL6A 4O62A 2QICA 4AYCA 3DQVR 2RSDA 2M13A 3U5MA 2XOCA 2Y1NA 2YHOA 1WEVA 2YSJA 2HYED 2C2VS 2DX8A 4L58A 2YSMA 2JMJA 4FO9A 4W4UA 2L0BA 2MD8C 2YQLA 4BHWA 1WEPA 2MD7B 3SHBA 2OWAA 4I7DA 2CSYA 5K3QA 1IYMA 5B79A 3LRQA 5SVIB 4LLBA 2CT2A 1F62A 2IDAA 2MNYA 4PPEA 2FD4A 3O33A 1VFYA 3C6WA 3U5NA 2YQMA 4XI1A 3I2DA 4F1PA 3DPLR 4X3GA 4BBQA 2VJEA 2VPEA 1X4IA 1WENA 2VJFA 2K16A 3O7AA 3LVRE 2KWJA 1X4UA 5H1TA 4YBSA 3KDEC 3PHDA 2KKXA 1T1HA 3ZTGA 3KQIA 4AYCB 2RR4A 3RTRB 3N9OA 4IC2A 5D1LB 3T7LA 2FUIA 4AVXA 4GNEA 3DWDA 3PURA 4YBTA 1XWHA 1LDJB 3L1XA 5H9MA 2LDRA 3FANA 1E4UA 1JM7A 1RMDA 3LVQE 2KKYA 2CKLB 2F6JA 2KYUA 4A0CD 2ECWA 2JMDA 3O47A 3VK6A 5FB0A 1WFKA 2D8SA 1HYJA 3N9PA 3L1ZB 4NN2A 5AIUA 3T9KA 4O64A 4YABA 1FP0A 1WEQA 2MA6A 3KV6A 5FB1A 2KU3A 2PUYA 4V3KC 4CA1A 1WESA 2MIQA 2LV9A 4LJNA 2LQ6A 2JM3A 1WGMA 1LDKC 1WEUA 4LKAA 3ZVZB 2MUMA 1WILA 2B0OE 2LRIC 3Q1DA 5LCWB 1Z2QA 3N9NA 3V43A 1ZBDB 1VYXA 2LGLA 4N4FA 5FEYA 1VD4A 2P57A 5TRBA 5SVXA 3ZYQA 4YATA 2VNFA 3N9LA 3EB6A 3GV4A 2MA5A 3MDBC 2H0DA 3KV5A 1WIMA 2YVRA 2F42A 5TDRA 4MVTA 5JG6A 1U6GB 2XOZA 2KWOA 3E2DA 1WEOA 4F52B 3FL2A 4GNGA 3HCUA 1X4JA 3ZPV1 4FIPA 2LGGA 2VP7A 2ECNA 1WE9A 3JUEA 1JM7B 2JRJA 1V87A 5B75A 2IQJA 3O35A 1CHCA 2YYRA 2LGVA 3HCSA 5B76A 4Z0RA 1N87A 5J3XA 4GB0A 5B78A 4R8PK 4L7XA 4I7CA 1WEWA 2MKEA 4ZDTA 1G25A 2MNZA 3O34A 4ZQLA 3HCTA 3M62A 4WZ0A 5KH7A 2EXUA 4H9DA 4AP4A 3M7KA 3FJUB 4Q6FA 3ZPVE 4R2YA 5G04B 4C9ZA 2M6MA 2LAUA 2ECJA 2G43A 3DDTA 5LKXA 5LKUA 2KFTA 5KH9A 2LXPC 3N9QA 5DKAA 3LQHA 5LKTA 2ECGA 2LXHC 2QIZA 2XB1A 5C13A 2XEUA 3T6RA 1JOCA 2KREA 2KWKA 4UP5A 3M99A 4A49A 3SOUA 5I3LA 5D1KB 4LADB 3SOXA 1BORA 2F6NA 2YHNA 4QF3A 5G05B 3HTKC 3O37A 2JMIA 2KE1A 2VPBA 2Y43A 5C11A 3L11A 4GNFA 4YC9A 5LKZA 5SVIA 2LN0A 2L75A 4QQ4A 3ZVYA 5G0FA 3QZVA 2NAAA 2G45A 2VJEB 2VJFB 2VPGA 4OGCA 5TBNA 3LQIA 1Z6UA 2L5UA 3MHHA 2UZGA 2YUCA 2C2LA 2YU4A 2XP0A 2L80A 4FK5A 3FEHA 4WZ2A 4N3WA 2YURA 5D1MB 4V3LC 2KWNA 3EB5A 2ECVA 2JUNA 4YADA 4YAXA 1WEEA 2L7PA 4CCGX 4A4BA 3C5KA 2AN6A 2E6SA 4UI9B 2FSAA 2DSMA 1WEMA
chains in the Genus database with same CATH topology
2M3HA 3ZNIA 2VPDA 3U5OA 5B77A 4YBMA 2M85A 2KR4A 2CKLA 3O70A 2YT5A 1MM2A 2Y1MA 4PTBA 2ECTA 2QJ0A 2K4DA 5AITA 4MSXA 2L43A 2LGKA 2K17A 4B7YC 1FBVA 4WA6A 4TKPB 5H1VA 2M1RA 4LK9A 2H0DB 5B8DA 2OXQC 2KGGA 4WZ3B 2HDPA 4ZUXU 4S3OB 3MHSA 3RPGB 2ZETC 3LQJA 2FUUA 3KNVA 3O36A 3NG2A 2KIZA 2YW8A 4GNDA 3N9MA 2CSZA 4AUQB 1HYIA 4A4CA 4UP0A 4IC3A 3IHPA 5H1UA 2EGPA 3U5PA 2RI7A 4B86C 1K2FA 4P5OB 2BAYA 2PNXA 2K1JA 2I50A 4FJCA 2G6QA 3M63A 2EA6A 3SOWA 2ECIA 3PUQA 4I7BA 1DVPA 2KGIA 5EYAF 2EODA 1MM3A 2E6RA 4R7EA 3ASLA 5KH3A 2YREA 4S3OC 5TDWA 5DINA 3RPGC 5FERA 4QF2A 1Z60A 5TABA 2MT5A 3GL6A 2QICA 4AYCA 3DQVR 2RSDA 3U5MA 2Y1NA 2YHOA 1WEVA 2YSJA 2HYED 2C2VS 2DX8A 4L58A 2YSMA 2JMJA 4FO9A 4W4UA 2L0BA 2MD8C 2YQLA 4BHWA 1WEPA 2MD7B 3SHBA 4I7DA 2CSYA 1IYMA 5B79A 3LRQA 4LLBA 2CT2A 1F62A 2IDAA 2MNYA 4PPEA 3O33A 1VFYA 3C6WA 3U5NA 2YQMA 4XI1A 3I2DA 3DPLR 4X3GA 4BBQA 2VJEA 2VPEA 1X4IA 1WENA 2VJFA 2K16A 3O7AA 2KWJA 1X4UA 5H1TA 4YBSA 3PHDA 1T1HA 3ZTGA 3KQIA 4AYCB 3RTRB 3N9OA 4IC2A 3T7LA 5D1LB 2FUIA 4AVXA 4GNEA 3PURA 4YBTA 1XWHA 1LDJB 3L1XA 5H9MA 2LDRA 1E4UA 1JM7A 1RMDA 2CKLB 2F6JA 2KYUA 4A0CD 2ECWA 2JMDA 3VK6A 5FB0A 1WFKA 2D8SA 1HYJA 3N9PA 3L1ZB 4NN2A 5AIUA 4O64A 4YABA 1FP0A 1WEQA 2MA6A 3KV6A 5FB1A 2KU3A 2PUYA 4V3KC 4CA1A 1WESA 2MIQA 2LV9A 4LJNA 2LQ6A 1WGMA 1LDKC 1WEUA 4LKAA 3ZVZB 2MUMA 1WILA 2LRIC 5LCWB 3V43A 1Z2QA 3N9NA 1ZBDB 1VYXA 2LGLA 4N4FA 5FEYA 1VD4A 5TRBA 3ZYQA 4YATA 2VNFA 3EB6A 3N9LA 3GV4A 2MA5A 2H0DA 3KV5A 1WIMA 2F42A 5TDRA 4MVTA 5JG6A 1U6GB 2KWOA 1WEOA 4F52B 3FL2A 4GNGA 3HCUA 1X4JA 3ZPV1 4FIPA 2LGGA 2VP7A 2ECNA 1WE9A 1JM7B 2JRJA 1V87A 5B75A 3O35A 1CHCA 2YYRA 2LGVA 3HCSA 5B76A 1N87A 5J3XA 4GB0A 5B78A 4R8PK 4L7XA 4I7CA 1WEWA 4ZDTA 1G25A 2MNZA 3O34A 4ZQLA 3HCTA 3M62A 4WZ0A 5KH7A 4AP4A 4Q6FA 3ZPVE 4R2YA 5G04B 4C9ZA 2M6MA 2ECJA 2G43A 5LKXA 5LKUA 2KFTA 5KH9A 2LXPC 3N9QA 5DKAA 3LQHA 5LKTA 2ECGA 2LXHC 2QIZA 2XB1A 5C13A 2XEUA 3T6RA 1JOCA 2KREA 2KWKA 4UP5A 3M99A 4A49A 3SOUA 5I3LA 5D1KB 4LADB 3SOXA 1BORA 2F6NA 2YHNA 4QF3A 5G05B 3HTKC 3O37A 2JMIA 2KE1A 2VPBA 2Y43A 5C11A 3L11A 4GNFA 4YC9A 5LKZA 2LN0A 2L75A 3ZVYA 5G0FA 3QZVA 2NAAA 2G45A 2VJEB 2VJFB 2VPGA 5TBNA 3LQIA 1Z6UA 2L5UA 3MHHA 2UZGA 2YUCA 2C2LA 2YU4A 2L80A 4FK5A 4WZ2A 4N3WA 2YURA 5D1MB 4V3LC 2KWNA 3EB5A 2ECVA 4YADA 4YAXA 1WEEA 4CCGX 4A4BA 3C5KA 2AN6A 2E6SA 4UI9B 2FSAA 1WEMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M3H A;  3ZNI A;  2VPD A;  3U5O A;  5B77 A;  4YBM A;  2M85 A;  2KR4 A;  2CKL A;  3O70 A;  2YT5 A;  1MM2 A;  2Y1M A;  4PTB A;  2ECT A;  2QJ0 A;  2K4D A;  5AIT A;  4MSX A;  2L43 A;  2LGK A;  2K17 A;  4B7Y C;  1FBV A;  4WA6 A;  4TKP B;  5H1V A;  2M1R A;  4LK9 A;  2H0D B;  5B8D A;  2OXQ C;  2KGG A;  4WZ3 B;  2HDP A;  4ZUX U;  4S3O B;  3MHS A;  3RPG B;  2ZET C;  3LQJ A;  2FUU A;  3KNV A;  3O36 A;  3NG2 A;  2KIZ A;  2YW8 A;  4GND A;  3N9M A;  2CSZ A;  4AUQ B;  1HYI A;  4A4C A;  4UP0 A;  4IC3 A;  3IHP A;  5H1U A;  2EGP A;  3U5P A;  2RI7 A;  4B86 C;  1K2F A;  4P5O B;  2BAY A;  2PNX A;  2K1J A;  2I50 A;  4FJC A;  2G6Q A;  3M63 A;  2EA6 A;  3SOW A;  2ECI A;  3PUQ A;  4I7B A;  1DVP A;  2KGI A;  5EYA F;  2EOD A;  1MM3 A;  2E6R A;  4R7E A;  3ASL A;  5KH3 A;  2YRE A;  4S3O C;  5TDW A;  5DIN A;  3RPG C;  5FER A;  4QF2 A;  1Z60 A;  5TAB A;  2MT5 A;  3GL6 A;  2QIC A;  4AYC A;  3DQV R;  2RSD A;  3U5M A;  2Y1N A;  2YHO A;  1WEV A;  2YSJ A;  2HYE D;  2C2V S;  2DX8 A;  4L58 A;  2YSM A;  2JMJ A;  4FO9 A;  4W4U A;  2L0B A;  2MD8 C;  2YQL A;  4BHW A;  1WEP A;  2MD7 B;  3SHB A;  4I7D A;  2CSY A;  1IYM A;  5B79 A;  3LRQ A;  4LLB A;  2CT2 A;  1F62 A;  2IDA A;  2MNY A;  4PPE A;  3O33 A;  1VFY A;  3C6W A;  3U5N A;  2YQM A;  4XI1 A;  3I2D A;  3DPL R;  4X3G A;  4BBQ A;  2VJE A;  2VPE A;  1X4I A;  1WEN A;  2VJF A;  2K16 A;  3O7A A;  2KWJ A;  1X4U A;  5H1T A;  4YBS A;  3PHD A;  1T1H A;  3ZTG A;  3KQI A;  4AYC B;  3RTR B;  3N9O A;  4IC2 A;  3T7L A;  5D1L B;  2FUI A;  4AVX A;  4GNE A;  3PUR A;  4YBT A;  1XWH A;  1LDJ B;  3L1X A;  5H9M A;  2LDR A;  1E4U A;  1JM7 A;  1RMD A;  2CKL B;  2F6J A;  2KYU A;  4A0C D;  2ECW A;  2JMD A;  3VK6 A;  5FB0 A;  1WFK A;  2D8S A;  1HYJ A;  3N9P A;  3L1Z B;  4NN2 A;  5AIU A;  4O64 A;  4YAB A;  1FP0 A;  1WEQ A;  2MA6 A;  3KV6 A;  5FB1 A;  2KU3 A;  2PUY A;  4V3K C;  4CA1 A;  1WES A;  2MIQ A;  2LV9 A;  4LJN A;  2LQ6 A;  1WGM A;  1LDK C;  1WEU A;  4LKA A;  3ZVZ B;  2MUM A;  1WIL A;  2LRI C;  5LCW B;  3V43 A;  1Z2Q A;  3N9N A;  1ZBD B;  1VYX A;  2LGL A;  4N4F A;  5FEY A;  1VD4 A;  5TRB A;  3ZYQ A;  4YAT A;  2VNF A;  3EB6 A;  3N9L A;  3GV4 A;  2MA5 A;  2H0D A;  3KV5 A;  1WIM A;  2F42 A;  5TDR A;  4MVT A;  5JG6 A;  1U6G B;  2KWO A;  1WEO A;  4F52 B;  3FL2 A;  4GNG A;  3HCU A;  1X4J A;  3ZPV 1;  4FIP A;  2LGG A;  2VP7 A;  2ECN A;  1WE9 A;  1JM7 B;  2JRJ A;  1V87 A;  5B75 A;  3O35 A;  1CHC A;  2YYR A;  2LGV A;  3HCS A;  5B76 A;  1N87 A;  5J3X A;  4GB0 A;  5B78 A;  4R8P K;  4L7X A;  4I7C A;  1WEW A;  4ZDT A;  1G25 A;  2MNZ A;  3O34 A;  4ZQL A;  3HCT A;  3M62 A;  4WZ0 A;  5KH7 A;  4AP4 A;  4Q6F A;  3ZPV E;  4R2Y A;  5G04 B;  4C9Z A;  2M6M A;  2ECJ A;  2G43 A;  5LKX A;  5LKU A;  2KFT A;  5KH9 A;  2LXP C;  3N9Q A;  5DKA A;  3LQH A;  5LKT A;  2ECG A;  2LXH C;  2QIZ A;  2XB1 A;  5C13 A;  2XEU A;  3T6R A;  1JOC A;  2KRE A;  2KWK A;  4UP5 A;  3M99 A;  4A49 A;  3SOU A;  5I3L A;  5D1K B;  4LAD B;  3SOX A;  1BOR A;  2F6N A;  2YHN A;  4QF3 A;  5G05 B;  3HTK C;  3O37 A;  2JMI A;  2KE1 A;  2VPB A;  2Y43 A;  5C11 A;  3L11 A;  4GNF A;  4YC9 A;  5LKZ A;  2LN0 A;  2L75 A;  3ZVY A;  5G0F A;  3QZV A;  2NAA A;  2G45 A;  2VJE B;  2VJF B;  2VPG A;  5TBN A;  3LQI A;  1Z6U A;  2L5U A;  3MHH A;  2UZG A;  2YUC A;  2C2L A;  2YU4 A;  2L80 A;  4FK5 A;  4WZ2 A;  4N3W A;  2YUR A;  5D1M B;  4V3L C;  2KWN A;  3EB5 A;  2ECV A;  4YAD A;  4YAX A;  1WEE A;  4CCG X;  4A4B A;  3C5K A;  2AN6 A;  2E6S A;  4UI9 B;  2FSA A;  1WEM A; 
#chains in the Genus database with same CATH topology
 2M3H A;  2E61 A;  3ZNI A;  2VPD A;  3U5O A;  5SVY A;  5B77 A;  4YBM A;  3FAO A;  2M85 A;  2XOY A;  2KR4 A;  2CKL A;  3O70 A;  2YT5 A;  1MM2 A;  2D8U A;  2Y1M A;  4PTB A;  2ECT A;  2QJ0 A;  3LDY A;  2K4D A;  5AIT A;  4MSX A;  2CON A;  2L43 A;  2LGK A;  2K17 A;  4B7Y C;  1FBV A;  4WA6 A;  4TKP B;  5H1V A;  2M1R A;  4LK9 A;  2H0D B;  5B8D A;  2OXQ C;  2KGG A;  3LJU X;  4WZ3 B;  2HDP A;  2DJA A;  4ZUX U;  2FFW A;  4S3O B;  3MHS A;  3RPG B;  2ZET C;  3LQJ A;  2FUU A;  3KNV A;  3O36 A;  3NG2 A;  2KIZ A;  2YW8 A;  1DCQ A;  4OGE A;  4GND A;  3N9M A;  2CSZ A;  1MBM A;  4AUQ B;  1HYI A;  4A4C A;  4UP0 A;  4IC3 A;  3IHP A;  5H1U A;  2CSV A;  2EGP A;  4Z0O A;  3U5P A;  2RI7 A;  4B86 C;  1K2F A;  4P5O B;  2BAY A;  2PNX A;  2K1J A;  2I50 A;  4FJC A;  2G6Q A;  3M63 A;  2EA6 A;  3SOW A;  2ECI A;  3PUQ A;  2CRW A;  4I7B A;  1DVP A;  2KGI A;  2EOD A;  5EYA F;  3H7H A;  1MM3 A;  2E6R A;  3FM8 C;  4R7E A;  3ASL A;  3SUB A;  5KH3 A;  2EGM A;  2YRE A;  3PLW A;  4S3O C;  5TDW A;  5DIN A;  3RPG C;  5FER A;  4QF2 A;  1Z60 A;  5TAB A;  2MT5 A;  2CRR A;  3GL6 A;  4O62 A;  2QIC A;  4AYC A;  3DQV R;  2RSD A;  2M13 A;  3U5M A;  2XOC A;  2Y1N A;  2YHO A;  1WEV A;  2YSJ A;  2HYE D;  2C2V S;  2DX8 A;  4L58 A;  2YSM A;  2JMJ A;  4FO9 A;  4W4U A;  2L0B A;  2MD8 C;  2YQL A;  4BHW A;  1WEP A;  2MD7 B;  3SHB A;  2OWA A;  4I7D A;  2CSY A;  5K3Q A;  1IYM A;  5B79 A;  3LRQ A;  5SVI B;  4LLB A;  2CT2 A;  1F62 A;  2IDA A;  2MNY A;  4PPE A;  2FD4 A;  3O33 A;  1VFY A;  3C6W A;  3U5N A;  2YQM A;  4XI1 A;  3I2D A;  4F1P A;  3DPL R;  4X3G A;  4BBQ A;  2VJE A;  2VPE A;  1X4I A;  1WEN A;  2VJF A;  2K16 A;  3O7A A;  3LVR E;  2KWJ A;  1X4U A;  5H1T A;  4YBS A;  3KDE C;  3PHD A;  2KKX A;  1T1H A;  3ZTG A;  3KQI A;  4AYC B;  2RR4 A;  3RTR B;  3N9O A;  4IC2 A;  5D1L B;  3T7L A;  2FUI A;  4AVX A;  4GNE A;  3DWD A;  3PUR A;  4YBT A;  1XWH A;  1LDJ B;  3L1X A;  5H9M A;  2LDR A;  3FAN A;  1E4U A;  1JM7 A;  1RMD A;  3LVQ E;  2KKY A;  2CKL B;  2F6J A;  2KYU A;  4A0C D;  2ECW A;  2JMD A;  3O47 A;  3VK6 A;  5FB0 A;  1WFK A;  2D8S A;  1HYJ A;  3N9P A;  3L1Z B;  4NN2 A;  5AIU A;  3T9K A;  4O64 A;  4YAB A;  1FP0 A;  1WEQ A;  2MA6 A;  3KV6 A;  5FB1 A;  2KU3 A;  2PUY A;  4V3K C;  4CA1 A;  1WES A;  2MIQ A;  2LV9 A;  4LJN A;  2LQ6 A;  2JM3 A;  1WGM A;  1LDK C;  1WEU A;  4LKA A;  3ZVZ B;  2MUM A;  1WIL A;  2B0O E;  2LRI C;  3Q1D A;  5LCW B;  1Z2Q A;  3N9N A;  3V43 A;  1ZBD B;  1VYX A;  2LGL A;  4N4F A;  5FEY A;  1VD4 A;  2P57 A;  5TRB A;  5SVX A;  3ZYQ A;  4YAT A;  2VNF A;  3N9L A;  3EB6 A;  3GV4 A;  2MA5 A;  3MDB C;  2H0D A;  3KV5 A;  1WIM A;  2YVR A;  2F42 A;  5TDR A;  4MVT A;  5JG6 A;  1U6G B;  2XOZ A;  2KWO A;  3E2D A;  1WEO A;  4F52 B;  3FL2 A;  4GNG A;  3HCU A;  1X4J A;  3ZPV 1;  4FIP A;  2LGG A;  2VP7 A;  2ECN A;  1WE9 A;  3JUE A;  1JM7 B;  2JRJ A;  1V87 A;  5B75 A;  2IQJ A;  3O35 A;  1CHC A;  2YYR A;  2LGV A;  3HCS A;  5B76 A;  4Z0R A;  1N87 A;  5J3X A;  4GB0 A;  5B78 A;  4R8P K;  4L7X A;  4I7C A;  1WEW A;  2MKE A;  4ZDT A;  1G25 A;  2MNZ A;  3O34 A;  4ZQL A;  3HCT A;  3M62 A;  4WZ0 A;  5KH7 A;  2EXU A;  4H9D A;  4AP4 A;  3M7K A;  3FJU B;  4Q6F A;  3ZPV E;  4R2Y A;  5G04 B;  4C9Z A;  2M6M A;  2LAU A;  2ECJ A;  2G43 A;  3DDT A;  5LKX A;  5LKU A;  2KFT A;  5KH9 A;  2LXP C;  3N9Q A;  5DKA A;  3LQH A;  5LKT A;  2ECG A;  2LXH C;  2QIZ A;  2XB1 A;  5C13 A;  2XEU A;  3T6R A;  1JOC A;  2KRE A;  2KWK A;  4UP5 A;  3M99 A;  4A49 A;  3SOU A;  5I3L A;  5D1K B;  4LAD B;  3SOX A;  1BOR A;  2F6N A;  2YHN A;  4QF3 A;  5G05 B;  3HTK C;  3O37 A;  2JMI A;  2KE1 A;  2VPB A;  2Y43 A;  5C11 A;  3L11 A;  4GNF A;  4YC9 A;  5LKZ A;  5SVI A;  2LN0 A;  2L75 A;  4QQ4 A;  3ZVY A;  5G0F A;  3QZV A;  2NAA A;  2G45 A;  2VJE B;  2VJF B;  2VPG A;  4OGC A;  5TBN A;  3LQI A;  1Z6U A;  2L5U A;  3MHH A;  2UZG A;  2YUC A;  2C2L A;  2YU4 A;  2XP0 A;  2L80 A;  4FK5 A;  3FEH A;  4WZ2 A;  4N3W A;  2YUR A;  5D1M B;  4V3L C;  2KWN A;  3EB5 A;  2ECV A;  2JUN A;  4YAD A;  4YAX A;  1WEE A;  2L7P A;  4CCG X;  4A4B A;  3C5K A;  2AN6 A;  2E6S A;  4UI9 B;  2FSA A;  2DSM A;  1WEM A; 
#chains in the Genus database with same CATH homology
 2M3H A;  3ZNI A;  2VPD A;  3U5O A;  5B77 A;  4YBM A;  2M85 A;  2KR4 A;  2CKL A;  3O70 A;  2YT5 A;  1MM2 A;  2Y1M A;  4PTB A;  2ECT A;  2QJ0 A;  2K4D A;  5AIT A;  4MSX A;  2L43 A;  2LGK A;  2K17 A;  4B7Y C;  1FBV A;  4WA6 A;  4TKP B;  5H1V A;  2M1R A;  4LK9 A;  2H0D B;  5B8D A;  2OXQ C;  2KGG A;  4WZ3 B;  2HDP A;  4ZUX U;  4S3O B;  3MHS A;  3RPG B;  2ZET C;  3LQJ A;  2FUU A;  3KNV A;  3O36 A;  3NG2 A;  2KIZ A;  2YW8 A;  4GND A;  3N9M A;  2CSZ A;  4AUQ B;  1HYI A;  4A4C A;  4UP0 A;  4IC3 A;  3IHP A;  5H1U A;  2EGP A;  3U5P A;  2RI7 A;  4B86 C;  1K2F A;  4P5O B;  2BAY A;  2PNX A;  2K1J A;  2I50 A;  4FJC A;  2G6Q A;  3M63 A;  2EA6 A;  3SOW A;  2ECI A;  3PUQ A;  4I7B A;  1DVP A;  2KGI A;  5EYA F;  2EOD A;  1MM3 A;  2E6R A;  4R7E A;  3ASL A;  5KH3 A;  2YRE A;  4S3O C;  5TDW A;  5DIN A;  3RPG C;  5FER A;  4QF2 A;  1Z60 A;  5TAB A;  2MT5 A;  3GL6 A;  2QIC A;  4AYC A;  3DQV R;  2RSD A;  3U5M A;  2Y1N A;  2YHO A;  1WEV A;  2YSJ A;  2HYE D;  2C2V S;  2DX8 A;  4L58 A;  2YSM A;  2JMJ A;  4FO9 A;  4W4U A;  2L0B A;  2MD8 C;  2YQL A;  4BHW A;  1WEP A;  2MD7 B;  3SHB A;  4I7D A;  2CSY A;  1IYM A;  5B79 A;  3LRQ A;  4LLB A;  2CT2 A;  1F62 A;  2IDA A;  2MNY A;  4PPE A;  3O33 A;  1VFY A;  3C6W A;  3U5N A;  2YQM A;  4XI1 A;  3I2D A;  3DPL R;  4X3G A;  4BBQ A;  2VJE A;  2VPE A;  1X4I A;  1WEN A;  2VJF A;  2K16 A;  3O7A A;  2KWJ A;  1X4U A;  5H1T A;  4YBS A;  3PHD A;  1T1H A;  3ZTG A;  3KQI A;  4AYC B;  3RTR B;  3N9O A;  4IC2 A;  3T7L A;  5D1L B;  2FUI A;  4AVX A;  4GNE A;  3PUR A;  4YBT A;  1XWH A;  1LDJ B;  3L1X A;  5H9M A;  2LDR A;  1E4U A;  1JM7 A;  1RMD A;  2CKL B;  2F6J A;  2KYU A;  4A0C D;  2ECW A;  2JMD A;  3VK6 A;  5FB0 A;  1WFK A;  2D8S A;  1HYJ A;  3N9P A;  3L1Z B;  4NN2 A;  5AIU A;  4O64 A;  4YAB A;  1FP0 A;  1WEQ A;  2MA6 A;  3KV6 A;  5FB1 A;  2KU3 A;  2PUY A;  4V3K C;  4CA1 A;  1WES A;  2MIQ A;  2LV9 A;  4LJN A;  2LQ6 A;  1WGM A;  1LDK C;  1WEU A;  4LKA A;  3ZVZ B;  2MUM A;  1WIL A;  2LRI C;  5LCW B;  3V43 A;  1Z2Q A;  3N9N A;  1ZBD B;  1VYX A;  2LGL A;  4N4F A;  5FEY A;  1VD4 A;  5TRB A;  3ZYQ A;  4YAT A;  2VNF A;  3EB6 A;  3N9L A;  3GV4 A;  2MA5 A;  2H0D A;  3KV5 A;  1WIM A;  2F42 A;  5TDR A;  4MVT A;  5JG6 A;  1U6G B;  2KWO A;  1WEO A;  4F52 B;  3FL2 A;  4GNG A;  3HCU A;  1X4J A;  3ZPV 1;  4FIP A;  2LGG A;  2VP7 A;  2ECN A;  1WE9 A;  1JM7 B;  2JRJ A;  1V87 A;  5B75 A;  3O35 A;  1CHC A;  2YYR A;  2LGV A;  3HCS A;  5B76 A;  1N87 A;  5J3X A;  4GB0 A;  5B78 A;  4R8P K;  4L7X A;  4I7C A;  1WEW A;  4ZDT A;  1G25 A;  2MNZ A;  3O34 A;  4ZQL A;  3HCT A;  3M62 A;  4WZ0 A;  5KH7 A;  4AP4 A;  4Q6F A;  3ZPV E;  4R2Y A;  5G04 B;  4C9Z A;  2M6M A;  2ECJ A;  2G43 A;  5LKX A;  5LKU A;  2KFT A;  5KH9 A;  2LXP C;  3N9Q A;  5DKA A;  3LQH A;  5LKT A;  2ECG A;  2LXH C;  2QIZ A;  2XB1 A;  5C13 A;  2XEU A;  3T6R A;  1JOC A;  2KRE A;  2KWK A;  4UP5 A;  3M99 A;  4A49 A;  3SOU A;  5I3L A;  5D1K B;  4LAD B;  3SOX A;  1BOR A;  2F6N A;  2YHN A;  4QF3 A;  5G05 B;  3HTK C;  3O37 A;  2JMI A;  2KE1 A;  2VPB A;  2Y43 A;  5C11 A;  3L11 A;  4GNF A;  4YC9 A;  5LKZ A;  2LN0 A;  2L75 A;  3ZVY A;  5G0F A;  3QZV A;  2NAA A;  2G45 A;  2VJE B;  2VJF B;  2VPG A;  5TBN A;  3LQI A;  1Z6U A;  2L5U A;  3MHH A;  2UZG A;  2YUC A;  2C2L A;  2YU4 A;  2L80 A;  4FK5 A;  4WZ2 A;  4N3W A;  2YUR A;  5D1M B;  4V3L C;  2KWN A;  3EB5 A;  2ECV A;  4YAD A;  4YAX A;  1WEE A;  4CCG X;  4A4B A;  3C5K A;  2AN6 A;  2E6S A;  4UI9 B;  2FSA A;  1WEM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...