2F6JA

Crystal structure of phd finger-linker-bromodomain fragment of human bptf in the h3(1-15)k4me3 bound state
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
168
structure length
168
Chain Sequence
DTKLYCICKTPYDESKFYIGCDRCQNWYHGRCVGILQSEAELIDEYVCPQCQSTEDAMTVLTPLTEKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLATMEERVQRRYYEKLTEFVADMTKIFDNCRYYNPSDSPFYQCAEVLESFFVQKLKGFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for site-specific read-out of histone H3K4me3 by the BPTF PHD finger of NURF.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords bromodomain PHD finger transcription factor
total genus 49
structure length 168
sequence length 168
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2f6jA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2f6jA01
2LSPB 4QB3A 4WA6A 5B76A 2Y1MA 3U5MA 1FBVA 4A0CD 4CUTA 2LRIC 4S3OC 5I83A 4NUEA 3I2DA 3DAIA 4HXNA 4I7CA 2ZETC 5A5SA 4P5OB 4ALGA 4XY8A 5KU3A 4UIUA 5TBNA 4R7EA 4IR4A 4CFLA 2DVRA 5II2A 5KH7A 3PUQA 5L98A 4ALHA 2YREA 2M85A 5EICA 2L5UA 3SOWA 5FB0A 5EPBA 1X4UA 5ENHA 3UV2A 4XUBA 4V3KC 3RPGC 4W4UA 2AN6A 3P5OA 2KWKA 4TT2A 5I89A 4FJCA 5E9MA 3HCTA 4PPEA 4R2YA 4LZ2A 1HYJA 4HXOA 4HXKA 2RS9B 5D3SA 5HRVA 4YBMA 4WZ2A 5EWDA 2F6JA 5EV9A 4CUUA 5AITA 4QSWA 4UP5A 4CUPA 3U5PA 2K17A 3LRQA 5H1TA 3M63A 1HYIA 4XYAA 3AQAA 4YYIA 4ZC9A 2VPDA 4NYXA 4XUAA 5EU1A 4LRGA 1T1HA 5B79A 4YBTA 4UIVA 3DWYA 5ENBA 2CT2A 1WGMA 2ECVA 2KR4A 2PUYA 4NR6A 4TZ8A 5TABA 4A9OA 4QSQA 5DYCA 2L75A 4L58A 4B86C 4I7BA 3IU5A 5HJCA 1BORA 5A5RA 2LGVA 2M6MA 2UZGA 5I80A 2C2LA 3S91A 4QSUA 5FE6A 5LKUA 3MUKA 4QEUA 5TDWA 1MM3A 4LC2A 4PCIA 2ECWA 5J3XA 5H1UA 1JOCA 2E6RA 3LQHA 2IDAA 2M3HA 1V87A 5L8UA 4J0RA 1VD4A 4QY4A 5FG4A 2QIZA 5F3AA 5G4RA 5C11A 4HBXA 3NXBA 4UIYA 5A5PA 5AMFA 5FE7A 5KTXA 5L99A 2YSMA 4GNDA 3M62A 4CFKA 5A5QA 2WP1A 4WHUA 4Z6IA 3HCUA 1X4JA 4OGIA 4Z6HA 5A5OA 2CKLB 2L5EA 3LQJA 4B7YC 5C13A 5HFQA 1WEPA 5LUUA 5KH9A 3IU6A 3EB6A 4QZSA 1IYMA 2H0DB 2EGPA 3I3JA 2YW5A 4C9ZA 4O72A 4QSVA 5EWCA 1WEEA 4J3IA 5L97A 4YK0A 5FE9A 5BT4A 1Z2QA 5KTUA 1WEUA 4KV1A 3O33A 2KWOA 3ASLA 3ZPV1 2G45A 4HXSA 2BAYA 5EWWA 2ECNA 4PCEA 3N9LA 4MVTA 4NN2A 3VK6A 5FH6A 3MB3A 5ENEA 5DINA 5FEYA 5LJ0A 4LLBA 2ECIA 5G4SA 4QR5A 5D3TA 5EA1A 2D9EA 5KTWA 3KNVA 2MUMA 5H9MA 3IHPA 4NQMA 1WIMA 3SVGA 3O34A 3TLPA 3C5KA 5CQTA 2I7KA 1CHCA 4A9LA 2YYRA 3HMFA 5A82A 4O7EA 4GNFA 4BBQA 4NR8A 5JWMA 4YY4A 5D24A 2L43A 4ZW1A 4CLBA 4GNEA 5HM0A 5LCWB 3JVLA 2GRCA 5AD2A 5FG6A 4X3GA 5TRBA 2ECTA 2YSJA 4QUTA 2XEUA 4PS5A 5E73A 5G0FA 2YUCA 2H0DA 4O7AA 4UIZA 4QF3A 3L11A 3MXFA 4CL9A 5LVRA 5D7XA 4QEVA 4AKNA 2CSZA 2KFTA 5B8DA 5CQ6A 4UYHA 4N4IA 4AP4A 4MENA 1VYXA 5F25A 1K2FA 5LKXA 5D3LA 3HMHA 4LZRA 5I86A 4TU6A 2KGGA 4QUUA 3DPLR 5ENJA 1EQFA 2WP2A 4GNGA 5A81A 3ZYQA 4CUSA 3RPGB 5CQ8A 2YU4A 1E4UA 5TB6A 2MIQA 4XY9A 2FUUA 4MR3A 5CY9A 2EA6A 5C87A 2HDPA 3MHSA 4WIVA 5F62A 4LADB 4MEQA 4NRCA 4O75A 4O7FA 4AUQB 5IGNA 3SHBA 4AVXA 5HRXA 4NR4A 5CZGA 5DY7A 4BW2A 4BW4A 2NXBA 4NS5A 4IC3A 5E9KA 4UI9B 5E9YA 5C8GA 5CUGA 4I7DA 4S3OB 4UYFB 2LGGA 1WUGA 5E9IA 1WENA 2YELA 5F5ZA 3UW9A 5C89A 1WEWA 3JVKA 4IR6A 4QC3A 4Q0OA 5I7YA 1F62A 4UYEA 2FSAA 4MR4A 5EPRA 5LKZA 3UVWA 2LV9A 5KH3A 3G0LA 4QSRA 4NUDA 3JVMA 3KV5A 5FE5A 1WESA 4GB0A 2LN0A 5CQ3A 1N87A 2F6NA 5DYXA 4PKLA 4YYHA 5FFYA 2YHOA 5CQ5A 4MSXA 5DW1A 3P1DA 3U5NA 5I88A 4A9JA 3RTRB 3O36A 4QR4A 4O71A 5D25A 5EK9A 4PY6A 4YYNA 1WFKA 2CSYA 2L84A 4N4GA 4Z1SA 1DVPA 4TT6A 4YY6A 2JMDA 4F52B 4ZUXU 2RNWA 3Q2EA 2R0SA 2YQLA 4A9KA 4QEWA 2FUIA 1LDJB 5E0RA 4N3WA 4Q6FA 5D3JA 5A83A 5AMEA 5D3PA 4X2IA 5FH8A 4UYFA 5D1MB 3ZVZB 2VPGA 2DX8A 4KCXA 4QYDA 4YATA 3UVYA 5IIDA 2G43A 3HMEA 5F61A 2YEMA 4QC1A 5LKTA 3UV4A 1FP0A 5HELA 4IR3A 2L0BA 4A4BA 4TQNA 4Z93A 4O7BA 5HEMA 2YW8A 4BW3A 4QYLA 3UVDA 3U5KA 5HCLA 2LQ6A 4QSSA 3P1FA 3V43A 1WEQA 1JSPB 3MB4A 4LJNA 4YYDA 4NYVA 5TCMA 5CRMA 4LDFA 5FE2A 2MD7B 2D82A 5ENGA 5E3GA 5LVQA 5FBXA 1JM4B 4N4HA 4BHWA 3ZPVE 4YH4A 4LYIA 5D3HA 5HENA 3T6RA 2DATA 1U6GB 2EODA 3ONIA 5F2PA 5CUDA 3N9PA 4RVRA 4TS8A 3ZVYA 4NUCA 3Q2FA 4BW1A 4FK5A 2KIZA 4UIWA 5DKHA 4O77A 2OXQC 3KV6A 4C66A 5I1QA 4A9FA 4OGJA 4A9NA 1Z60A 3T7LA 3ZTGA 4Z1QA 2QJ0A 3NG2A 4IOQA 2LGLA 4IOOA 5FE4A 4BJXA 4O70A 5I7XA 5DFDA 4FIPA 4PTBA 5C85A 4KV4A 4TTEA 4HBVA 2KE1A 2KGIA 2DWWA 5CPEA 2L85A 2YURA 5CRZA 2DKWA 5DBMA 5FFVA 2JRJA 5E74A 5CP5A 5TDRA 5CU8A 5D26A 5G04B 5EWVA 2VJFA 5D3NA 5EYAF 2K16A 2ECGA 5I29A 4FLPA 4A9IA 5FE0A 5EI4A 2F42A 1ZS5A 2MA6A 2QICA 2JMIA 4Y03A 5CUBA 5CQAA 5ETDA 5I3LA 3SVHA 4NR7A 5ACYA 2LDRA 2R10A 2YT5A 1JM7A 3SVFA 4V3LC 1WUMA 2LXHC 2RNYA 4QBMA 2MA5A 4E96A 5EQ1A 3GV4A 4MEOA 4YYGA 2N9GA 2RSDA 5CUAA 5KHMA 4YYJA 5C4QA 3PURA 3P1CA 5CS8A 4A4CA 5EPSA 5J0DA 4QR3A 4QNSA 5AD3A 4LYWA 5DLXA 4LK9A 2DVVA 4YAXA 4UIXA 4J1PA 2MD8C 5LJ2A 2Y1NA 5G05B 5FE1A 2MNYA 5ENCA 2D8SA 5B78A 5H1VA 2E6SA 1MM2A 2R0VA 3S92A 5ENFA 3HTKC 5CFWA 5D1LB 2VNFA 2YHNA 3ZNIA 5JI8A 2NAAA 3O7AA 2KU3A 4NR5A 4AYCA 4IORA 4AYCB 4O74A 5B75A 4O7CA 4HXPA 5A7CA 2VJFB 1WEMA 4TU4A 2RI7A 5H85A 5I40A 1F68A 3EB5A 3U5OA 4QSTA 5IGLA 2MT5A 5L8TA 2VPBA 5CUCA 4HBYA 3P1EA 5E3DA 5DW2A 5EM3A 4UITA 5II1A 5BT3A 5E7DA 2M1RA 4DONA 4TKPB 2KREA 5HQ5A 4NXJA 5CQ4A 5EVAA 2H60A 5A5NA 1JM7B 5F1HA 2OO1A 3D7CA 4YYKA 4TZ2A 4CUQA 1Z6UA 5FG5A 4XI1A 2ECJA 3UVXA 4A49A 4UYDA 4ZQLA 5F60A 5F1LA 5ETBA 5FH7A 2G4AA 2OSSA 4HXRA 5FE3A 2KYUA 3PHDA 5EISA 5HRWA 4QF2A 5FERA 5DFBA 3L1ZB 3DQVR 2MJVB 4YH3A 5EGUA 5CGPA 5F36A 4YYMA 2C2VS 3MHHA 2E3KA 2G6QA 5FDZA 2Y43A 5A85A 4QSXA 2YEKA 4QSPA 5EP7A 4TYLA 4ZDTA 4CCGX 4TT4A 4A9MA 3N9NA 3LQIA 3L1XA 3U5LA 1E6IA 5IBNA 2KWNA 4LR6A 2RO1A 1ZBDB 4NRAA 3ZYUA 4MR6A 5HLSA 4A9EA 3FL2A 4MEPA 2JMJA 2RFJA 3QZTA 2OUOA 3G0JA 1XWHA 3KQIA 5KO4A 4F3IA 4Q0NA 2MNZA 2KWJA 3QZVA 4O76A 2LXPC 1X4IA 4LYSA 5ENIA 5LJ1A 4GPJA 4N4FA 4O78A 5JG6A 5C7NA 2I50A 5D3RA 5COIA 1LDKC 2CKLA 5DX4A 4NRBA 5DYAA 3HCSA 5D1KB 3SOUA 5D0CA 3AADA 3RCWA 5DKCA 5K29A 4YBSA 5CTLA 5IGMA 2VJEA 5HFRA 3O35A 4WHWA 5HQ7A 3N9QA 2PNXA 2YQDA 5IG6A 1X0JA 4R8PK 5F63A 4HBWA 3N9OA 4UP0A 2YYNA 5DFCA 4YADA 2RNXA 4FO9A 2K4DA 2DVQA 2K1JA 2HYED 3O70A 2YDWA 4NYWA 3K2JA 3GL6A 4HXMA 3FKMX 4O64A 5E9VA 4A9HA 3JVJA 5DLZA 5IGKA 2L80A 1G25A 5DKAA 1N72A 5BT5A 3MULA 5CUEA 5CQ7A 5AIUA 4UYGA 2I8NA 4WZ0A 4L7XA 2R0YA 2YQMA 3SOXA 4YC9A 1VFYA 5DYUA 2KTBB 5L96A 4CURA 1WEOA 4HXLA 5FFWA 3M99A 5HQ6A 1WILA 3GG3A 3N9MA 5FB1A 3UV5A 3U5JA 3QZSA 2E7NA 1WE9A 4NR9A 2LGKA 5EWHA 2E7OA 2XB1A 4CA1A 1RMDA 4C67A 2VP7A 4IR5A 5E9LA 2VJEB 3C6WA 4LKAA 5B77A 4J0SA 3MQMA 4NQNA 4IC2A 3LJWA 4YABA 2VPEA 4LZSA 3O37A 1WEVA 3LXJA 5FE8A 2DVSA 4WZ3B 4OUFA 4MR5A 5DKDA
chains in the Genus database with same CATH superfamily
2LSPB 4QB3A 2XOYA 4WA6A 2Y1MA 5B76A 3U5MA 1FBVA 4A0CD 4CUTA 3T9KA 2LRIC 4S3OC 5I83A 4NUEA 3I2DA 3DAIA 4HXNA 4I7CA 2ZETC 5A5SA 4P5OB 4ALGA 4XY8A 5KU3A 4UIUA 5TBNA 4R7EA 4IR4A 4CFLA 2DVRA 5II2A 5KH7A 3PUQA 5L98A 4ALHA 2YREA 2M85A 5EICA 2L5UA 3SOWA 5FB0A 3FEHA 5EPBA 1X4UA 5ENHA 3UV2A 4XUBA 4V3KC 3RPGC 4W4UA 2AN6A 3P5OA 2KWKA 4TT2A 3KDEC 5I89A 4FJCA 5E9MA 3HCTA 4PPEA 4R2YA 4LZ2A 4AKIA 1HYJA 4HXOA 4HXKA 2XP0A 2RS9B 5D3SA 3LVQE 5HRVA 4YBMA 4WZ2A 5EWDA 2F6JA 5EV9A 4CUUA 5AITA 4QSWA 4UP5A 4CUPA 3U5PA 2K17A 3LRQA 5H1TA 3M63A 1HYIA 4XYAA 3AQAA 4YYIA 4ZC9A 2VPDA 4NYXA 4XUAA 5EU1A 4LRGA 1T1HA 5B79A 4YBTA 4UIVA 3DWYA 5ENBA 2CT2A 1WGMA 2ECVA 5K3QA 2KR4A 2PUYA 4NR6A 4TZ8A 5TABA 4A9OA 4QSQA 5DYCA 2L75A 4L58A 4B86C 4I7BA 3IU5A 5HJCA 1BORA 5A5RA 2LGVA 2M6MA 2UZGA 5I80A 2C2LA 3S91A 3LJUX 4QSUA 5FE6A 5LKUA 3MUKA 4QEUA 5TDWA 1MM3A 4LC2A 4PCIA 2ECWA 5J3XA 5H1UA 1JOCA 2E6RA 3LQHA 2IDAA 2M3HA 1V87A 5L8UA 4J0RA 1DCQA 2EJNA 1VD4A 4QY4A 5FG4A 2QIZA 5F3AA 5G4RA 5C11A 4HBXA 3NXBA 4UIYA 5A5PA 5AMFA 5FE7A 5KTXA 5L99A 2YSMA 4GNDA 3M62A 4CFKA 5A5QA 2WP1A 4WHUA 4Z6IA 3HCUA 1X4JA 4OGIA 4Z6HA 5A5OA 2CKLB 2L5EA 3LQJA 4B7YC 3DWDA 5C13A 5HFQA 1WEPA 5LUUA 5KH9A 3IU6A 3EB6A 4QZSA 1IYMA 2H0DB 2EGPA 3I3JA 2YW5A 4C9ZA 4O72A 4QSVA 5EWCA 1WEEA 2YVRA 4OGCA 4J3IA 5L97A 4YK0A 5FE9A 5BT4A 1Z2QA 5KTUA 1WEUA 4KV1A 3O33A 3LDYA 2KWOA 3ASLA 3ZPV1 2G45A 4HXSA 2BAYA 5EWWA 2ECNA 4PCEA 2E61A 3N9LA 4MVTA 4NN2A 3VK6A 3FJUB 5FH6A 2LAUA 3MB3A 5ENEA 5DINA 5FEYA 5LJ0A 4LLBA 2ECIA 5G4SA 4QR5A 5D3TA 5EA1A 2D9EA 5KTWA 3KNVA 2MUMA 5H9MA 3IHPA 4NQMA 1WIMA 3SVGA 3O34A 3TLPA 3C5KA 5CQTA 2I7KA 1CHCA 4A9LA 2YYRA 3HMFA 5A82A 3DDTA 4O7EA 4GNFA 4BBQA 4NR8A 5JWMA 4YY4A 5D24A 2M13A 2L43A 4ZW1A 4CLBA 4GNEA 5HM0A 3VKHA 5LCWB 3JVLA 2GRCA 5AD2A 5FG6A 4X3GA 5TRBA 2ECTA 2YSJA 4QUTA 2XEUA 4PS5A 5E73A 5G0FA 2YUCA 2H0DA 4O7AA 4UIZA 4QF3A 3L11A 4F1PA 3MXFA 3ERRA 2FFWA 2L7PA 4CL9A 5LVRA 5D7XA 4QEVA 4AKNA 2CSZA 2KFTA 5B8DA 2KKXA 5CQ6A 4UYHA 4N4IA 4AP4A 4MENA 2B0OE 1VYXA 5F25A 1K2FA 5LKXA 5D3LA 3HMHA 4LZRA 5I86A 4TU6A 2KGGA 4QUUA 3DPLR 5ENJA 1EQFA 2WP2A 4GNGA 5A81A 3ZYQA 4CUSA 3RPGB 5CQ8A 2YU4A 1E4UA 5TB6A 2MIQA 4XY9A 2FUUA 4MR3A 5CY9A 2EA6A 4Z0OA 5C87A 2HDPA 4AI6A 3MHSA 4WIVA 5F62A 4LADB 4MEQA 4NRCA 4O75A 4O7FA 4AUQB 5IGNA 2DJAA 3SHBA 4AVXA 5HRXA 4NR4A 5CZGA 5DY7A 4BW2A 4BW4A 2NXBA 4NS5A 4IC3A 5E9KA 4UI9B 5E9YA 5C8GA 5CUGA 4I7DA 4S3OB 4UYFB 2LGGA 1WUGA 5E9IA 1WENA 2YELA 3D1BA 5F5ZA 3UW9A 5C89A 1WEWA 3JVKA 4IR6A 4QC3A 4Q0OA 5I7YA 1F62A 4UYEA 2FSAA 4MR4A 5EPRA 5LKZA 3UVWA 2LV9A 5KH3A 3G0LA 4QSRA 3SUBA 4NUDA 3JVMA 2D8UA 3KV5A 5FE5A 1WESA 4GB0A 2KKYA 2LN0A 5CQ3A 1N87A 2F6NA 4QQ4A 2OWAA 5DYXA 4PKLA 4YYHA 5FFYA 2YHOA 5CQ5A 4MSXA 5DW1A 3P1DA 3U5NA 5I88A 4A9JA 3RTRB 3O36A 4QR4A 4O71A 5D25A 5EK9A 4PY6A 4YYNA 1WFKA 2CSYA 2L84A 4N4GA 4Z1SA 2P57A 1DVPA 2MKEA 4TT6A 4YY6A 2JMDA 4F52B 4ZUXU 2RNWA 3Q2EA 2R0SA 2YQLA 4A9KA 4QEWA 2FUIA 1LDJB 5E0RA 4N3WA 4Q6FA 5D3JA 5A83A 5AMEA 5D3PA 4X2IA 5FH8A 4O62A 4UYFA 5D1MB 3ZVZB 2VPGA 2DX8A 4KCXA 4QYDA 4YATA 3UVYA 1PUOA 5IIDA 2G43A 3HMEA 5F61A 2YEMA 4QC1A 5LKTA 3UV4A 1FP0A 5HELA 4IR3A 2L0BA 4A4BA 4TQNA 4Z93A 4O7BA 5HEMA 2YW8A 4BW3A 4QYLA 3UVDA 3U5KA 5HCLA 2LQ6A 4QSSA 3P1FA 3V43A 1WEQA 1JSPB 3MB4A 4LJNA 4YYDA 4NYVA 5TCMA 5CRMA 4LDFA 5FE2A 2MD7B 2D82A 5ENGA 5E3GA 5LVQA 5FBXA 1JM4B 3FANA 4N4HA 4BHWA 3ZPVE 4YH4A 4LYIA 5D3HA 5HENA 3T6RA 2DATA 1U6GB 2EODA 3ONIA 5F2PA 5CUDA 3N9PA 4RVRA 4TS8A 3ZVYA 4NUCA 3Q2FA 4BW1A 4FK5A 2KIZA 4UIWA 5DKHA 4O77A 2OXQC 3KV6A 4C66A 5I1QA 2IQJA 4A9FA 4OGJA 4A9NA 1Z60A 3T7LA 3ZTGA 4Z1QA 2QJ0A 4AKGA 3NG2A 4IOQA 2LGLA 4IOOA 5FE4A 4BJXA 4O70A 5I7XA 5DFDA 4FIPA 4PTBA 5C85A 4KV4A 4TTEA 4HBVA 5SVXA 2KE1A 2KGIA 2DWWA 5CPEA 2L85A 2YURA 5CRZA 2DKWA 5DBMA 5FFVA 2JRJA 3JUEA 5E74A 5CP5A 5TDRA 5CU8A 5D26A 5G04B 5EWVA 2VJFA 5D3NA 5EYAF 2K16A 2ECGA 5I29A 2EXUA 4FLPA 4A9IA 5FE0A 5EI4A 2F42A 1ZS5A 2MA6A 2QICA 2JMIA 4Y03A 2CRRA 5CUBA 5CQAA 5ETDA 5I3LA 3SVHA 4NR7A 5ACYA 2LDRA 2R10A 2YT5A 1JM7A 3SVFA 4V3LC 1WUMA 2LXHC 2RNYA 4QBMA 2MA5A 4E96A 5EQ1A 3GV4A 4MEOA 4YYGA 2N9GA 2RSDA 5CUAA 5KHMA 4YYJA 5C4QA 3FM8C 3P1CA 5CS8A 3PURA 4A4CA 5EPSA 3D1DA 5J0DA 4QR3A 1ZKRA 4QNSA 5AD3A 4LYWA 5DLXA 4LK9A 4Z0RA 2DVVA 4YAXA 4UIXA 4J1PA 4H9DA 2MD8C 3M7KA 5LJ2A 2Y1NA 1MBMA 5G05B 5FE1A 2MNYA 5ENCA 2D8SA 5B78A 5H1VA 2E6SA 1MM2A 2R0VA 3S92A 5ENFA 2JM3A 3HTKC 5CFWA 5D1LB 2VNFA 2YHNA 3ZNIA 5JI8A 2NAAA 3O7AA 2KU3A 4NR5A 4AYCA 4IORA 4AYCB 4O74A 5B75A 4O7CA 4HXPA 5A7CA 2VJFB 1WEMA 2JUNA 4TU4A 2RI7A 5H85A 5I40A 1F68A 3EB5A 3U5OA 4QSTA 5IGLA 2MT5A 5L8TA 2VPBA 5CUCA 4HBYA 3P1EA 5E3DA 5DW2A 5EM3A 4UITA 5II1A 5BT3A 5E7DA 2M1RA 4DONA 4TKPB 2KREA 5HQ5A 4NXJA 5CQ4A 5EVAA 2H60A 3VKGA 5A5NA 1JM7B 5F1HA 2OO1A 3D7CA 4YYKA 4TZ2A 4CUQA 1Z6UA 5FG5A 2CRWA 2ECJA 4XI1A 3UVXA 4A49A 4UYDA 4ZQLA 5F60A 5F1LA 5ETBA 5FH7A 2G4AA 2OSSA 4HXRA 5FE3A 2KYUA 3PHDA 5EISA 5HRWA 4QF2A 5FERA 5DFBA 3L1ZB 5SVIB 3DQVR 2MJVB 4YH3A 5EGUA 5CGPA 5F36A 4YYMA 2C2VS 3E2DA 3MHHA 2E3KA 2G6QA 5FDZA 2Y43A 5A85A 4QSXA 2YEKA 4QSPA 5EP7A 4TYLA 4OGEA 4ZDTA 4CCGX 4TT4A 4A9MA 3N9NA 3LQIA 3L1XA 3U5LA 1E6IA 5IBNA 2KWNA 4LR6A 2FD4A 2RO1A 1ZBDB 4NRAA 3ZYUA 4MR6A 5HLSA 4A9EA 3O47A 3FL2A 4MEPA 2JMJA 2RFJA 3QZTA 2RR4A 2OUOA 3G0JA 1XWHA 3KQIA 5KO4A 4F3IA 4Q0NA 2MNZA 2KWJA 3QZVA 4O76A 2LXPC 1X4IA 4LYSA 5ENIA 5LJ1A 5SVIA 4GPJA 4N4FA 4O78A 5JG6A 5C7NA 2I50A 5D3RA 5COIA 1LDKC 2CKLA 5DX4A 4NRBA 5DYAA 3HCSA 5D1KB 3SOUA 5D0CA 3AADA 3H7HA 3RCWA 5DKCA 5K29A 4YBSA 5CTLA 5IGMA 2VJEA 5HFRA 3O35A 4WHWA 5HQ7A 3N9QA 2PNXA 2YQDA 5IG6A 1X0JA 4R8PK 5F63A 4HBWA 3N9OA 4UP0A 2YYNA 5DFCA 4YADA 2RNXA 4FO9A 2K4DA 2DVQA 2K1JA 2HYED 3O70A 2YDWA 4NYWA 3K2JA 3GL6A 4HXMA 2XOCA 3FKMX 2EGMA 4O64A 5E9VA 4A9HA 3JVJA 5DLZA 5IGKA 2L80A 1G25A 5DKAA 3Q1DA 1N72A 5BT5A 3FAOA 3LVRE 3MULA 5CUEA 5CQ7A 5AIUA 4UYGA 2I8NA 4WZ0A 4L7XA 2R0YA 2YQMA 3SOXA 4AKHA 4YC9A 1VFYA 5DYUA 2CSVA 2CONA 2KTBB 5L96A 4CURA 1WEOA 4HXLA 5FFWA 3M99A 5HQ6A 1WILA 3GG3A 3N9MA 5SVYA 5FB1A 3UV5A 3U5JA 3QZSA 2E7NA 1WE9A 3MDBC 4NR9A 2LGKA 5EWHA 2E7OA 2XB1A 4CA1A 1RMDA 4C67A 2VP7A 4IR5A 5E9LA 2VJEB 3C6WA 4LKAA 5B77A 4J0SA 3MQMA 4NQNA 4IC2A 3PLWA 3LJWA 4YABA 2VPEA 2DSMA 4LZSA 3O37A 1WEVA 3LXJA 5FE8A 2XOZA 2DVSA 4WZ3B 4OUFA 4MR5A 5DKDA
chains in the Genus database with same CATH topology
2LSPB 4QB3A 4WA6A 5B76A 2Y1MA 3U5MA 1FBVA 4A0CD 4CUTA 2LRIC 4S3OC 5I83A 4NUEA 3I2DA 3DAIA 4HXNA 4I7CA 2ZETC 5A5SA 4P5OB 4ALGA 4XY8A 5KU3A 4UIUA 5TBNA 4R7EA 4IR4A 4CFLA 2DVRA 5II2A 5KH7A 3PUQA 5L98A 4ALHA 2YREA 2M85A 5EICA 2L5UA 3SOWA 5FB0A 5EPBA 1X4UA 5ENHA 3UV2A 4XUBA 4V3KC 3RPGC 4W4UA 2AN6A 3P5OA 2KWKA 4TT2A 5I89A 4FJCA 5E9MA 3HCTA 4PPEA 4R2YA 4LZ2A 1HYJA 4HXOA 4HXKA 2RS9B 5D3SA 5HRVA 4YBMA 4WZ2A 5EWDA 2F6JA 5EV9A 4CUUA 5AITA 4QSWA 4UP5A 4CUPA 3U5PA 2K17A 3LRQA 5H1TA 3M63A 1HYIA 4XYAA 3AQAA 4YYIA 4ZC9A 2VPDA 4NYXA 4XUAA 5EU1A 4LRGA 1T1HA 5B79A 4YBTA 4UIVA 3DWYA 5ENBA 2CT2A 1WGMA 2ECVA 2KR4A 2PUYA 4NR6A 4TZ8A 5TABA 4A9OA 4QSQA 5DYCA 2L75A 4L58A 4B86C 4I7BA 3IU5A 5HJCA 1BORA 5A5RA 2LGVA 2M6MA 2UZGA 5I80A 2C2LA 3S91A 4QSUA 5FE6A 5LKUA 3MUKA 4QEUA 5TDWA 1MM3A 4LC2A 4PCIA 2ECWA 5J3XA 5H1UA 1JOCA 2E6RA 3LQHA 2IDAA 2M3HA 1V87A 5L8UA 4J0RA 1VD4A 4QY4A 5FG4A 2QIZA 5F3AA 5G4RA 5C11A 4HBXA 3NXBA 4UIYA 5A5PA 5AMFA 5FE7A 5KTXA 5L99A 2YSMA 4GNDA 3M62A 4CFKA 5A5QA 2WP1A 4WHUA 4Z6IA 3HCUA 1X4JA 4OGIA 4Z6HA 5A5OA 2CKLB 2L5EA 3LQJA 4B7YC 5C13A 5HFQA 1WEPA 5LUUA 5KH9A 3IU6A 3EB6A 4QZSA 1IYMA 2H0DB 2EGPA 3I3JA 2YW5A 4C9ZA 4O72A 4QSVA 5EWCA 1WEEA 4J3IA 5L97A 4YK0A 5FE9A 5BT4A 1Z2QA 5KTUA 1WEUA 4KV1A 3O33A 2KWOA 3ASLA 3ZPV1 2G45A 4HXSA 2BAYA 5EWWA 2ECNA 4PCEA 3N9LA 4MVTA 4NN2A 3VK6A 5FH6A 3MB3A 5ENEA 5DINA 5FEYA 5LJ0A 4LLBA 2ECIA 5G4SA 4QR5A 5D3TA 5EA1A 2D9EA 5KTWA 3KNVA 2MUMA 5H9MA 3IHPA 4NQMA 1WIMA 3SVGA 3O34A 3TLPA 3C5KA 5CQTA 2I7KA 1CHCA 4A9LA 2YYRA 3HMFA 5A82A 4O7EA 4GNFA 4BBQA 4NR8A 5JWMA 4YY4A 5D24A 2L43A 4ZW1A 4CLBA 4GNEA 5HM0A 5LCWB 3JVLA 2GRCA 5AD2A 5FG6A 4X3GA 5TRBA 2ECTA 2YSJA 4QUTA 2XEUA 4PS5A 5E73A 5G0FA 2YUCA 2H0DA 4O7AA 4UIZA 4QF3A 3L11A 3MXFA 4CL9A 5LVRA 5D7XA 4QEVA 4AKNA 2CSZA 2KFTA 5B8DA 5CQ6A 4UYHA 4N4IA 4AP4A 4MENA 1VYXA 5F25A 1K2FA 5LKXA 5D3LA 3HMHA 4LZRA 5I86A 4TU6A 2KGGA 4QUUA 3DPLR 5ENJA 1EQFA 2WP2A 4GNGA 5A81A 3ZYQA 4CUSA 3RPGB 5CQ8A 2YU4A 1E4UA 5TB6A 2MIQA 4XY9A 2FUUA 4MR3A 5CY9A 2EA6A 5C87A 2HDPA 3MHSA 4WIVA 5F62A 4LADB 4MEQA 4NRCA 4O75A 4O7FA 4AUQB 5IGNA 3SHBA 4AVXA 5HRXA 4NR4A 5CZGA 5DY7A 4BW2A 4BW4A 2NXBA 4NS5A 4IC3A 5E9KA 4UI9B 5E9YA 5C8GA 5CUGA 4I7DA 4S3OB 4UYFB 2LGGA 1WUGA 5E9IA 1WENA 2YELA 5F5ZA 3UW9A 5C89A 1WEWA 3JVKA 4IR6A 4QC3A 4Q0OA 5I7YA 1F62A 4UYEA 2FSAA 4MR4A 5EPRA 5LKZA 3UVWA 2LV9A 5KH3A 3G0LA 4QSRA 4NUDA 3JVMA 3KV5A 5FE5A 1WESA 4GB0A 2LN0A 5CQ3A 1N87A 2F6NA 5DYXA 4PKLA 4YYHA 5FFYA 2YHOA 5CQ5A 4MSXA 5DW1A 3P1DA 3U5NA 5I88A 4A9JA 3RTRB 3O36A 4QR4A 4O71A 5D25A 5EK9A 4PY6A 4YYNA 1WFKA 2CSYA 2L84A 4N4GA 4Z1SA 1DVPA 4TT6A 4YY6A 2JMDA 4F52B 4ZUXU 2RNWA 3Q2EA 2R0SA 2YQLA 4A9KA 4QEWA 2FUIA 1LDJB 5E0RA 4N3WA 4Q6FA 5D3JA 5A83A 5AMEA 5D3PA 4X2IA 5FH8A 4UYFA 5D1MB 3ZVZB 2VPGA 2DX8A 4KCXA 4QYDA 4YATA 3UVYA 5IIDA 2G43A 3HMEA 5F61A 2YEMA 4QC1A 5LKTA 3UV4A 1FP0A 5HELA 4IR3A 2L0BA 4A4BA 4TQNA 4Z93A 4O7BA 5HEMA 2YW8A 4BW3A 4QYLA 3UVDA 3U5KA 5HCLA 2LQ6A 4QSSA 3P1FA 3V43A 1WEQA 1JSPB 3MB4A 4LJNA 4YYDA 4NYVA 5TCMA 5CRMA 4LDFA 5FE2A 2MD7B 2D82A 5ENGA 5E3GA 5LVQA 5FBXA 1JM4B 4N4HA 4BHWA 3ZPVE 4YH4A 4LYIA 5D3HA 5HENA 3T6RA 2DATA 1U6GB 2EODA 3ONIA 5F2PA 5CUDA 3N9PA 4RVRA 4TS8A 3ZVYA 4NUCA 3Q2FA 4BW1A 4FK5A 2KIZA 4UIWA 5DKHA 4O77A 2OXQC 3KV6A 4C66A 5I1QA 4A9FA 4OGJA 4A9NA 1Z60A 3T7LA 3ZTGA 4Z1QA 2QJ0A 3NG2A 4IOQA 2LGLA 4IOOA 5FE4A 4BJXA 4O70A 5I7XA 5DFDA 4FIPA 4PTBA 5C85A 4KV4A 4TTEA 4HBVA 2KE1A 2KGIA 2DWWA 5CPEA 2L85A 2YURA 5CRZA 2DKWA 5DBMA 5FFVA 2JRJA 5E74A 5CP5A 5TDRA 5CU8A 5D26A 5G04B 5EWVA 2VJFA 5D3NA 5EYAF 2K16A 2ECGA 5I29A 4FLPA 4A9IA 5FE0A 5EI4A 2F42A 1ZS5A 2MA6A 2QICA 2JMIA 4Y03A 5CUBA 5CQAA 5ETDA 5I3LA 3SVHA 4NR7A 5ACYA 2LDRA 2R10A 2YT5A 1JM7A 3SVFA 4V3LC 1WUMA 2LXHC 2RNYA 4QBMA 2MA5A 4E96A 5EQ1A 3GV4A 4MEOA 4YYGA 2N9GA 2RSDA 5CUAA 5KHMA 4YYJA 5C4QA 3PURA 3P1CA 5CS8A 4A4CA 5EPSA 5J0DA 4QR3A 4QNSA 5AD3A 4LYWA 5DLXA 4LK9A 2DVVA 4YAXA 4UIXA 4J1PA 2MD8C 5LJ2A 2Y1NA 5G05B 5FE1A 2MNYA 5ENCA 2D8SA 5B78A 5H1VA 2E6SA 1MM2A 2R0VA 3S92A 5ENFA 3HTKC 5CFWA 5D1LB 2VNFA 2YHNA 3ZNIA 5JI8A 2NAAA 3O7AA 2KU3A 4NR5A 4AYCA 4IORA 4AYCB 4O74A 5B75A 4O7CA 4HXPA 5A7CA 2VJFB 1WEMA 4TU4A 2RI7A 5H85A 5I40A 1F68A 3EB5A 3U5OA 4QSTA 5IGLA 2MT5A 5L8TA 2VPBA 5CUCA 4HBYA 3P1EA 5E3DA 5DW2A 5EM3A 4UITA 5II1A 5BT3A 5E7DA 2M1RA 4DONA 4TKPB 2KREA 5HQ5A 4NXJA 5CQ4A 5EVAA 2H60A 5A5NA 1JM7B 5F1HA 2OO1A 3D7CA 4YYKA 4TZ2A 4CUQA 1Z6UA 5FG5A 4XI1A 2ECJA 3UVXA 4A49A 4UYDA 4ZQLA 5F60A 5F1LA 5ETBA 5FH7A 2G4AA 2OSSA 4HXRA 5FE3A 2KYUA 3PHDA 5EISA 5HRWA 4QF2A 5FERA 5DFBA 3L1ZB 3DQVR 2MJVB 4YH3A 5EGUA 5CGPA 5F36A 4YYMA 2C2VS 3MHHA 2E3KA 2G6QA 5FDZA 2Y43A 5A85A 4QSXA 2YEKA 4QSPA 5EP7A 4TYLA 4ZDTA 4CCGX 4TT4A 4A9MA 3N9NA 3LQIA 3L1XA 3U5LA 1E6IA 5IBNA 2KWNA 4LR6A 2RO1A 1ZBDB 4NRAA 3ZYUA 4MR6A 5HLSA 4A9EA 3FL2A 4MEPA 2JMJA 2RFJA 3QZTA 2OUOA 3G0JA 1XWHA 3KQIA 5KO4A 4F3IA 4Q0NA 2MNZA 2KWJA 3QZVA 4O76A 2LXPC 1X4IA 4LYSA 5ENIA 5LJ1A 4GPJA 4N4FA 4O78A 5JG6A 5C7NA 2I50A 5D3RA 5COIA 1LDKC 2CKLA 5DX4A 4NRBA 5DYAA 3HCSA 5D1KB 3SOUA 5D0CA 3AADA 3RCWA 5DKCA 5K29A 4YBSA 5CTLA 5IGMA 2VJEA 5HFRA 3O35A 4WHWA 5HQ7A 3N9QA 2PNXA 2YQDA 5IG6A 1X0JA 4R8PK 5F63A 4HBWA 3N9OA 4UP0A 2YYNA 5DFCA 4YADA 2RNXA 4FO9A 2K4DA 2DVQA 2K1JA 2HYED 3O70A 2YDWA 4NYWA 3K2JA 3GL6A 4HXMA 3FKMX 4O64A 5E9VA 4A9HA 3JVJA 5DLZA 5IGKA 2L80A 1G25A 5DKAA 1N72A 5BT5A 3MULA 5CUEA 5CQ7A 5AIUA 4UYGA 2I8NA 4WZ0A 4L7XA 2R0YA 2YQMA 3SOXA 4YC9A 1VFYA 5DYUA 2KTBB 5L96A 4CURA 1WEOA 4HXLA 5FFWA 3M99A 5HQ6A 1WILA 3GG3A 3N9MA 5FB1A 3UV5A 3U5JA 3QZSA 2E7NA 1WE9A 4NR9A 2LGKA 5EWHA 2E7OA 2XB1A 4CA1A 1RMDA 4C67A 2VP7A 4IR5A 5E9LA 2VJEB 3C6WA 4LKAA 5B77A 4J0SA 3MQMA 4NQNA 4IC2A 3LJWA 4YABA 2VPEA 4LZSA 3O37A 1WEVA 3LXJA 5FE8A 2DVSA 4WZ3B 4OUFA 4MR5A 5DKDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LSP B;  4QB3 A;  4WA6 A;  5B76 A;  2Y1M A;  3U5M A;  1FBV A;  4A0C D;  4CUT A;  2LRI C;  4S3O C;  5I83 A;  4NUE A;  3I2D A;  3DAI A;  4HXN A;  4I7C A;  2ZET C;  5A5S A;  4P5O B;  4ALG A;  4XY8 A;  5KU3 A;  4UIU A;  5TBN A;  4R7E A;  4IR4 A;  4CFL A;  2DVR A;  5II2 A;  5KH7 A;  3PUQ A;  5L98 A;  4ALH A;  2YRE A;  2M85 A;  5EIC A;  2L5U A;  3SOW A;  5FB0 A;  5EPB A;  1X4U A;  5ENH A;  3UV2 A;  4XUB A;  4V3K C;  3RPG C;  4W4U A;  2AN6 A;  3P5O A;  2KWK A;  4TT2 A;  5I89 A;  4FJC A;  5E9M A;  3HCT A;  4PPE A;  4R2Y A;  4LZ2 A;  1HYJ A;  4HXO A;  4HXK A;  2RS9 B;  5D3S A;  5HRV A;  4YBM A;  4WZ2 A;  5EWD A;  2F6J A;  5EV9 A;  4CUU A;  5AIT A;  4QSW A;  4UP5 A;  4CUP A;  3U5P A;  2K17 A;  3LRQ A;  5H1T A;  3M63 A;  1HYI A;  4XYA A;  3AQA A;  4YYI A;  4ZC9 A;  2VPD A;  4NYX A;  4XUA A;  5EU1 A;  4LRG A;  1T1H A;  5B79 A;  4YBT A;  4UIV A;  3DWY A;  5ENB A;  2CT2 A;  1WGM A;  2ECV A;  2KR4 A;  2PUY A;  4NR6 A;  4TZ8 A;  5TAB A;  4A9O A;  4QSQ A;  5DYC A;  2L75 A;  4L58 A;  4B86 C;  4I7B A;  3IU5 A;  5HJC A;  1BOR A;  5A5R A;  2LGV A;  2M6M A;  2UZG A;  5I80 A;  2C2L A;  3S91 A;  4QSU A;  5FE6 A;  5LKU A;  3MUK A;  4QEU A;  5TDW A;  1MM3 A;  4LC2 A;  4PCI A;  2ECW A;  5J3X A;  5H1U A;  1JOC A;  2E6R A;  3LQH A;  2IDA A;  2M3H A;  1V87 A;  5L8U A;  4J0R A;  1VD4 A;  4QY4 A;  5FG4 A;  2QIZ A;  5F3A A;  5G4R A;  5C11 A;  4HBX A;  3NXB A;  4UIY A;  5A5P A;  5AMF A;  5FE7 A;  5KTX A;  5L99 A;  2YSM A;  4GND A;  3M62 A;  4CFK A;  5A5Q A;  2WP1 A;  4WHU A;  4Z6I A;  3HCU A;  1X4J A;  4OGI A;  4Z6H A;  5A5O A;  2CKL B;  2L5E A;  3LQJ A;  4B7Y C;  5C13 A;  5HFQ A;  1WEP A;  5LUU A;  5KH9 A;  3IU6 A;  3EB6 A;  4QZS A;  1IYM A;  2H0D B;  2EGP A;  3I3J A;  2YW5 A;  4C9Z A;  4O72 A;  4QSV A;  5EWC A;  1WEE A;  4J3I A;  5L97 A;  4YK0 A;  5FE9 A;  5BT4 A;  1Z2Q A;  5KTU A;  1WEU A;  4KV1 A;  3O33 A;  2KWO A;  3ASL A;  3ZPV 1;  2G45 A;  4HXS A;  2BAY A;  5EWW A;  2ECN A;  4PCE A;  3N9L A;  4MVT A;  4NN2 A;  3VK6 A;  5FH6 A;  3MB3 A;  5ENE A;  5DIN A;  5FEY A;  5LJ0 A;  4LLB A;  2ECI A;  5G4S A;  4QR5 A;  5D3T A;  5EA1 A;  2D9E A;  5KTW A;  3KNV A;  2MUM A;  5H9M A;  3IHP A;  4NQM A;  1WIM A;  3SVG A;  3O34 A;  3TLP A;  3C5K A;  5CQT A;  2I7K A;  1CHC A;  4A9L A;  2YYR A;  3HMF A;  5A82 A;  4O7E A;  4GNF A;  4BBQ A;  4NR8 A;  5JWM A;  4YY4 A;  5D24 A;  2L43 A;  4ZW1 A;  4CLB A;  4GNE A;  5HM0 A;  5LCW B;  3JVL A;  2GRC A;  5AD2 A;  5FG6 A;  4X3G A;  5TRB A;  2ECT A;  2YSJ A;  4QUT A;  2XEU A;  4PS5 A;  5E73 A;  5G0F A;  2YUC A;  2H0D A;  4O7A A;  4UIZ A;  4QF3 A;  3L11 A;  3MXF A;  4CL9 A;  5LVR A;  5D7X A;  4QEV A;  4AKN A;  2CSZ A;  2KFT A;  5B8D A;  5CQ6 A;  4UYH A;  4N4I A;  4AP4 A;  4MEN A;  1VYX A;  5F25 A;  1K2F A;  5LKX A;  5D3L A;  3HMH A;  4LZR A;  5I86 A;  4TU6 A;  2KGG A;  4QUU A;  3DPL R;  5ENJ A;  1EQF A;  2WP2 A;  4GNG A;  5A81 A;  3ZYQ A;  4CUS A;  3RPG B;  5CQ8 A;  2YU4 A;  1E4U A;  5TB6 A;  2MIQ A;  4XY9 A;  2FUU A;  4MR3 A;  5CY9 A;  2EA6 A;  5C87 A;  2HDP A;  3MHS A;  4WIV A;  5F62 A;  4LAD B;  4MEQ A;  4NRC A;  4O75 A;  4O7F A;  4AUQ B;  5IGN A;  3SHB A;  4AVX A;  5HRX A;  4NR4 A;  5CZG A;  5DY7 A;  4BW2 A;  4BW4 A;  2NXB A;  4NS5 A;  4IC3 A;  5E9K A;  4UI9 B;  5E9Y A;  5C8G A;  5CUG A;  4I7D A;  4S3O B;  4UYF B;  2LGG A;  1WUG A;  5E9I A;  1WEN A;  2YEL A;  5F5Z A;  3UW9 A;  5C89 A;  1WEW A;  3JVK A;  4IR6 A;  4QC3 A;  4Q0O A;  5I7Y A;  1F62 A;  4UYE A;  2FSA A;  4MR4 A;  5EPR A;  5LKZ A;  3UVW A;  2LV9 A;  5KH3 A;  3G0L A;  4QSR A;  4NUD A;  3JVM A;  3KV5 A;  5FE5 A;  1WES A;  4GB0 A;  2LN0 A;  5CQ3 A;  1N87 A;  2F6N A;  5DYX A;  4PKL A;  4YYH A;  5FFY A;  2YHO A;  5CQ5 A;  4MSX A;  5DW1 A;  3P1D A;  3U5N A;  5I88 A;  4A9J A;  3RTR B;  3O36 A;  4QR4 A;  4O71 A;  5D25 A;  5EK9 A;  4PY6 A;  4YYN A;  1WFK A;  2CSY A;  2L84 A;  4N4G A;  4Z1S A;  1DVP A;  4TT6 A;  4YY6 A;  2JMD A;  4F52 B;  4ZUX U;  2RNW A;  3Q2E A;  2R0S A;  2YQL A;  4A9K A;  4QEW A;  2FUI A;  1LDJ B;  5E0R A;  4N3W A;  4Q6F A;  5D3J A;  5A83 A;  5AME A;  5D3P A;  4X2I A;  5FH8 A;  4UYF A;  5D1M B;  3ZVZ B;  2VPG A;  2DX8 A;  4KCX A;  4QYD A;  4YAT A;  3UVY A;  5IID A;  2G43 A;  3HME A;  5F61 A;  2YEM A;  4QC1 A;  5LKT A;  3UV4 A;  1FP0 A;  5HEL A;  4IR3 A;  2L0B A;  4A4B A;  4TQN A;  4Z93 A;  4O7B A;  5HEM A;  2YW8 A;  4BW3 A;  4QYL A;  3UVD A;  3U5K A;  5HCL A;  2LQ6 A;  4QSS A;  3P1F A;  3V43 A;  1WEQ A;  1JSP B;  3MB4 A;  4LJN A;  4YYD A;  4NYV A;  5TCM A;  5CRM A;  4LDF A;  5FE2 A;  2MD7 B;  2D82 A;  5ENG A;  5E3G A;  5LVQ A;  5FBX A;  1JM4 B;  4N4H A;  4BHW A;  3ZPV E;  4YH4 A;  4LYI A;  5D3H A;  5HEN A;  3T6R A;  2DAT A;  1U6G B;  2EOD A;  3ONI A;  5F2P A;  5CUD A;  3N9P A;  4RVR A;  4TS8 A;  3ZVY A;  4NUC A;  3Q2F A;  4BW1 A;  4FK5 A;  2KIZ A;  4UIW A;  5DKH A;  4O77 A;  2OXQ C;  3KV6 A;  4C66 A;  5I1Q A;  4A9F A;  4OGJ A;  4A9N A;  1Z60 A;  3T7L A;  3ZTG A;  4Z1Q A;  2QJ0 A;  3NG2 A;  4IOQ A;  2LGL A;  4IOO A;  5FE4 A;  4BJX A;  4O70 A;  5I7X A;  5DFD A;  4FIP A;  4PTB A;  5C85 A;  4KV4 A;  4TTE A;  4HBV A;  2KE1 A;  2KGI A;  2DWW A;  5CPE A;  2L85 A;  2YUR A;  5CRZ A;  2DKW A;  5DBM A;  5FFV A;  2JRJ A;  5E74 A;  5CP5 A;  5TDR A;  5CU8 A;  5D26 A;  5G04 B;  5EWV A;  2VJF A;  5D3N A;  5EYA F;  2K16 A;  2ECG A;  5I29 A;  4FLP A;  4A9I A;  5FE0 A;  5EI4 A;  2F42 A;  1ZS5 A;  2MA6 A;  2QIC A;  2JMI A;  4Y03 A;  5CUB A;  5CQA A;  5ETD A;  5I3L A;  3SVH A;  4NR7 A;  5ACY A;  2LDR A;  2R10 A;  2YT5 A;  1JM7 A;  3SVF A;  4V3L C;  1WUM A;  2LXH C;  2RNY A;  4QBM A;  2MA5 A;  4E96 A;  5EQ1 A;  3GV4 A;  4MEO A;  4YYG A;  2N9G A;  2RSD A;  5CUA A;  5KHM A;  4YYJ A;  5C4Q A;  3PUR A;  3P1C A;  5CS8 A;  4A4C A;  5EPS A;  5J0D A;  4QR3 A;  4QNS A;  5AD3 A;  4LYW A;  5DLX A;  4LK9 A;  2DVV A;  4YAX A;  4UIX A;  4J1P A;  2MD8 C;  5LJ2 A;  2Y1N A;  5G05 B;  5FE1 A;  2MNY A;  5ENC A;  2D8S A;  5B78 A;  5H1V A;  2E6S A;  1MM2 A;  2R0V A;  3S92 A;  5ENF A;  3HTK C;  5CFW A;  5D1L B;  2VNF A;  2YHN A;  3ZNI A;  5JI8 A;  2NAA A;  3O7A A;  2KU3 A;  4NR5 A;  4AYC A;  4IOR A;  4AYC B;  4O74 A;  5B75 A;  4O7C A;  4HXP A;  5A7C A;  2VJF B;  1WEM A;  4TU4 A;  2RI7 A;  5H85 A;  5I40 A;  1F68 A;  3EB5 A;  3U5O A;  4QST A;  5IGL A;  2MT5 A;  5L8T A;  2VPB A;  5CUC A;  4HBY A;  3P1E A;  5E3D A;  5DW2 A;  5EM3 A;  4UIT A;  5II1 A;  5BT3 A;  5E7D A;  2M1R A;  4DON A;  4TKP B;  2KRE A;  5HQ5 A;  4NXJ A;  5CQ4 A;  5EVA A;  2H60 A;  5A5N A;  1JM7 B;  5F1H A;  2OO1 A;  3D7C A;  4YYK A;  4TZ2 A;  4CUQ A;  1Z6U A;  5FG5 A;  4XI1 A;  2ECJ A;  3UVX A;  4A49 A;  4UYD A;  4ZQL A;  5F60 A;  5F1L A;  5ETB A;  5FH7 A;  2G4A A;  2OSS A;  4HXR A;  5FE3 A;  2KYU A;  3PHD A;  5EIS A;  5HRW A;  4QF2 A;  5FER A;  5DFB A;  3L1Z B;  3DQV R;  2MJV B;  4YH3 A;  5EGU A;  5CGP A;  5F36 A;  4YYM A;  2C2V S;  3MHH A;  2E3K A;  2G6Q A;  5FDZ A;  2Y43 A;  5A85 A;  4QSX A;  2YEK A;  4QSP A;  5EP7 A;  4TYL A;  4ZDT A;  4CCG X;  4TT4 A;  4A9M A;  3N9N A;  3LQI A;  3L1X A;  3U5L A;  1E6I A;  5IBN A;  2KWN A;  4LR6 A;  2RO1 A;  1ZBD B;  4NRA A;  3ZYU A;  4MR6 A;  5HLS A;  4A9E A;  3FL2 A;  4MEP A;  2JMJ A;  2RFJ A;  3QZT A;  2OUO A;  3G0J A;  1XWH A;  3KQI A;  5KO4 A;  4F3I A;  4Q0N A;  2MNZ A;  2KWJ A;  3QZV A;  4O76 A;  2LXP C;  1X4I A;  4LYS A;  5ENI A;  5LJ1 A;  4GPJ A;  4N4F A;  4O78 A;  5JG6 A;  5C7N A;  2I50 A;  5D3R A;  5COI A;  1LDK C;  2CKL A;  5DX4 A;  4NRB A;  5DYA A;  3HCS A;  5D1K B;  3SOU A;  5D0C A;  3AAD A;  3RCW A;  5DKC A;  5K29 A;  4YBS A;  5CTL A;  5IGM A;  2VJE A;  5HFR A;  3O35 A;  4WHW A;  5HQ7 A;  3N9Q A;  2PNX A;  2YQD A;  5IG6 A;  1X0J A;  4R8P K;  5F63 A;  4HBW A;  3N9O A;  4UP0 A;  2YYN A;  5DFC A;  4YAD A;  2RNX A;  4FO9 A;  2K4D A;  2DVQ A;  2K1J A;  2HYE D;  3O70 A;  2YDW A;  4NYW A;  3K2J A;  3GL6 A;  4HXM A;  3FKM X;  4O64 A;  5E9V A;  4A9H A;  3JVJ A;  5DLZ A;  5IGK A;  2L80 A;  1G25 A;  5DKA A;  1N72 A;  5BT5 A;  3MUL A;  5CUE A;  5CQ7 A;  5AIU A;  4UYG A;  2I8N A;  4WZ0 A;  4L7X A;  2R0Y A;  2YQM A;  3SOX A;  4YC9 A;  1VFY A;  5DYU A;  2KTB B;  5L96 A;  4CUR A;  1WEO A;  4HXL A;  5FFW A;  3M99 A;  5HQ6 A;  1WIL A;  3GG3 A;  3N9M A;  5FB1 A;  3UV5 A;  3U5J A;  3QZS A;  2E7N A;  1WE9 A;  4NR9 A;  2LGK A;  5EWH A;  2E7O A;  2XB1 A;  4CA1 A;  1RMD A;  4C67 A;  2VP7 A;  4IR5 A;  5E9L A;  2VJE B;  3C6W A;  4LKA A;  5B77 A;  4J0S A;  3MQM A;  4NQN A;  4IC2 A;  3LJW A;  4YAB A;  2VPE A;  4LZS A;  3O37 A;  1WEV A;  3LXJ A;  5FE8 A;  2DVS A;  4WZ3 B;  4OUF A;  4MR5 A;  5DKD A; 
#chains in the Genus database with same CATH topology
 2LSP B;  4QB3 A;  2XOY A;  4WA6 A;  2Y1M A;  5B76 A;  3U5M A;  1FBV A;  4A0C D;  4CUT A;  3T9K A;  2LRI C;  4S3O C;  5I83 A;  4NUE A;  3I2D A;  3DAI A;  4HXN A;  4I7C A;  2ZET C;  5A5S A;  4P5O B;  4ALG A;  4XY8 A;  5KU3 A;  4UIU A;  5TBN A;  4R7E A;  4IR4 A;  4CFL A;  2DVR A;  5II2 A;  5KH7 A;  3PUQ A;  5L98 A;  4ALH A;  2YRE A;  2M85 A;  5EIC A;  2L5U A;  3SOW A;  5FB0 A;  3FEH A;  5EPB A;  1X4U A;  5ENH A;  3UV2 A;  4XUB A;  4V3K C;  3RPG C;  4W4U A;  2AN6 A;  3P5O A;  2KWK A;  4TT2 A;  3KDE C;  5I89 A;  4FJC A;  5E9M A;  3HCT A;  4PPE A;  4R2Y A;  4LZ2 A;  4AKI A;  1HYJ A;  4HXO A;  4HXK A;  2XP0 A;  2RS9 B;  5D3S A;  3LVQ E;  5HRV A;  4YBM A;  4WZ2 A;  5EWD A;  2F6J A;  5EV9 A;  4CUU A;  5AIT A;  4QSW A;  4UP5 A;  4CUP A;  3U5P A;  2K17 A;  3LRQ A;  5H1T A;  3M63 A;  1HYI A;  4XYA A;  3AQA A;  4YYI A;  4ZC9 A;  2VPD A;  4NYX A;  4XUA A;  5EU1 A;  4LRG A;  1T1H A;  5B79 A;  4YBT A;  4UIV A;  3DWY A;  5ENB A;  2CT2 A;  1WGM A;  2ECV A;  5K3Q A;  2KR4 A;  2PUY A;  4NR6 A;  4TZ8 A;  5TAB A;  4A9O A;  4QSQ A;  5DYC A;  2L75 A;  4L58 A;  4B86 C;  4I7B A;  3IU5 A;  5HJC A;  1BOR A;  5A5R A;  2LGV A;  2M6M A;  2UZG A;  5I80 A;  2C2L A;  3S91 A;  3LJU X;  4QSU A;  5FE6 A;  5LKU A;  3MUK A;  4QEU A;  5TDW A;  1MM3 A;  4LC2 A;  4PCI A;  2ECW A;  5J3X A;  5H1U A;  1JOC A;  2E6R A;  3LQH A;  2IDA A;  2M3H A;  1V87 A;  5L8U A;  4J0R A;  1DCQ A;  2EJN A;  1VD4 A;  4QY4 A;  5FG4 A;  2QIZ A;  5F3A A;  5G4R A;  5C11 A;  4HBX A;  3NXB A;  4UIY A;  5A5P A;  5AMF A;  5FE7 A;  5KTX A;  5L99 A;  2YSM A;  4GND A;  3M62 A;  4CFK A;  5A5Q A;  2WP1 A;  4WHU A;  4Z6I A;  3HCU A;  1X4J A;  4OGI A;  4Z6H A;  5A5O A;  2CKL B;  2L5E A;  3LQJ A;  4B7Y C;  3DWD A;  5C13 A;  5HFQ A;  1WEP A;  5LUU A;  5KH9 A;  3IU6 A;  3EB6 A;  4QZS A;  1IYM A;  2H0D B;  2EGP A;  3I3J A;  2YW5 A;  4C9Z A;  4O72 A;  4QSV A;  5EWC A;  1WEE A;  2YVR A;  4OGC A;  4J3I A;  5L97 A;  4YK0 A;  5FE9 A;  5BT4 A;  1Z2Q A;  5KTU A;  1WEU A;  4KV1 A;  3O33 A;  3LDY A;  2KWO A;  3ASL A;  3ZPV 1;  2G45 A;  4HXS A;  2BAY A;  5EWW A;  2ECN A;  4PCE A;  2E61 A;  3N9L A;  4MVT A;  4NN2 A;  3VK6 A;  3FJU B;  5FH6 A;  2LAU A;  3MB3 A;  5ENE A;  5DIN A;  5FEY A;  5LJ0 A;  4LLB A;  2ECI A;  5G4S A;  4QR5 A;  5D3T A;  5EA1 A;  2D9E A;  5KTW A;  3KNV A;  2MUM A;  5H9M A;  3IHP A;  4NQM A;  1WIM A;  3SVG A;  3O34 A;  3TLP A;  3C5K A;  5CQT A;  2I7K A;  1CHC A;  4A9L A;  2YYR A;  3HMF A;  5A82 A;  3DDT A;  4O7E A;  4GNF A;  4BBQ A;  4NR8 A;  5JWM A;  4YY4 A;  5D24 A;  2M13 A;  2L43 A;  4ZW1 A;  4CLB A;  4GNE A;  5HM0 A;  3VKH A;  5LCW B;  3JVL A;  2GRC A;  5AD2 A;  5FG6 A;  4X3G A;  5TRB A;  2ECT A;  2YSJ A;  4QUT A;  2XEU A;  4PS5 A;  5E73 A;  5G0F A;  2YUC A;  2H0D A;  4O7A A;  4UIZ A;  4QF3 A;  3L11 A;  4F1P A;  3MXF A;  3ERR A;  2FFW A;  2L7P A;  4CL9 A;  5LVR A;  5D7X A;  4QEV A;  4AKN A;  2CSZ A;  2KFT A;  5B8D A;  2KKX A;  5CQ6 A;  4UYH A;  4N4I A;  4AP4 A;  4MEN A;  2B0O E;  1VYX A;  5F25 A;  1K2F A;  5LKX A;  5D3L A;  3HMH A;  4LZR A;  5I86 A;  4TU6 A;  2KGG A;  4QUU A;  3DPL R;  5ENJ A;  1EQF A;  2WP2 A;  4GNG A;  5A81 A;  3ZYQ A;  4CUS A;  3RPG B;  5CQ8 A;  2YU4 A;  1E4U A;  5TB6 A;  2MIQ A;  4XY9 A;  2FUU A;  4MR3 A;  5CY9 A;  2EA6 A;  4Z0O A;  5C87 A;  2HDP A;  4AI6 A;  3MHS A;  4WIV A;  5F62 A;  4LAD B;  4MEQ A;  4NRC A;  4O75 A;  4O7F A;  4AUQ B;  5IGN A;  2DJA A;  3SHB A;  4AVX A;  5HRX A;  4NR4 A;  5CZG A;  5DY7 A;  4BW2 A;  4BW4 A;  2NXB A;  4NS5 A;  4IC3 A;  5E9K A;  4UI9 B;  5E9Y A;  5C8G A;  5CUG A;  4I7D A;  4S3O B;  4UYF B;  2LGG A;  1WUG A;  5E9I A;  1WEN A;  2YEL A;  3D1B A;  5F5Z A;  3UW9 A;  5C89 A;  1WEW A;  3JVK A;  4IR6 A;  4QC3 A;  4Q0O A;  5I7Y A;  1F62 A;  4UYE A;  2FSA A;  4MR4 A;  5EPR A;  5LKZ A;  3UVW A;  2LV9 A;  5KH3 A;  3G0L A;  4QSR A;  3SUB A;  4NUD A;  3JVM A;  2D8U A;  3KV5 A;  5FE5 A;  1WES A;  4GB0 A;  2KKY A;  2LN0 A;  5CQ3 A;  1N87 A;  2F6N A;  4QQ4 A;  2OWA A;  5DYX A;  4PKL A;  4YYH A;  5FFY A;  2YHO A;  5CQ5 A;  4MSX A;  5DW1 A;  3P1D A;  3U5N A;  5I88 A;  4A9J A;  3RTR B;  3O36 A;  4QR4 A;  4O71 A;  5D25 A;  5EK9 A;  4PY6 A;  4YYN A;  1WFK A;  2CSY A;  2L84 A;  4N4G A;  4Z1S A;  2P57 A;  1DVP A;  2MKE A;  4TT6 A;  4YY6 A;  2JMD A;  4F52 B;  4ZUX U;  2RNW A;  3Q2E A;  2R0S A;  2YQL A;  4A9K A;  4QEW A;  2FUI A;  1LDJ B;  5E0R A;  4N3W A;  4Q6F A;  5D3J A;  5A83 A;  5AME A;  5D3P A;  4X2I A;  5FH8 A;  4O62 A;  4UYF A;  5D1M B;  3ZVZ B;  2VPG A;  2DX8 A;  4KCX A;  4QYD A;  4YAT A;  3UVY A;  1PUO A;  5IID A;  2G43 A;  3HME A;  5F61 A;  2YEM A;  4QC1 A;  5LKT A;  3UV4 A;  1FP0 A;  5HEL A;  4IR3 A;  2L0B A;  4A4B A;  4TQN A;  4Z93 A;  4O7B A;  5HEM A;  2YW8 A;  4BW3 A;  4QYL A;  3UVD A;  3U5K A;  5HCL A;  2LQ6 A;  4QSS A;  3P1F A;  3V43 A;  1WEQ A;  1JSP B;  3MB4 A;  4LJN A;  4YYD A;  4NYV A;  5TCM A;  5CRM A;  4LDF A;  5FE2 A;  2MD7 B;  2D82 A;  5ENG A;  5E3G A;  5LVQ A;  5FBX A;  1JM4 B;  3FAN A;  4N4H A;  4BHW A;  3ZPV E;  4YH4 A;  4LYI A;  5D3H A;  5HEN A;  3T6R A;  2DAT A;  1U6G B;  2EOD A;  3ONI A;  5F2P A;  5CUD A;  3N9P A;  4RVR A;  4TS8 A;  3ZVY A;  4NUC A;  3Q2F A;  4BW1 A;  4FK5 A;  2KIZ A;  4UIW A;  5DKH A;  4O77 A;  2OXQ C;  3KV6 A;  4C66 A;  5I1Q A;  2IQJ A;  4A9F A;  4OGJ A;  4A9N A;  1Z60 A;  3T7L A;  3ZTG A;  4Z1Q A;  2QJ0 A;  4AKG A;  3NG2 A;  4IOQ A;  2LGL A;  4IOO A;  5FE4 A;  4BJX A;  4O70 A;  5I7X A;  5DFD A;  4FIP A;  4PTB A;  5C85 A;  4KV4 A;  4TTE A;  4HBV A;  5SVX A;  2KE1 A;  2KGI A;  2DWW A;  5CPE A;  2L85 A;  2YUR A;  5CRZ A;  2DKW A;  5DBM A;  5FFV A;  2JRJ A;  3JUE A;  5E74 A;  5CP5 A;  5TDR A;  5CU8 A;  5D26 A;  5G04 B;  5EWV A;  2VJF A;  5D3N A;  5EYA F;  2K16 A;  2ECG A;  5I29 A;  2EXU A;  4FLP A;  4A9I A;  5FE0 A;  5EI4 A;  2F42 A;  1ZS5 A;  2MA6 A;  2QIC A;  2JMI A;  4Y03 A;  2CRR A;  5CUB A;  5CQA A;  5ETD A;  5I3L A;  3SVH A;  4NR7 A;  5ACY A;  2LDR A;  2R10 A;  2YT5 A;  1JM7 A;  3SVF A;  4V3L C;  1WUM A;  2LXH C;  2RNY A;  4QBM A;  2MA5 A;  4E96 A;  5EQ1 A;  3GV4 A;  4MEO A;  4YYG A;  2N9G A;  2RSD A;  5CUA A;  5KHM A;  4YYJ A;  5C4Q A;  3FM8 C;  3P1C A;  5CS8 A;  3PUR A;  4A4C A;  5EPS A;  3D1D A;  5J0D A;  4QR3 A;  1ZKR A;  4QNS A;  5AD3 A;  4LYW A;  5DLX A;  4LK9 A;  4Z0R A;  2DVV A;  4YAX A;  4UIX A;  4J1P A;  4H9D A;  2MD8 C;  3M7K A;  5LJ2 A;  2Y1N A;  1MBM A;  5G05 B;  5FE1 A;  2MNY A;  5ENC A;  2D8S A;  5B78 A;  5H1V A;  2E6S A;  1MM2 A;  2R0V A;  3S92 A;  5ENF A;  2JM3 A;  3HTK C;  5CFW A;  5D1L B;  2VNF A;  2YHN A;  3ZNI A;  5JI8 A;  2NAA A;  3O7A A;  2KU3 A;  4NR5 A;  4AYC A;  4IOR A;  4AYC B;  4O74 A;  5B75 A;  4O7C A;  4HXP A;  5A7C A;  2VJF B;  1WEM A;  2JUN A;  4TU4 A;  2RI7 A;  5H85 A;  5I40 A;  1F68 A;  3EB5 A;  3U5O A;  4QST A;  5IGL A;  2MT5 A;  5L8T A;  2VPB A;  5CUC A;  4HBY A;  3P1E A;  5E3D A;  5DW2 A;  5EM3 A;  4UIT A;  5II1 A;  5BT3 A;  5E7D A;  2M1R A;  4DON A;  4TKP B;  2KRE A;  5HQ5 A;  4NXJ A;  5CQ4 A;  5EVA A;  2H60 A;  3VKG A;  5A5N A;  1JM7 B;  5F1H A;  2OO1 A;  3D7C A;  4YYK A;  4TZ2 A;  4CUQ A;  1Z6U A;  5FG5 A;  2CRW A;  2ECJ A;  4XI1 A;  3UVX A;  4A49 A;  4UYD A;  4ZQL A;  5F60 A;  5F1L A;  5ETB A;  5FH7 A;  2G4A A;  2OSS A;  4HXR A;  5FE3 A;  2KYU A;  3PHD A;  5EIS A;  5HRW A;  4QF2 A;  5FER A;  5DFB A;  3L1Z B;  5SVI B;  3DQV R;  2MJV B;  4YH3 A;  5EGU A;  5CGP A;  5F36 A;  4YYM A;  2C2V S;  3E2D A;  3MHH A;  2E3K A;  2G6Q A;  5FDZ A;  2Y43 A;  5A85 A;  4QSX A;  2YEK A;  4QSP A;  5EP7 A;  4TYL A;  4OGE A;  4ZDT A;  4CCG X;  4TT4 A;  4A9M A;  3N9N A;  3LQI A;  3L1X A;  3U5L A;  1E6I A;  5IBN A;  2KWN A;  4LR6 A;  2FD4 A;  2RO1 A;  1ZBD B;  4NRA A;  3ZYU A;  4MR6 A;  5HLS A;  4A9E A;  3O47 A;  3FL2 A;  4MEP A;  2JMJ A;  2RFJ A;  3QZT A;  2RR4 A;  2OUO A;  3G0J A;  1XWH A;  3KQI A;  5KO4 A;  4F3I A;  4Q0N A;  2MNZ A;  2KWJ A;  3QZV A;  4O76 A;  2LXP C;  1X4I A;  4LYS A;  5ENI A;  5LJ1 A;  5SVI A;  4GPJ A;  4N4F A;  4O78 A;  5JG6 A;  5C7N A;  2I50 A;  5D3R A;  5COI A;  1LDK C;  2CKL A;  5DX4 A;  4NRB A;  5DYA A;  3HCS A;  5D1K B;  3SOU A;  5D0C A;  3AAD A;  3H7H A;  3RCW A;  5DKC A;  5K29 A;  4YBS A;  5CTL A;  5IGM A;  2VJE A;  5HFR A;  3O35 A;  4WHW A;  5HQ7 A;  3N9Q A;  2PNX A;  2YQD A;  5IG6 A;  1X0J A;  4R8P K;  5F63 A;  4HBW A;  3N9O A;  4UP0 A;  2YYN A;  5DFC A;  4YAD A;  2RNX A;  4FO9 A;  2K4D A;  2DVQ A;  2K1J A;  2HYE D;  3O70 A;  2YDW A;  4NYW A;  3K2J A;  3GL6 A;  4HXM A;  2XOC A;  3FKM X;  2EGM A;  4O64 A;  5E9V A;  4A9H A;  3JVJ A;  5DLZ A;  5IGK A;  2L80 A;  1G25 A;  5DKA A;  3Q1D A;  1N72 A;  5BT5 A;  3FAO A;  3LVR E;  3MUL A;  5CUE A;  5CQ7 A;  5AIU A;  4UYG A;  2I8N A;  4WZ0 A;  4L7X A;  2R0Y A;  2YQM A;  3SOX A;  4AKH A;  4YC9 A;  1VFY A;  5DYU A;  2CSV A;  2CON A;  2KTB B;  5L96 A;  4CUR A;  1WEO A;  4HXL A;  5FFW A;  3M99 A;  5HQ6 A;  1WIL A;  3GG3 A;  3N9M A;  5SVY A;  5FB1 A;  3UV5 A;  3U5J A;  3QZS A;  2E7N A;  1WE9 A;  3MDB C;  4NR9 A;  2LGK A;  5EWH A;  2E7O A;  2XB1 A;  4CA1 A;  1RMD A;  4C67 A;  2VP7 A;  4IR5 A;  5E9L A;  2VJE B;  3C6W A;  4LKA A;  5B77 A;  4J0S A;  3MQM A;  4NQN A;  4IC2 A;  3PLW A;  3LJW A;  4YAB A;  2VPE A;  2DSM A;  4LZS A;  3O37 A;  1WEV A;  3LXJ A;  5FE8 A;  2XOZ A;  2DVS A;  4WZ3 B;  4OUF A;  4MR5 A;  5DKD A; 
#chains in the Genus database with same CATH homology
 2LSP B;  4QB3 A;  4WA6 A;  5B76 A;  2Y1M A;  3U5M A;  1FBV A;  4A0C D;  4CUT A;  2LRI C;  4S3O C;  5I83 A;  4NUE A;  3I2D A;  3DAI A;  4HXN A;  4I7C A;  2ZET C;  5A5S A;  4P5O B;  4ALG A;  4XY8 A;  5KU3 A;  4UIU A;  5TBN A;  4R7E A;  4IR4 A;  4CFL A;  2DVR A;  5II2 A;  5KH7 A;  3PUQ A;  5L98 A;  4ALH A;  2YRE A;  2M85 A;  5EIC A;  2L5U A;  3SOW A;  5FB0 A;  5EPB A;  1X4U A;  5ENH A;  3UV2 A;  4XUB A;  4V3K C;  3RPG C;  4W4U A;  2AN6 A;  3P5O A;  2KWK A;  4TT2 A;  5I89 A;  4FJC A;  5E9M A;  3HCT A;  4PPE A;  4R2Y A;  4LZ2 A;  1HYJ A;  4HXO A;  4HXK A;  2RS9 B;  5D3S A;  5HRV A;  4YBM A;  4WZ2 A;  5EWD A;  2F6J A;  5EV9 A;  4CUU A;  5AIT A;  4QSW A;  4UP5 A;  4CUP A;  3U5P A;  2K17 A;  3LRQ A;  5H1T A;  3M63 A;  1HYI A;  4XYA A;  3AQA A;  4YYI A;  4ZC9 A;  2VPD A;  4NYX A;  4XUA A;  5EU1 A;  4LRG A;  1T1H A;  5B79 A;  4YBT A;  4UIV A;  3DWY A;  5ENB A;  2CT2 A;  1WGM A;  2ECV A;  2KR4 A;  2PUY A;  4NR6 A;  4TZ8 A;  5TAB A;  4A9O A;  4QSQ A;  5DYC A;  2L75 A;  4L58 A;  4B86 C;  4I7B A;  3IU5 A;  5HJC A;  1BOR A;  5A5R A;  2LGV A;  2M6M A;  2UZG A;  5I80 A;  2C2L A;  3S91 A;  4QSU A;  5FE6 A;  5LKU A;  3MUK A;  4QEU A;  5TDW A;  1MM3 A;  4LC2 A;  4PCI A;  2ECW A;  5J3X A;  5H1U A;  1JOC A;  2E6R A;  3LQH A;  2IDA A;  2M3H A;  1V87 A;  5L8U A;  4J0R A;  1VD4 A;  4QY4 A;  5FG4 A;  2QIZ A;  5F3A A;  5G4R A;  5C11 A;  4HBX A;  3NXB A;  4UIY A;  5A5P A;  5AMF A;  5FE7 A;  5KTX A;  5L99 A;  2YSM A;  4GND A;  3M62 A;  4CFK A;  5A5Q A;  2WP1 A;  4WHU A;  4Z6I A;  3HCU A;  1X4J A;  4OGI A;  4Z6H A;  5A5O A;  2CKL B;  2L5E A;  3LQJ A;  4B7Y C;  5C13 A;  5HFQ A;  1WEP A;  5LUU A;  5KH9 A;  3IU6 A;  3EB6 A;  4QZS A;  1IYM A;  2H0D B;  2EGP A;  3I3J A;  2YW5 A;  4C9Z A;  4O72 A;  4QSV A;  5EWC A;  1WEE A;  4J3I A;  5L97 A;  4YK0 A;  5FE9 A;  5BT4 A;  1Z2Q A;  5KTU A;  1WEU A;  4KV1 A;  3O33 A;  2KWO A;  3ASL A;  3ZPV 1;  2G45 A;  4HXS A;  2BAY A;  5EWW A;  2ECN A;  4PCE A;  3N9L A;  4MVT A;  4NN2 A;  3VK6 A;  5FH6 A;  3MB3 A;  5ENE A;  5DIN A;  5FEY A;  5LJ0 A;  4LLB A;  2ECI A;  5G4S A;  4QR5 A;  5D3T A;  5EA1 A;  2D9E A;  5KTW A;  3KNV A;  2MUM A;  5H9M A;  3IHP A;  4NQM A;  1WIM A;  3SVG A;  3O34 A;  3TLP A;  3C5K A;  5CQT A;  2I7K A;  1CHC A;  4A9L A;  2YYR A;  3HMF A;  5A82 A;  4O7E A;  4GNF A;  4BBQ A;  4NR8 A;  5JWM A;  4YY4 A;  5D24 A;  2L43 A;  4ZW1 A;  4CLB A;  4GNE A;  5HM0 A;  5LCW B;  3JVL A;  2GRC A;  5AD2 A;  5FG6 A;  4X3G A;  5TRB A;  2ECT A;  2YSJ A;  4QUT A;  2XEU A;  4PS5 A;  5E73 A;  5G0F A;  2YUC A;  2H0D A;  4O7A A;  4UIZ A;  4QF3 A;  3L11 A;  3MXF A;  4CL9 A;  5LVR A;  5D7X A;  4QEV A;  4AKN A;  2CSZ A;  2KFT A;  5B8D A;  5CQ6 A;  4UYH A;  4N4I A;  4AP4 A;  4MEN A;  1VYX A;  5F25 A;  1K2F A;  5LKX A;  5D3L A;  3HMH A;  4LZR A;  5I86 A;  4TU6 A;  2KGG A;  4QUU A;  3DPL R;  5ENJ A;  1EQF A;  2WP2 A;  4GNG A;  5A81 A;  3ZYQ A;  4CUS A;  3RPG B;  5CQ8 A;  2YU4 A;  1E4U A;  5TB6 A;  2MIQ A;  4XY9 A;  2FUU A;  4MR3 A;  5CY9 A;  2EA6 A;  5C87 A;  2HDP A;  3MHS A;  4WIV A;  5F62 A;  4LAD B;  4MEQ A;  4NRC A;  4O75 A;  4O7F A;  4AUQ B;  5IGN A;  3SHB A;  4AVX A;  5HRX A;  4NR4 A;  5CZG A;  5DY7 A;  4BW2 A;  4BW4 A;  2NXB A;  4NS5 A;  4IC3 A;  5E9K A;  4UI9 B;  5E9Y A;  5C8G A;  5CUG A;  4I7D A;  4S3O B;  4UYF B;  2LGG A;  1WUG A;  5E9I A;  1WEN A;  2YEL A;  5F5Z A;  3UW9 A;  5C89 A;  1WEW A;  3JVK A;  4IR6 A;  4QC3 A;  4Q0O A;  5I7Y A;  1F62 A;  4UYE A;  2FSA A;  4MR4 A;  5EPR A;  5LKZ A;  3UVW A;  2LV9 A;  5KH3 A;  3G0L A;  4QSR A;  4NUD A;  3JVM A;  3KV5 A;  5FE5 A;  1WES A;  4GB0 A;  2LN0 A;  5CQ3 A;  1N87 A;  2F6N A;  5DYX A;  4PKL A;  4YYH A;  5FFY A;  2YHO A;  5CQ5 A;  4MSX A;  5DW1 A;  3P1D A;  3U5N A;  5I88 A;  4A9J A;  3RTR B;  3O36 A;  4QR4 A;  4O71 A;  5D25 A;  5EK9 A;  4PY6 A;  4YYN A;  1WFK A;  2CSY A;  2L84 A;  4N4G A;  4Z1S A;  1DVP A;  4TT6 A;  4YY6 A;  2JMD A;  4F52 B;  4ZUX U;  2RNW A;  3Q2E A;  2R0S A;  2YQL A;  4A9K A;  4QEW A;  2FUI A;  1LDJ B;  5E0R A;  4N3W A;  4Q6F A;  5D3J A;  5A83 A;  5AME A;  5D3P A;  4X2I A;  5FH8 A;  4UYF A;  5D1M B;  3ZVZ B;  2VPG A;  2DX8 A;  4KCX A;  4QYD A;  4YAT A;  3UVY A;  5IID A;  2G43 A;  3HME A;  5F61 A;  2YEM A;  4QC1 A;  5LKT A;  3UV4 A;  1FP0 A;  5HEL A;  4IR3 A;  2L0B A;  4A4B A;  4TQN A;  4Z93 A;  4O7B A;  5HEM A;  2YW8 A;  4BW3 A;  4QYL A;  3UVD A;  3U5K A;  5HCL A;  2LQ6 A;  4QSS A;  3P1F A;  3V43 A;  1WEQ A;  1JSP B;  3MB4 A;  4LJN A;  4YYD A;  4NYV A;  5TCM A;  5CRM A;  4LDF A;  5FE2 A;  2MD7 B;  2D82 A;  5ENG A;  5E3G A;  5LVQ A;  5FBX A;  1JM4 B;  4N4H A;  4BHW A;  3ZPV E;  4YH4 A;  4LYI A;  5D3H A;  5HEN A;  3T6R A;  2DAT A;  1U6G B;  2EOD A;  3ONI A;  5F2P A;  5CUD A;  3N9P A;  4RVR A;  4TS8 A;  3ZVY A;  4NUC A;  3Q2F A;  4BW1 A;  4FK5 A;  2KIZ A;  4UIW A;  5DKH A;  4O77 A;  2OXQ C;  3KV6 A;  4C66 A;  5I1Q A;  4A9F A;  4OGJ A;  4A9N A;  1Z60 A;  3T7L A;  3ZTG A;  4Z1Q A;  2QJ0 A;  3NG2 A;  4IOQ A;  2LGL A;  4IOO A;  5FE4 A;  4BJX A;  4O70 A;  5I7X A;  5DFD A;  4FIP A;  4PTB A;  5C85 A;  4KV4 A;  4TTE A;  4HBV A;  2KE1 A;  2KGI A;  2DWW A;  5CPE A;  2L85 A;  2YUR A;  5CRZ A;  2DKW A;  5DBM A;  5FFV A;  2JRJ A;  5E74 A;  5CP5 A;  5TDR A;  5CU8 A;  5D26 A;  5G04 B;  5EWV A;  2VJF A;  5D3N A;  5EYA F;  2K16 A;  2ECG A;  5I29 A;  4FLP A;  4A9I A;  5FE0 A;  5EI4 A;  2F42 A;  1ZS5 A;  2MA6 A;  2QIC A;  2JMI A;  4Y03 A;  5CUB A;  5CQA A;  5ETD A;  5I3L A;  3SVH A;  4NR7 A;  5ACY A;  2LDR A;  2R10 A;  2YT5 A;  1JM7 A;  3SVF A;  4V3L C;  1WUM A;  2LXH C;  2RNY A;  4QBM A;  2MA5 A;  4E96 A;  5EQ1 A;  3GV4 A;  4MEO A;  4YYG A;  2N9G A;  2RSD A;  5CUA A;  5KHM A;  4YYJ A;  5C4Q A;  3PUR A;  3P1C A;  5CS8 A;  4A4C A;  5EPS A;  5J0D A;  4QR3 A;  4QNS A;  5AD3 A;  4LYW A;  5DLX A;  4LK9 A;  2DVV A;  4YAX A;  4UIX A;  4J1P A;  2MD8 C;  5LJ2 A;  2Y1N A;  5G05 B;  5FE1 A;  2MNY A;  5ENC A;  2D8S A;  5B78 A;  5H1V A;  2E6S A;  1MM2 A;  2R0V A;  3S92 A;  5ENF A;  3HTK C;  5CFW A;  5D1L B;  2VNF A;  2YHN A;  3ZNI A;  5JI8 A;  2NAA A;  3O7A A;  2KU3 A;  4NR5 A;  4AYC A;  4IOR A;  4AYC B;  4O74 A;  5B75 A;  4O7C A;  4HXP A;  5A7C A;  2VJF B;  1WEM A;  4TU4 A;  2RI7 A;  5H85 A;  5I40 A;  1F68 A;  3EB5 A;  3U5O A;  4QST A;  5IGL A;  2MT5 A;  5L8T A;  2VPB A;  5CUC A;  4HBY A;  3P1E A;  5E3D A;  5DW2 A;  5EM3 A;  4UIT A;  5II1 A;  5BT3 A;  5E7D A;  2M1R A;  4DON A;  4TKP B;  2KRE A;  5HQ5 A;  4NXJ A;  5CQ4 A;  5EVA A;  2H60 A;  5A5N A;  1JM7 B;  5F1H A;  2OO1 A;  3D7C A;  4YYK A;  4TZ2 A;  4CUQ A;  1Z6U A;  5FG5 A;  4XI1 A;  2ECJ A;  3UVX A;  4A49 A;  4UYD A;  4ZQL A;  5F60 A;  5F1L A;  5ETB A;  5FH7 A;  2G4A A;  2OSS A;  4HXR A;  5FE3 A;  2KYU A;  3PHD A;  5EIS A;  5HRW A;  4QF2 A;  5FER A;  5DFB A;  3L1Z B;  3DQV R;  2MJV B;  4YH3 A;  5EGU A;  5CGP A;  5F36 A;  4YYM A;  2C2V S;  3MHH A;  2E3K A;  2G6Q A;  5FDZ A;  2Y43 A;  5A85 A;  4QSX A;  2YEK A;  4QSP A;  5EP7 A;  4TYL A;  4ZDT A;  4CCG X;  4TT4 A;  4A9M A;  3N9N A;  3LQI A;  3L1X A;  3U5L A;  1E6I A;  5IBN A;  2KWN A;  4LR6 A;  2RO1 A;  1ZBD B;  4NRA A;  3ZYU A;  4MR6 A;  5HLS A;  4A9E A;  3FL2 A;  4MEP A;  2JMJ A;  2RFJ A;  3QZT A;  2OUO A;  3G0J A;  1XWH A;  3KQI A;  5KO4 A;  4F3I A;  4Q0N A;  2MNZ A;  2KWJ A;  3QZV A;  4O76 A;  2LXP C;  1X4I A;  4LYS A;  5ENI A;  5LJ1 A;  4GPJ A;  4N4F A;  4O78 A;  5JG6 A;  5C7N A;  2I50 A;  5D3R A;  5COI A;  1LDK C;  2CKL A;  5DX4 A;  4NRB A;  5DYA A;  3HCS A;  5D1K B;  3SOU A;  5D0C A;  3AAD A;  3RCW A;  5DKC A;  5K29 A;  4YBS A;  5CTL A;  5IGM A;  2VJE A;  5HFR A;  3O35 A;  4WHW A;  5HQ7 A;  3N9Q A;  2PNX A;  2YQD A;  5IG6 A;  1X0J A;  4R8P K;  5F63 A;  4HBW A;  3N9O A;  4UP0 A;  2YYN A;  5DFC A;  4YAD A;  2RNX A;  4FO9 A;  2K4D A;  2DVQ A;  2K1J A;  2HYE D;  3O70 A;  2YDW A;  4NYW A;  3K2J A;  3GL6 A;  4HXM A;  3FKM X;  4O64 A;  5E9V A;  4A9H A;  3JVJ A;  5DLZ A;  5IGK A;  2L80 A;  1G25 A;  5DKA A;  1N72 A;  5BT5 A;  3MUL A;  5CUE A;  5CQ7 A;  5AIU A;  4UYG A;  2I8N A;  4WZ0 A;  4L7X A;  2R0Y A;  2YQM A;  3SOX A;  4YC9 A;  1VFY A;  5DYU A;  2KTB B;  5L96 A;  4CUR A;  1WEO A;  4HXL A;  5FFW A;  3M99 A;  5HQ6 A;  1WIL A;  3GG3 A;  3N9M A;  5FB1 A;  3UV5 A;  3U5J A;  3QZS A;  2E7N A;  1WE9 A;  4NR9 A;  2LGK A;  5EWH A;  2E7O A;  2XB1 A;  4CA1 A;  1RMD A;  4C67 A;  2VP7 A;  4IR5 A;  5E9L A;  2VJE B;  3C6W A;  4LKA A;  5B77 A;  4J0S A;  3MQM A;  4NQN A;  4IC2 A;  3LJW A;  4YAB A;  2VPE A;  4LZS A;  3O37 A;  1WEV A;  3LXJ A;  5FE8 A;  2DVS A;  4WZ3 B;  4OUF A;  4MR5 A;  5DKD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...