4IC2A

Crystal structure of the xiap ring domain
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
62
structure length
62
Chain Sequence
b'ISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDKCPMCYTVITFKQKIFM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase XIAP
publication title Regulation of ubiquitin transfer by XIAP, a dimeric RING E3 ligase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 15
structure length 62
sequence length 62
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4ic2A00
2BAYA 1CHCA 3HTKC 5D1KB 2MT5A 5EYAF 1WE9A 4BBQA 5C13A 3DPLR 1Z6UA 4XI1A 2YU4A 3ZNIA 3EB6A 4A49A 2QJ0A 4O64A 1IYMA 4LK9A 4R2YA 5FB1A 4YAXA 2Y1MA 2LXPC 4GNGA 2LGVA 4A0CD 4P5OB 4I7BA 2VJEB 4S3OB 2KGIA 3KNVA 3RTRB 1RMDA 2KYUA 3LQHA 1HYIA 4AP4A 2E6RA 4GB0A 4WA6A 2YSJA 1BORA 5DINA 4PPEA 3M99A 2LQ6A 4GNDA 3N9QA 1N87A 2CKLB 5AITA 2VPGA 3KV5A 2ECGA 4QF3A 1LDKC 2CSZA 4S3OC 3N9LA 2I50A 3V43A 5B76A 3LRQA 2KFTA 1T1HA 1WENA 2FSAA 2CT2A 2L5UA 3MHSA 4ZDTA 2C2VS 2YW8A 2JMIA 2MUMA 3O7AA 2NAAA 1WESA 2MD7B 2L75A 2LDRA 2KWNA 3HCSA 3QZVA 4IC3A 5I3LA 3HCTA 5TDWA 3N9OA 3M63A 5H1VA 2F6JA 3N9NA 5G0FA 2FUUA 5TBNA 2YQLA 2D8SA 2YHNA 2KREA 2VPDA 1ZBDB 2VJFA 5J3XA 2F6NA 3C5KA 2L80A 5KH3A 2EA6A 2ECWA 4I7CA 2ECVA 4AVXA 2KIZA 2VNFA 4N4FA 1WFKA 2PNXA 4YBMA 1G25A 2Y43A 4Q6FA 2VPEA 1JOCA 4V3LC 4AYCB 1E4UA 3IHPA 2H0DA 1X4JA 2UZGA 3O37A 3DQVR 5LKUA 2G43A 4CA1A 2YURA 2YSMA 4ZUXU 2LRIC 3L1XA 4YC9A 3RPGB 2QIZA 4B86C 3ZVZB 4LKAA 1VD4A 4FJCA 1HYJA 3FL2A 4PTBA 3N9MA 3M62A 2QICA 1WEVA 1LDJB 2XB1A 5KH9A 3U5OA 4X3GA 2VP7A 5D1MB 4MSXA 2LGGA 3O70A 1WGMA 1JM7B 3LQIA 3NG2A 3RPGC 2YHOA 1VYXA 2IDAA 5LCWB 2G6QA 4LJNA 2MA5A 4WZ0A 4WZ3B 5TDRA 4YABA 5B77A 2EODA 2JMJA 2VJEA 2YQMA 4A4CA 4B7YC 2LGKA 5B79A 3MHHA 4L7XA 2K1JA 5H1TA 2EGPA 2M85A 5TABA 4UP0A 2G45A 4YBTA 2L43A 1WILA 2DX8A 2ECJA 4W4UA 1K2FA 2JMDA 3C6WA 4AUQB 4LADB 2CKLA 2ZETC 2KWKA 4QF2A 2YT5A 3SOUA 2LXHC 2L0BA 4WZ2A 2HDPA 4NN2A 4R8PK 4V3KC 2K4DA 3VK6A 1WEWA 3KV6A 1WEUA 2PUYA 4FK5A 2RI7A 3HCUA 3SHBA 2Y1NA 1X4UA 2KWOA 3PURA 4LLBA 3ZYQA 2M3HA 3O33A 5LKZA 1U6GB 4YADA 2MD8C 4YATA 2RSDA 3N9PA 2OXQC 3T6RA 1VFYA 1WEEA 2JRJA 5FB0A 5B75A 2KWJA 5H9MA 4MVTA 3O36A 4I7DA 2CSYA 2K16A 3LQJA 2E6SA 4CCGX 3SOWA 1WIMA 2F42A 4A4BA 5AIUA 4BHWA 1FBVA 2MNZA 3GL6A 5JG6A 1WEMA 3L1ZB 1Z60A 2ECTA 1MM3A 2LN0A 2XEUA 4GNFA 4UP5A 4AYCA 3O34A 2YUCA 5FEYA 4FIPA 4ZQLA 2ECNA 2YYRA 1MM2A 2MA6A 5KH7A 5LKXA 2HYED 2VJFB 3SOXA 1V87A 3I2DA 3KQIA 2C2LA 2ECIA 3EB5A 5B78A 2KU3A 5C11A 4FO9A 3L11A 5G04B 3ZVYA 4N3WA 4C9ZA 2KE1A 1XWHA 2FUIA 5G05B 4IC2A 3ASLA 2M1RA 1WEOA 2MNYA 3PHDA 2H0DB 2AN6A 3U5PA 2YREA 5LKTA 1Z2QA 3GV4A 2LV9A 4L58A 5TRBA 2KGGA 2MIQA 5H1UA 4UI9B 3PUQA 2LGLA 4GNEA 2VPBA 1X4IA 4YBSA 5B8DA 1F62A 5DKAA 1WEQA 1JM7A 4F52B 5FERA 3O35A 4TKPB 2M6MA 1WEPA 3U5NA 3T7LA 4R7EA 2K17A 1FP0A 3ZTGA 2KR4A 3ZPV1 3ZPVE 3U5MA 5D1LB 1DVPA
chains in the Genus database with same CATH superfamily
2BAYA 1CHCA 3HTKC 5D1KB 2MT5A 5EYAF 1WE9A 4BBQA 5SVIA 3H7HA 5C13A 3DPLR 1Z6UA 4XI1A 2YU4A 3ZNIA 3EB6A 4A49A 2QJ0A 4O64A 1IYMA 2EGMA 4LK9A 4R2YA 5FB1A 4YAXA 2Y1MA 2LXPC 4GNGA 2LGVA 4A0CD 4P5OB 4I7BA 2VJEB 4S3OB 2KGIA 3KNVA 3RTRB 1RMDA 2KYUA 3LQHA 1HYIA 2D8UA 3LVRE 4AP4A 3SUBA 2E6RA 4GB0A 4WA6A 2YSJA 1BORA 5DINA 4PPEA 3M99A 2LQ6A 3FEHA 2JUNA 4GNDA 3N9QA 4H9DA 1N87A 2CKLB 5AITA 2VPGA 3KV5A 2ECGA 4QF3A 2L7PA 1LDKC 2CSZA 4S3OC 3M7KA 3N9LA 2I50A 3V43A 5B76A 3LRQA 3T9KA 2KFTA 1T1HA 1WENA 2FSAA 2CT2A 4Z0OA 2P57A 2L5UA 3MHSA 3DWDA 4ZDTA 2C2VS 2YW8A 3JUEA 2JMIA 2MUMA 3O7AA 2NAAA 1WESA 2MD7B 2L75A 2LDRA 2KWNA 3HCSA 3QZVA 4IC3A 5I3LA 3HCTA 5TDWA 3N9OA 3M63A 5H1VA 3KDEC 2F6JA 2IQJA 3N9NA 4Z0RA 2FUUA 5G0FA 5TBNA 2DSMA 2YQLA 2D8SA 2YHNA 2KREA 2VPDA 1ZBDB 2VJFA 5J3XA 2F6NA 3C5KA 2L80A 3O47A 5KH3A 2EA6A 2ECWA 4I7CA 2ECVA 4AVXA 2KIZA 4O62A 2VNFA 4N4FA 1WFKA 2PNXA 4YBMA 1G25A 2CRRA 2JM3A 2Y43A 4Q6FA 2VPEA 1JOCA 4OGCA 4V3LC 4AYCB 1E4UA 3Q1DA 3IHPA 2H0DA 1X4JA 2UZGA 3O37A 3DQVR 5LKUA 2G43A 4CA1A 2XOZA 2YURA 2YSMA 4ZUXU 2DJAA 1DCQA 2LRIC 3L1XA 4YC9A 3RPGB 1MBMA 2QIZA 4B86C 3ZVZB 3MDBC 5SVYA 4LKAA 1VD4A 4FJCA 3LJUX 1HYJA 3FL2A 4PTBA 2KKXA 3N9MA 3M62A 2QICA 2MKEA 1WEVA 1LDJB 2XOCA 2XB1A 5KH9A 3U5OA 2FFWA 4X3GA 2VP7A 5D1MB 4MSXA 3LVQE 2LGGA 3O70A 1WGMA 1JM7B 3LQIA 3NG2A 3RPGC 2YHOA 3PLWA 1VYXA 2IDAA 5LCWB 2G6QA 4LJNA 2EXUA 2MA5A 4WZ0A 4WZ3B 5TDRA 2CONA 4YABA 5B77A 2XOYA 3LDYA 2EODA 2JMJA 2VJEA 2YQMA 4A4CA 4B7YC 2LGKA 5B79A 3MHHA 4L7XA 2K1JA 5H1TA 2EGPA 2M85A 5TABA 3DDTA 4UP0A 2G45A 3FANA 4YBTA 2L43A 5SVIB 1WILA 2DX8A 2ECJA 4W4UA 1K2FA 2JMDA 3C6WA 4AUQB 4LADB 3FAOA 2CKLA 2ZETC 2KWKA 4QF2A 2YT5A 3SOUA 2LXHC 2B0OE 2L0BA 4WZ2A 2HDPA 4NN2A 4R8PK 4V3KC 2OWAA 2K4DA 3VK6A 1WEWA 3KV6A 1WEUA 2PUYA 4FK5A 2RI7A 3HCUA 3SHBA 2Y1NA 4F1PA 1X4UA 2KWOA 3PURA 2LAUA 4LLBA 3ZYQA 2M3HA 3O33A 5LKZA 1U6GB 4YADA 2MD8C 4YATA 2RSDA 3N9PA 2OXQC 3T6RA 1VFYA 1WEEA 2JRJA 5FB0A 5B75A 2KWJA 5H9MA 4MVTA 3O36A 4I7DA 2CSYA 2K16A 3FJUB 2E6SA 3LQJA 4OGEA 4CCGX 3SOWA 1WIMA 2F42A 4A4BA 2XP0A 5AIUA 4BHWA 1FBVA 2MNZA 3GL6A 5JG6A 1WEMA 3L1ZB 4QQ4A 3FM8C 1Z60A 2ECTA 1MM3A 2LN0A 2XEUA 4GNFA 4UP5A 4AYCA 3O34A 2YUCA 2CSVA 5FEYA 4FIPA 3E2DA 4ZQLA 2ECNA 2YYRA 1MM2A 2MA6A 5KH7A 5LKXA 2HYED 2VJFB 3SOXA 1V87A 3I2DA 3KQIA 2C2LA 2ECIA 3EB5A 5B78A 2KU3A 5C11A 4FO9A 3L11A 2M13A 5G04B 3ZVYA 4N3WA 4C9ZA 2KE1A 1XWHA 2FUIA 5G05B 4IC2A 3ASLA 2M1RA 1WEOA 2MNYA 3PHDA 2H0DB 2AN6A 3U5PA 5K3QA 2YREA 2FD4A 2YVRA 5LKTA 1Z2QA 3GV4A 2LV9A 4L58A 5TRBA 2KGGA 2MIQA 5H1UA 4UI9B 2KKYA 3PUQA 2LGLA 4GNEA 2VPBA 1X4IA 4YBSA 2CRWA 5SVXA 5B8DA 1F62A 5DKAA 1WEQA 1JM7A 4F52B 5FERA 3O35A 4TKPB 2M6MA 1WEPA 3U5NA 3T7LA 2E61A 4R7EA 2K17A 1FP0A 3ZTGA 2KR4A 3ZPV1 3ZPVE 3U5MA 5D1LB 1DVPA 2RR4A
chains in the Genus database with same CATH topology
2BAYA 1CHCA 3HTKC 5D1KB 2MT5A 5EYAF 1WE9A 4BBQA 5C13A 3DPLR 1Z6UA 4XI1A 2YU4A 3ZNIA 3EB6A 4A49A 2QJ0A 4O64A 1IYMA 4LK9A 4R2YA 5FB1A 4YAXA 2Y1MA 2LXPC 4GNGA 2LGVA 4A0CD 4P5OB 4I7BA 2VJEB 4S3OB 2KGIA 3KNVA 3RTRB 1RMDA 2KYUA 3LQHA 1HYIA 4AP4A 2E6RA 4GB0A 4WA6A 2YSJA 1BORA 5DINA 4PPEA 3M99A 2LQ6A 4GNDA 3N9QA 1N87A 2CKLB 5AITA 2VPGA 3KV5A 2ECGA 4QF3A 1LDKC 2CSZA 4S3OC 3N9LA 2I50A 3V43A 5B76A 3LRQA 2KFTA 1T1HA 1WENA 2FSAA 2CT2A 2L5UA 3MHSA 4ZDTA 2C2VS 2YW8A 2JMIA 2MUMA 3O7AA 2NAAA 1WESA 2MD7B 2L75A 2LDRA 2KWNA 3HCSA 3QZVA 4IC3A 5I3LA 3HCTA 5TDWA 3N9OA 3M63A 5H1VA 2F6JA 3N9NA 5G0FA 2FUUA 5TBNA 2YQLA 2D8SA 2YHNA 2KREA 2VPDA 1ZBDB 2VJFA 5J3XA 2F6NA 3C5KA 2L80A 5KH3A 2EA6A 2ECWA 4I7CA 2ECVA 4AVXA 2KIZA 2VNFA 4N4FA 1WFKA 2PNXA 4YBMA 1G25A 2Y43A 4Q6FA 2VPEA 1JOCA 4V3LC 4AYCB 1E4UA 3IHPA 2H0DA 1X4JA 2UZGA 3O37A 3DQVR 5LKUA 2G43A 4CA1A 2YURA 2YSMA 4ZUXU 2LRIC 3L1XA 4YC9A 3RPGB 2QIZA 4B86C 3ZVZB 4LKAA 1VD4A 4FJCA 1HYJA 3FL2A 4PTBA 3N9MA 3M62A 2QICA 1WEVA 1LDJB 2XB1A 5KH9A 3U5OA 4X3GA 2VP7A 5D1MB 4MSXA 2LGGA 3O70A 1WGMA 1JM7B 3LQIA 3NG2A 3RPGC 2YHOA 1VYXA 2IDAA 5LCWB 2G6QA 4LJNA 2MA5A 4WZ0A 4WZ3B 5TDRA 4YABA 5B77A 2EODA 2JMJA 2VJEA 2YQMA 4A4CA 4B7YC 2LGKA 5B79A 3MHHA 4L7XA 2K1JA 5H1TA 2EGPA 2M85A 5TABA 4UP0A 2G45A 4YBTA 2L43A 1WILA 2DX8A 2ECJA 4W4UA 1K2FA 2JMDA 3C6WA 4AUQB 4LADB 2CKLA 2ZETC 2KWKA 4QF2A 2YT5A 3SOUA 2LXHC 2L0BA 4WZ2A 2HDPA 4NN2A 4R8PK 4V3KC 2K4DA 3VK6A 1WEWA 3KV6A 1WEUA 2PUYA 4FK5A 2RI7A 3HCUA 3SHBA 2Y1NA 1X4UA 2KWOA 3PURA 4LLBA 3ZYQA 2M3HA 3O33A 5LKZA 1U6GB 4YADA 2MD8C 4YATA 2RSDA 3N9PA 2OXQC 3T6RA 1VFYA 1WEEA 2JRJA 5FB0A 5B75A 2KWJA 5H9MA 4MVTA 3O36A 4I7DA 2CSYA 2K16A 3LQJA 2E6SA 4CCGX 3SOWA 1WIMA 2F42A 4A4BA 5AIUA 4BHWA 1FBVA 2MNZA 3GL6A 5JG6A 1WEMA 3L1ZB 1Z60A 2ECTA 1MM3A 2LN0A 2XEUA 4GNFA 4UP5A 4AYCA 3O34A 2YUCA 5FEYA 4FIPA 4ZQLA 2ECNA 2YYRA 1MM2A 2MA6A 5KH7A 5LKXA 2HYED 2VJFB 3SOXA 1V87A 3I2DA 3KQIA 2C2LA 2ECIA 3EB5A 5B78A 2KU3A 5C11A 4FO9A 3L11A 5G04B 3ZVYA 4N3WA 4C9ZA 2KE1A 1XWHA 2FUIA 5G05B 4IC2A 3ASLA 2M1RA 1WEOA 2MNYA 3PHDA 2H0DB 2AN6A 3U5PA 2YREA 5LKTA 1Z2QA 3GV4A 2LV9A 4L58A 5TRBA 2KGGA 2MIQA 5H1UA 4UI9B 3PUQA 2LGLA 4GNEA 2VPBA 1X4IA 4YBSA 5B8DA 1F62A 5DKAA 1WEQA 1JM7A 4F52B 5FERA 3O35A 4TKPB 2M6MA 1WEPA 3U5NA 3T7LA 4R7EA 2K17A 1FP0A 3ZTGA 2KR4A 3ZPV1 3ZPVE 3U5MA 5D1LB 1DVPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BAY A;  1CHC A;  3HTK C;  5D1K B;  2MT5 A;  5EYA F;  1WE9 A;  4BBQ A;  5C13 A;  3DPL R;  1Z6U A;  4XI1 A;  2YU4 A;  3ZNI A;  3EB6 A;  4A49 A;  2QJ0 A;  4O64 A;  1IYM A;  4LK9 A;  4R2Y A;  5FB1 A;  4YAX A;  2Y1M A;  2LXP C;  4GNG A;  2LGV A;  4A0C D;  4P5O B;  4I7B A;  2VJE B;  4S3O B;  2KGI A;  3KNV A;  3RTR B;  1RMD A;  2KYU A;  3LQH A;  1HYI A;  4AP4 A;  2E6R A;  4GB0 A;  4WA6 A;  2YSJ A;  1BOR A;  5DIN A;  4PPE A;  3M99 A;  2LQ6 A;  4GND A;  3N9Q A;  1N87 A;  2CKL B;  5AIT A;  2VPG A;  3KV5 A;  2ECG A;  4QF3 A;  1LDK C;  2CSZ A;  4S3O C;  3N9L A;  2I50 A;  3V43 A;  5B76 A;  3LRQ A;  2KFT A;  1T1H A;  1WEN A;  2FSA A;  2CT2 A;  2L5U A;  3MHS A;  4ZDT A;  2C2V S;  2YW8 A;  2JMI A;  2MUM A;  3O7A A;  2NAA A;  1WES A;  2MD7 B;  2L75 A;  2LDR A;  2KWN A;  3HCS A;  3QZV A;  4IC3 A;  5I3L A;  3HCT A;  5TDW A;  3N9O A;  3M63 A;  5H1V A;  2F6J A;  3N9N A;  5G0F A;  2FUU A;  5TBN A;  2YQL A;  2D8S A;  2YHN A;  2KRE A;  2VPD A;  1ZBD B;  2VJF A;  5J3X A;  2F6N A;  3C5K A;  2L80 A;  5KH3 A;  2EA6 A;  2ECW A;  4I7C A;  2ECV A;  4AVX A;  2KIZ A;  2VNF A;  4N4F A;  1WFK A;  2PNX A;  4YBM A;  1G25 A;  2Y43 A;  4Q6F A;  2VPE A;  1JOC A;  4V3L C;  4AYC B;  1E4U A;  3IHP A;  2H0D A;  1X4J A;  2UZG A;  3O37 A;  3DQV R;  5LKU A;  2G43 A;  4CA1 A;  2YUR A;  2YSM A;  4ZUX U;  2LRI C;  3L1X A;  4YC9 A;  3RPG B;  2QIZ A;  4B86 C;  3ZVZ B;  4LKA A;  1VD4 A;  4FJC A;  1HYJ A;  3FL2 A;  4PTB A;  3N9M A;  3M62 A;  2QIC A;  1WEV A;  1LDJ B;  2XB1 A;  5KH9 A;  3U5O A;  4X3G A;  2VP7 A;  5D1M B;  4MSX A;  2LGG A;  3O70 A;  1WGM A;  1JM7 B;  3LQI A;  3NG2 A;  3RPG C;  2YHO A;  1VYX A;  2IDA A;  5LCW B;  2G6Q A;  4LJN A;  2MA5 A;  4WZ0 A;  4WZ3 B;  5TDR A;  4YAB A;  5B77 A;  2EOD A;  2JMJ A;  2VJE A;  2YQM A;  4A4C A;  4B7Y C;  2LGK A;  5B79 A;  3MHH A;  4L7X A;  2K1J A;  5H1T A;  2EGP A;  2M85 A;  5TAB A;  4UP0 A;  2G45 A;  4YBT A;  2L43 A;  1WIL A;  2DX8 A;  2ECJ A;  4W4U A;  1K2F A;  2JMD A;  3C6W A;  4AUQ B;  4LAD B;  2CKL A;  2ZET C;  2KWK A;  4QF2 A;  2YT5 A;  3SOU A;  2LXH C;  2L0B A;  4WZ2 A;  2HDP A;  4NN2 A;  4R8P K;  4V3K C;  2K4D A;  3VK6 A;  1WEW A;  3KV6 A;  1WEU A;  2PUY A;  4FK5 A;  2RI7 A;  3HCU A;  3SHB A;  2Y1N A;  1X4U A;  2KWO A;  3PUR A;  4LLB A;  3ZYQ A;  2M3H A;  3O33 A;  5LKZ A;  1U6G B;  4YAD A;  2MD8 C;  4YAT A;  2RSD A;  3N9P A;  2OXQ C;  3T6R A;  1VFY A;  1WEE A;  2JRJ A;  5FB0 A;  5B75 A;  2KWJ A;  5H9M A;  4MVT A;  3O36 A;  4I7D A;  2CSY A;  2K16 A;  3LQJ A;  2E6S A;  4CCG X;  3SOW A;  1WIM A;  2F42 A;  4A4B A;  5AIU A;  4BHW A;  1FBV A;  2MNZ A;  3GL6 A;  5JG6 A;  1WEM A;  3L1Z B;  1Z60 A;  2ECT A;  1MM3 A;  2LN0 A;  2XEU A;  4GNF A;  4UP5 A;  4AYC A;  3O34 A;  2YUC A;  5FEY A;  4FIP A;  4ZQL A;  2ECN A;  2YYR A;  1MM2 A;  2MA6 A;  5KH7 A;  5LKX A;  2HYE D;  2VJF B;  3SOX A;  1V87 A;  3I2D A;  3KQI A;  2C2L A;  2ECI A;  3EB5 A;  5B78 A;  2KU3 A;  5C11 A;  4FO9 A;  3L11 A;  5G04 B;  3ZVY A;  4N3W A;  4C9Z A;  2KE1 A;  1XWH A;  2FUI A;  5G05 B;  4IC2 A;  3ASL A;  2M1R A;  1WEO A;  2MNY A;  3PHD A;  2H0D B;  2AN6 A;  3U5P A;  2YRE A;  5LKT A;  1Z2Q A;  3GV4 A;  2LV9 A;  4L58 A;  5TRB A;  2KGG A;  2MIQ A;  5H1U A;  4UI9 B;  3PUQ A;  2LGL A;  4GNE A;  2VPB A;  1X4I A;  4YBS A;  5B8D A;  1F62 A;  5DKA A;  1WEQ A;  1JM7 A;  4F52 B;  5FER A;  3O35 A;  4TKP B;  2M6M A;  1WEP A;  3U5N A;  3T7L A;  4R7E A;  2K17 A;  1FP0 A;  3ZTG A;  2KR4 A;  3ZPV 1;  3ZPV E;  3U5M A;  5D1L B;  1DVP A; 
#chains in the Genus database with same CATH topology
 2BAY A;  1CHC A;  3HTK C;  5D1K B;  2MT5 A;  5EYA F;  1WE9 A;  4BBQ A;  5SVI A;  3H7H A;  5C13 A;  3DPL R;  1Z6U A;  4XI1 A;  2YU4 A;  3ZNI A;  3EB6 A;  4A49 A;  2QJ0 A;  4O64 A;  1IYM A;  2EGM A;  4LK9 A;  4R2Y A;  5FB1 A;  4YAX A;  2Y1M A;  2LXP C;  4GNG A;  2LGV A;  4A0C D;  4P5O B;  4I7B A;  2VJE B;  4S3O B;  2KGI A;  3KNV A;  3RTR B;  1RMD A;  2KYU A;  3LQH A;  1HYI A;  2D8U A;  3LVR E;  4AP4 A;  3SUB A;  2E6R A;  4GB0 A;  4WA6 A;  2YSJ A;  1BOR A;  5DIN A;  4PPE A;  3M99 A;  2LQ6 A;  3FEH A;  2JUN A;  4GND A;  3N9Q A;  4H9D A;  1N87 A;  2CKL B;  5AIT A;  2VPG A;  3KV5 A;  2ECG A;  4QF3 A;  2L7P A;  1LDK C;  2CSZ A;  4S3O C;  3M7K A;  3N9L A;  2I50 A;  3V43 A;  5B76 A;  3LRQ A;  3T9K A;  2KFT A;  1T1H A;  1WEN A;  2FSA A;  2CT2 A;  4Z0O A;  2P57 A;  2L5U A;  3MHS A;  3DWD A;  4ZDT A;  2C2V S;  2YW8 A;  3JUE A;  2JMI A;  2MUM A;  3O7A A;  2NAA A;  1WES A;  2MD7 B;  2L75 A;  2LDR A;  2KWN A;  3HCS A;  3QZV A;  4IC3 A;  5I3L A;  3HCT A;  5TDW A;  3N9O A;  3M63 A;  5H1V A;  3KDE C;  2F6J A;  2IQJ A;  3N9N A;  4Z0R A;  2FUU A;  5G0F A;  5TBN A;  2DSM A;  2YQL A;  2D8S A;  2YHN A;  2KRE A;  2VPD A;  1ZBD B;  2VJF A;  5J3X A;  2F6N A;  3C5K A;  2L80 A;  3O47 A;  5KH3 A;  2EA6 A;  2ECW A;  4I7C A;  2ECV A;  4AVX A;  2KIZ A;  4O62 A;  2VNF A;  4N4F A;  1WFK A;  2PNX A;  4YBM A;  1G25 A;  2CRR A;  2JM3 A;  2Y43 A;  4Q6F A;  2VPE A;  1JOC A;  4OGC A;  4V3L C;  4AYC B;  1E4U A;  3Q1D A;  3IHP A;  2H0D A;  1X4J A;  2UZG A;  3O37 A;  3DQV R;  5LKU A;  2G43 A;  4CA1 A;  2XOZ A;  2YUR A;  2YSM A;  4ZUX U;  2DJA A;  1DCQ A;  2LRI C;  3L1X A;  4YC9 A;  3RPG B;  1MBM A;  2QIZ A;  4B86 C;  3ZVZ B;  3MDB C;  5SVY A;  4LKA A;  1VD4 A;  4FJC A;  3LJU X;  1HYJ A;  3FL2 A;  4PTB A;  2KKX A;  3N9M A;  3M62 A;  2QIC A;  2MKE A;  1WEV A;  1LDJ B;  2XOC A;  2XB1 A;  5KH9 A;  3U5O A;  2FFW A;  4X3G A;  2VP7 A;  5D1M B;  4MSX A;  3LVQ E;  2LGG A;  3O70 A;  1WGM A;  1JM7 B;  3LQI A;  3NG2 A;  3RPG C;  2YHO A;  3PLW A;  1VYX A;  2IDA A;  5LCW B;  2G6Q A;  4LJN A;  2EXU A;  2MA5 A;  4WZ0 A;  4WZ3 B;  5TDR A;  2CON A;  4YAB A;  5B77 A;  2XOY A;  3LDY A;  2EOD A;  2JMJ A;  2VJE A;  2YQM A;  4A4C A;  4B7Y C;  2LGK A;  5B79 A;  3MHH A;  4L7X A;  2K1J A;  5H1T A;  2EGP A;  2M85 A;  5TAB A;  3DDT A;  4UP0 A;  2G45 A;  3FAN A;  4YBT A;  2L43 A;  5SVI B;  1WIL A;  2DX8 A;  2ECJ A;  4W4U A;  1K2F A;  2JMD A;  3C6W A;  4AUQ B;  4LAD B;  3FAO A;  2CKL A;  2ZET C;  2KWK A;  4QF2 A;  2YT5 A;  3SOU A;  2LXH C;  2B0O E;  2L0B A;  4WZ2 A;  2HDP A;  4NN2 A;  4R8P K;  4V3K C;  2OWA A;  2K4D A;  3VK6 A;  1WEW A;  3KV6 A;  1WEU A;  2PUY A;  4FK5 A;  2RI7 A;  3HCU A;  3SHB A;  2Y1N A;  4F1P A;  1X4U A;  2KWO A;  3PUR A;  2LAU A;  4LLB A;  3ZYQ A;  2M3H A;  3O33 A;  5LKZ A;  1U6G B;  4YAD A;  2MD8 C;  4YAT A;  2RSD A;  3N9P A;  2OXQ C;  3T6R A;  1VFY A;  1WEE A;  2JRJ A;  5FB0 A;  5B75 A;  2KWJ A;  5H9M A;  4MVT A;  3O36 A;  4I7D A;  2CSY A;  2K16 A;  3FJU B;  2E6S A;  3LQJ A;  4OGE A;  4CCG X;  3SOW A;  1WIM A;  2F42 A;  4A4B A;  2XP0 A;  5AIU A;  4BHW A;  1FBV A;  2MNZ A;  3GL6 A;  5JG6 A;  1WEM A;  3L1Z B;  4QQ4 A;  3FM8 C;  1Z60 A;  2ECT A;  1MM3 A;  2LN0 A;  2XEU A;  4GNF A;  4UP5 A;  4AYC A;  3O34 A;  2YUC A;  2CSV A;  5FEY A;  4FIP A;  3E2D A;  4ZQL A;  2ECN A;  2YYR A;  1MM2 A;  2MA6 A;  5KH7 A;  5LKX A;  2HYE D;  2VJF B;  3SOX A;  1V87 A;  3I2D A;  3KQI A;  2C2L A;  2ECI A;  3EB5 A;  5B78 A;  2KU3 A;  5C11 A;  4FO9 A;  3L11 A;  2M13 A;  5G04 B;  3ZVY A;  4N3W A;  4C9Z A;  2KE1 A;  1XWH A;  2FUI A;  5G05 B;  4IC2 A;  3ASL A;  2M1R A;  1WEO A;  2MNY A;  3PHD A;  2H0D B;  2AN6 A;  3U5P A;  5K3Q A;  2YRE A;  2FD4 A;  2YVR A;  5LKT A;  1Z2Q A;  3GV4 A;  2LV9 A;  4L58 A;  5TRB A;  2KGG A;  2MIQ A;  5H1U A;  4UI9 B;  2KKY A;  3PUQ A;  2LGL A;  4GNE A;  2VPB A;  1X4I A;  4YBS A;  2CRW A;  5SVX A;  5B8D A;  1F62 A;  5DKA A;  1WEQ A;  1JM7 A;  4F52 B;  5FER A;  3O35 A;  4TKP B;  2M6M A;  1WEP A;  3U5N A;  3T7L A;  2E61 A;  4R7E A;  2K17 A;  1FP0 A;  3ZTG A;  2KR4 A;  3ZPV 1;  3ZPV E;  3U5M A;  5D1L B;  1DVP A;  2RR4 A; 
#chains in the Genus database with same CATH homology
 2BAY A;  1CHC A;  3HTK C;  5D1K B;  2MT5 A;  5EYA F;  1WE9 A;  4BBQ A;  5C13 A;  3DPL R;  1Z6U A;  4XI1 A;  2YU4 A;  3ZNI A;  3EB6 A;  4A49 A;  2QJ0 A;  4O64 A;  1IYM A;  4LK9 A;  4R2Y A;  5FB1 A;  4YAX A;  2Y1M A;  2LXP C;  4GNG A;  2LGV A;  4A0C D;  4P5O B;  4I7B A;  2VJE B;  4S3O B;  2KGI A;  3KNV A;  3RTR B;  1RMD A;  2KYU A;  3LQH A;  1HYI A;  4AP4 A;  2E6R A;  4GB0 A;  4WA6 A;  2YSJ A;  1BOR A;  5DIN A;  4PPE A;  3M99 A;  2LQ6 A;  4GND A;  3N9Q A;  1N87 A;  2CKL B;  5AIT A;  2VPG A;  3KV5 A;  2ECG A;  4QF3 A;  1LDK C;  2CSZ A;  4S3O C;  3N9L A;  2I50 A;  3V43 A;  5B76 A;  3LRQ A;  2KFT A;  1T1H A;  1WEN A;  2FSA A;  2CT2 A;  2L5U A;  3MHS A;  4ZDT A;  2C2V S;  2YW8 A;  2JMI A;  2MUM A;  3O7A A;  2NAA A;  1WES A;  2MD7 B;  2L75 A;  2LDR A;  2KWN A;  3HCS A;  3QZV A;  4IC3 A;  5I3L A;  3HCT A;  5TDW A;  3N9O A;  3M63 A;  5H1V A;  2F6J A;  3N9N A;  5G0F A;  2FUU A;  5TBN A;  2YQL A;  2D8S A;  2YHN A;  2KRE A;  2VPD A;  1ZBD B;  2VJF A;  5J3X A;  2F6N A;  3C5K A;  2L80 A;  5KH3 A;  2EA6 A;  2ECW A;  4I7C A;  2ECV A;  4AVX A;  2KIZ A;  2VNF A;  4N4F A;  1WFK A;  2PNX A;  4YBM A;  1G25 A;  2Y43 A;  4Q6F A;  2VPE A;  1JOC A;  4V3L C;  4AYC B;  1E4U A;  3IHP A;  2H0D A;  1X4J A;  2UZG A;  3O37 A;  3DQV R;  5LKU A;  2G43 A;  4CA1 A;  2YUR A;  2YSM A;  4ZUX U;  2LRI C;  3L1X A;  4YC9 A;  3RPG B;  2QIZ A;  4B86 C;  3ZVZ B;  4LKA A;  1VD4 A;  4FJC A;  1HYJ A;  3FL2 A;  4PTB A;  3N9M A;  3M62 A;  2QIC A;  1WEV A;  1LDJ B;  2XB1 A;  5KH9 A;  3U5O A;  4X3G A;  2VP7 A;  5D1M B;  4MSX A;  2LGG A;  3O70 A;  1WGM A;  1JM7 B;  3LQI A;  3NG2 A;  3RPG C;  2YHO A;  1VYX A;  2IDA A;  5LCW B;  2G6Q A;  4LJN A;  2MA5 A;  4WZ0 A;  4WZ3 B;  5TDR A;  4YAB A;  5B77 A;  2EOD A;  2JMJ A;  2VJE A;  2YQM A;  4A4C A;  4B7Y C;  2LGK A;  5B79 A;  3MHH A;  4L7X A;  2K1J A;  5H1T A;  2EGP A;  2M85 A;  5TAB A;  4UP0 A;  2G45 A;  4YBT A;  2L43 A;  1WIL A;  2DX8 A;  2ECJ A;  4W4U A;  1K2F A;  2JMD A;  3C6W A;  4AUQ B;  4LAD B;  2CKL A;  2ZET C;  2KWK A;  4QF2 A;  2YT5 A;  3SOU A;  2LXH C;  2L0B A;  4WZ2 A;  2HDP A;  4NN2 A;  4R8P K;  4V3K C;  2K4D A;  3VK6 A;  1WEW A;  3KV6 A;  1WEU A;  2PUY A;  4FK5 A;  2RI7 A;  3HCU A;  3SHB A;  2Y1N A;  1X4U A;  2KWO A;  3PUR A;  4LLB A;  3ZYQ A;  2M3H A;  3O33 A;  5LKZ A;  1U6G B;  4YAD A;  2MD8 C;  4YAT A;  2RSD A;  3N9P A;  2OXQ C;  3T6R A;  1VFY A;  1WEE A;  2JRJ A;  5FB0 A;  5B75 A;  2KWJ A;  5H9M A;  4MVT A;  3O36 A;  4I7D A;  2CSY A;  2K16 A;  3LQJ A;  2E6S A;  4CCG X;  3SOW A;  1WIM A;  2F42 A;  4A4B A;  5AIU A;  4BHW A;  1FBV A;  2MNZ A;  3GL6 A;  5JG6 A;  1WEM A;  3L1Z B;  1Z60 A;  2ECT A;  1MM3 A;  2LN0 A;  2XEU A;  4GNF A;  4UP5 A;  4AYC A;  3O34 A;  2YUC A;  5FEY A;  4FIP A;  4ZQL A;  2ECN A;  2YYR A;  1MM2 A;  2MA6 A;  5KH7 A;  5LKX A;  2HYE D;  2VJF B;  3SOX A;  1V87 A;  3I2D A;  3KQI A;  2C2L A;  2ECI A;  3EB5 A;  5B78 A;  2KU3 A;  5C11 A;  4FO9 A;  3L11 A;  5G04 B;  3ZVY A;  4N3W A;  4C9Z A;  2KE1 A;  1XWH A;  2FUI A;  5G05 B;  4IC2 A;  3ASL A;  2M1R A;  1WEO A;  2MNY A;  3PHD A;  2H0D B;  2AN6 A;  3U5P A;  2YRE A;  5LKT A;  1Z2Q A;  3GV4 A;  2LV9 A;  4L58 A;  5TRB A;  2KGG A;  2MIQ A;  5H1U A;  4UI9 B;  3PUQ A;  2LGL A;  4GNE A;  2VPB A;  1X4I A;  4YBS A;  5B8D A;  1F62 A;  5DKA A;  1WEQ A;  1JM7 A;  4F52 B;  5FER A;  3O35 A;  4TKP B;  2M6M A;  1WEP A;  3U5N A;  3T7L A;  4R7E A;  2K17 A;  1FP0 A;  3ZTG A;  2KR4 A;  3ZPV 1;  3ZPV E;  3U5M A;  5D1L B;  1DVP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...