2F6JA

Crystal structure of phd finger-linker-bromodomain fragment of human bptf in the h3(1-15)k4me3 bound state
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
168
structure length
168
Chain Sequence
DTKLYCICKTPYDESKFYIGCDRCQNWYHGRCVGILQSEAELIDEYVCPQCQSTEDAMTVLTPLTEKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLATMEERVQRRYYEKLTEFVADMTKIFDNCRYYNPSDSPFYQCAEVLESFFVQKLKGFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords bromodomain PHD finger transcription factor
publication title Molecular basis for site-specific read-out of histone H3K4me3 by the BPTF PHD finger of NURF.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 49
structure length 168
sequence length 168
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2f6jA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2f6jA01
3L11A 5E9MA 5E9KA 5G0FA 4QSXA 4QSSA 2UZGA 5D1MB 5ETBA 4NN2A 4UIVA 4IC3A 5LVQA 2MA6A 4ZW1A 3P1CA 4LYIA 4B7YC 4RVRA 5CQ7A 1WIMA 4A9JA 2ECNA 3MUKA 4QBMA 3N9QA 3ZVZB 4TU4A 4O70A 4CUSA 5CUAA 4LK9A 5DYUA 3SOUA 5ENHA 5DX4A 4NR4A 2VNFA 4UYFA 3N9OA 4ALGA 1EQFA 2I7KA 4NYXA 5CFWA 4CUUA 4QR5A 5FE2A 4LADB 4P5OB 3SOWA 2M6MA 4A9OA 5C4QA 2DWWA 5COIA 2EODA 5HRXA 4B86C 5ENIA 2NXBA 5BT3A 2OUOA 2BAYA 5FDZA 2RNWA 2N9GA 3MXFA 5F3AA 2MIQA 5A5PA 5C87A 5G4RA 3UVDA 2VJFA 4UIZA 5L96A 5H1UA 5KTWA 4UYFB 4GB0A 5D1KB 5FE9A 5C85A 4YY6A 4CLBA 1LDJB 3P1EA 4QEWA 5F36A 3M62A 5EGUA 4YYGA 5HLSA 4NR8A 4IORA 2AN6A 5L8UA 4HXLA 4LZRA 2YDWA 5C89A 1VD4A 1XWHA 2KWNA 2YHOA 4J0SA 3TLPA 4AYCA 4BBQA 5AD2A 5ENCA 4NYVA 2L5UA 2G4AA 4NXJA 5E74A 5I40A 1JSPB 4UI9B 3JVMA 4QB3A 1VFYA 2ZETC 2MA5A 4O7CA 4CFKA 1ZS5A 3ZPV1 2JRJA 2I50A 2KU3A 2DKWA 3ASLA 3N9LA 3O34A 5CQ8A 5D3RA 4YY4A 2C2VS 2M85A 2MNZA 2LGLA 4C66A 4AYCB 5C13A 4GNFA 4A4BA 2Y1NA 4LZSA 5I1QA 3ZPVE 2I8NA 5CQ5A 3JVKA 5CUGA 4YH4A 5FH8A 4YYHA 4W4UA 5CP5A 5HFRA 3SVHA 1FBVA 3ZYUA 3KNVA 5DINA 4TU6A 2E3KA 5EICA 5KO4A 3U5JA 4AUQB 2L5EA 2LSPB 3D7CA 4NR6A 5L98A 5IGKA 2FUUA 3QZTA 5I88A 4QEVA 3QZSA 5JG6A 3MHHA 5H9MA 1ZBDB 4WZ2A 5FB1A 5HQ6A 4MEQA 4OGJA 5E0RA 4YYIA 2XEUA 5CTLA 4NUEA 5D3LA 5TRBA 2EA6A 3SVGA 4ZQLA 5E3DA 5F1HA 5B79A 5EPSA 3LRQA 1WENA 2D9EA 5EPBA 2JMJA 2LN0A 5DFCA 2K16A 2CSZA 4MSXA 4WA6A 4WZ0A 4QF2A 1JM4B 4GNGA 4UITA 4QSTA 1LDKC 3GV4A 4BJXA 5I7YA 5E3GA 5FEYA 5KH7A 5J0DA 3MHSA 4YAXA 2CKLA 4X2IA 4CUTA 5HENA 3LXJA 4HXNA 4HBYA 4O78A 2LGKA 4GPJA 4N4HA 1WILA 2H0DA 5ACYA 3U5LA 5DFDA 3V43A 4R2YA 2KR4A 3UV4A 5E9VA 1WGMA 4O76A 5KHMA 2LV9A 3KV5A 2CKLB 2G45A 4NQNA 5I7XA 3DWYA 5I29A 2RNXA 4E96A 4O77A 4UIUA 4UYEA 2H0DB 2YYRA 4OGIA 4YBMA 4YABA 4AVXA 4UP0A 5ENJA 4LDFA 5DKHA 3HMEA 5A5QA 3O37A 5C8GA 2R10A 5A83A 4R7EA 5HELA 3Q2FA 3IHPA 1WUMA 4UIXA 5B75A 5DYXA 2YREA 2R0YA 4PS5A 4GNEA 3T7LA 4NR7A 4TT2A 5IG6A 4A9HA 2YW5A 3U5PA 4ZUXU 4IR4A 4BW1A 4QSPA 1DVPA 5EWDA 4TYLA 5EISA 1Z2QA 2MNYA 1FP0A 3C6WA 5ETDA 2FUIA 3EB6A 2G43A 3K2JA 5FFYA 1WEWA 2KGGA 5IGNA 3EB5A 1JOCA 4O75A 3PHDA 5EQ1A 5EV9A 2MJVB 4XYAA 3S92A 3UV2A 3HCTA 5II2A 5F5ZA 4ALHA 4R8PK 2DVSA 3T6RA 3MB4A 3RCWA 4QNSA 2M1RA 1IYMA 4MVTA 4QSUA 3P1DA 3KQIA 5A7CA 4N4IA 5LCWB 4Q0OA 1F68A 2K1JA 4S3OC 4NYWA 4XY9A 5AMFA 4TS8A 2ECIA 1WEPA 5I3LA 3HMHA 4IR3A 2ECTA 4LKAA 4MEOA 2M3HA 4N3WA 4Z1QA 2E6SA 3AQAA 4IR6A 4A9MA 4YADA 4N4FA 5J3XA 5D3HA 2VJFB 4HXKA 4TTEA 4XUAA 2KGIA 4NRCA 5DW2A 5I80A 3PURA 4ZC9A 5A85A 5CRMA 3SOXA 5F61A 2F42A 5LKUA 5I89A 5L97A 3O70A 5CQTA 3P1FA 4PY6A 5CY9A 2VPGA 4CCGX 5FH6A 2KIZA 2LGGA 5D24A 5CQ3A 1WEOA 4UYGA 5ENFA 5EI4A 4MR5A 2YURA 4IC2A 2YEKA 5DLXA 4QC3A 3KV6A 5A81A 5TCMA 3UV5A 2DVVA 3AADA 5LKTA 2HDPA 2KFTA 4IOQA 4O71A 5D3PA 4BW4A 2MD8C 4O7EA 5LJ2A 2DX8A 2VP7A 5B76A 4LR6A 5LUUA 5DBMA 4UIYA 4YYNA 4YC9A 5FBXA 4HXPA 5F1LA 5FFVA 2JMDA 4TQNA 5E9IA 2KYUA 5CZGA 3N9PA 1WEQA 3Q2EA 4A0CD 4PCEA 5KU3A 3RPGC 2WP1A 4NUCA 5LKZA 4L58A 2DVQA 3UW9A 3UVYA 1BORA 5DKAA 2L84A 5AIUA 5D3JA 4NUDA 3O7AA 4QR3A 3G0LA 2VJEA 4LC2A 4LYWA 2FSAA 5DKCA 5EWVA 5IIDA 2G6QA 4FK5A 3HCUA 5B8DA 4O7AA 4PTBA 3PUQA 3UVWA 5DW1A 4QR4A 5KTXA 5DYAA 2L0BA 5B78A 3QZVA 4YYMA 4A9LA 4FJCA 4A4CA 4LRGA 5HQ7A 5KTUA 1E6IA 5HRWA 4QY4A 5TABA 2Y1MA 2KTBB 4UP5A 3DQVR 5A5NA 5EM3A 2D8SA 1K2FA 2DVRA 2OO1A 2R0SA 5EWWA 2DATA 5F60A 4Z93A 5AMEA 5D0CA 3M63A 4MR4A 5FE7A 4QSQA 2HYED 4O7FA 4YYDA 5BT4A 3L1ZB 1MM2A 3IU6A 3ZTGA 5CUBA 4MR3A 5D26A 4LLBA 1E4UA 2OSSA 4WIVA 4A9FA 2KWJA 4Q6FA 5IBNA 4UYDA 2NAAA 2YW8A 2E7OA 5D3SA 5FH7A 3U5MA 2E6RA 5E9YA 5D25A 4QEUA 4Z6IA 4TT6A 5E7DA 5F25A 5H85A 2RS9B 2WP2A 4A9EA 3M99A 2YSMA 3I2DA 3O36A 4QYDA 4UYHA 4J3IA 5CQAA 2OXQC 3O33A 3FL2A 1Z6UA 4PCIA 2D82A 5FG6A 4Z1SA 5G05B 5LJ1A 2VPBA 5D3TA 5DFBA 2MD7B 2R0VA 4WHUA 2YQMA 5H1VA 4TKPB 4O7BA 4S3OB 4TZ2A 5D1LB 4MENA 1X4JA 4C67A 1CHCA 5ENEA 2K17A 1VYXA 3HCSA 2LXHC 2YUCA 2EGPA 4BHWA 5TBNA 3LQJA 1WE9A 5G4SA 2ECGA 2YU4A 2L75A 4LYSA 4A49A 4Y03A 2RI7A 5C11A 4XI1A 3U5NA 4YBSA 5HFQA 5HCLA 2QICA 2PUYA 2K4DA 2F6NA 5KH3A 5DKDA 3ZYQA 4I7BA 5A82A 2KWOA 2XB1A 3GL6A 4MR6A 1RMDA 5DYCA 4AP4A 4A9KA 4A9NA 4OUFA 2VPDA 4HXOA 5F62A 4Q0NA 4O74A 4A9IA 5H1TA 5FERA 3LJWA 1V87A 1HYIA 3I3JA 1WUGA 5A5SA 4KCXA 5HM0A 2C2LA 2MT5A 3ZNIA 4XUBA 5A5RA 4I7CA 3JVLA 5F63A 1WFKA 2ECWA 4N4GA 4LJNA 1X4IA 5CQ6A 4CFLA 3O35A 3GG3A 5FFWA 5HJCA 4QUUA 5I83A 4IR5A 4CURA 5CRZA 5CUDA 2ECJA 5CU8A 3RPGB 2CSYA 4BW2A 2QJ0A 2YYNA 3U5KA 5FG5A 5FE1A 4NR5A 5D3NA 4YYJA 4NRAA 4BW3A 4ZDTA 1X0JA 5FG4A 5ENBA 2ECVA 3P5OA 3HTKC 2RSDA 2L43A 5CUCA 5FE8A 4LZ2A 4KV1A 4QF3A 3JVJA 4TZ8A 4FLPA 1MM3A 5HQ5A 2LDRA 1JM7A 4HXMA 5LVRA 5EP7A 2VPEA 4AKNA 5E73A 5IGLA 3ZVYA 5TDWA 4YK0A 5K29A 4F3IA 3S91A 2Y43A 4QC1A 3U5OA 3N9MA 2RNYA 5FE0A 2GRCA 4J0RA 5CQ4A 5JWMA 4HXSA 4CUPA 5LJ0A 5KH9A 5FE5A 2MUMA 2L85A 5AD3A 1JM7B 1WEVA 3NG2A 2CT2A 2YELA 3MULA 3LQIA 4J1PA 3UVXA 5B77A 4FIPA 5L8TA 4YBTA 3HMFA 4TT4A 1Z60A 5EPRA 5EWHA 2LXPC 2QIZA 1T1HA 3MQMA 3SHBA 2VJEB 3C5KA 5CUEA 5JI8A 4QSWA 1F62A 5TB6A 4KV4A 2LQ6A 2KWKA 2YHNA 2KE1A 4QSVA 3SVFA 3L1XA 3VK6A 4C9ZA 2LGVA 4IOOA 4CL9A 3LQHA 5BT5A 2PNXA 2YSJA 4CUQA 1G25A 4HXRA 5ENGA 1WEUA 5I86A 2YQDA 4YATA 3NXBA 4O64A 3RTRB 1X4UA 5FB0A 5FE6A 1N87A 5C7NA 2H60A 4L7XA 5TDRA 1U6GB 4HBVA 5EU1A 2KREA 3N9NA 5D7XA 4PKLA 3DAIA 5AITA 5FE4A 4QZSA 5EA1A 4X3GA 5A5OA 5EWCA 2YT5A 4UIWA 4NS5A 1N72A 5CGPA 5DY7A 3MB3A 5E9LA 1WEEA 5HRVA 5G04B 4MEPA 2JMIA 4QUTA 4WHWA 2LRIC 2YEMA 4DONA 4NRBA 5DLZA 4YYKA 3G0JA 5EK9A 5HEMA 4NR9A 5IGMA 2RFJA 1WEMA 4HBWA 3DPLR 5CS8A 3FKMX 4O72A 5F2PA 3IU5A 5CPEA 4FO9A 4WZ3B 4YH3A 2YQLA 4NQMA 2RO1A 5II1A 1WESA 5FE3A 4XY8A 5EYAF 4F52B 2L80A 4GNDA 4QSRA 5EVAA 4V3LC 1HYJA 5LKXA 4PPEA 4Z6HA 2IDAA 2F6JA 4CA1A 5L99A 2E7NA 4V3KC 4HBXA 4I7DA 4QYLA 3ONIA
chains in the Genus database with same CATH superfamily
3L11A 5E9MA 5E9KA 5G0FA 4QSXA 4QSSA 2UZGA 5D1MB 5ETBA 4NN2A 4UIVA 4IC3A 5LVQA 2MA6A 4ZW1A 3P1CA 4LYIA 4B7YC 4RVRA 5CQ7A 1WIMA 4A9JA 2ECNA 3MUKA 4QBMA 3N9QA 3ZVZB 4TU4A 4O70A 4CUSA 5CUAA 4LK9A 5DYUA 3SOUA 5ENHA 5DX4A 4NR4A 2VNFA 4UYFA 3N9OA 4ALGA 1EQFA 2I7KA 4NYXA 5CFWA 4CUUA 4QR5A 5FE2A 3MDBC 4LADB 4QQ4A 3SOWA 2M6MA 4A9OA 5C4QA 2DWWA 5COIA 2EODA 5HRXA 4B86C 5ENIA 2NXBA 5BT3A 2OUOA 2BAYA 5FDZA 2RNWA 2N9GA 3MXFA 5F3AA 2MIQA 5A5PA 5C87A 5G4RA 3UVDA 2RR4A 2VJFA 4UIZA 5L96A 5H1UA 5KTWA 4UYFB 4GB0A 5D1KB 5FE9A 5C85A 4YY6A 4CLBA 1LDJB 3P1EA 4QEWA 5F36A 3M62A 5EGUA 4YYGA 5HLSA 4NR8A 4IORA 2AN6A 5L8UA 4HXLA 4LZRA 2YDWA 5C89A 1VD4A 1XWHA 2KWNA 2YHOA 4J0SA 3TLPA 4AYCA 4BBQA 5AD2A 5ENCA 4NYVA 2L5UA 2G4AA 4NXJA 5E74A 5I40A 1JSPB 4UI9B 3JVMA 4QB3A 1VFYA 2ZETC 2MA5A 4O7CA 4CFKA 1ZS5A 3ZPV1 2JRJA 2I50A 2KU3A 2DKWA 3ASLA 5SVIB 3N9LA 3O34A 5CQ8A 5D3RA 4YY4A 2C2VS 2M85A 2MNZA 2LGLA 4C66A 4AYCB 5C13A 4GNFA 4A4BA 2Y1NA 4LZSA 5I1QA 3ZPVE 2I8NA 5CQ5A 3JVKA 5CUGA 4YH4A 5FH8A 4YYHA 4W4UA 5CP5A 5HFRA 3SVHA 1FBVA 3ZYUA 3KNVA 5DINA 4TU6A 2E3KA 5K3QA 5EICA 5KO4A 3U5JA 4OGCA 4AUQB 2L5EA 4AKGA 3D7CA 2LSPB 4NR6A 5L98A 5IGKA 2FUUA 3QZTA 5I88A 4QEVA 3QZSA 5JG6A 3MHHA 3VKGA 5H9MA 1ZBDB 4WZ2A 2DJAA 5FB1A 5HQ6A 4MEQA 4OGJA 5E0RA 4YYIA 2XEUA 5CTLA 4NUEA 5D3LA 5TRBA 2EA6A 3SVGA 4ZQLA 5E3DA 5F1HA 5B79A 5EPSA 3M7KA 3FAOA 3LRQA 1WENA 2D9EA 5EPBA 2JMJA 2LN0A 5DFCA 2K16A 2CSZA 4MSXA 4WA6A 4WZ0A 4QF2A 1JM4B 4GNGA 4UITA 4QSTA 1LDKC 3GV4A 4BJXA 5I7YA 1MBMA 5E3GA 5FEYA 5KH7A 5J0DA 3MHSA 4YAXA 2CKLA 4X2IA 4CUTA 5HENA 3LXJA 4HXNA 4HBYA 4O78A 2LGKA 4GPJA 4N4HA 1WILA 2H0DA 5ACYA 3U5LA 5DFDA 4AI6A 3V43A 4R2YA 2KR4A 3UV4A 5E9VA 1WGMA 4O76A 5KHMA 2LV9A 3KV5A 2CKLB 2G45A 4NQNA 3SUBA 5I7XA 2CRWA 3DWDA 3DWYA 5I29A 4H9DA 2RNXA 4E96A 4O77A 4UIUA 4UYEA 2H0DB 2YYRA 4OGIA 4YBMA 4YABA 4AVXA 4UP0A 5ENJA 4LDFA 3O47A 5DKHA 3HMEA 5A5QA 3FEHA 3O37A 5C8GA 2R10A 5A83A 4R7EA 5HELA 3Q2FA 3FJUB 3IHPA 1WUMA 4UIXA 5B75A 5DYXA 2YREA 2R0YA 4Z0RA 4PS5A 4GNEA 3T7LA 4NR7A 4TT2A 5IG6A 4A9HA 2YW5A 3U5PA 4ZUXU 4IR4A 2EGMA 4BW1A 4QSPA 1DVPA 5EWDA 4TYLA 5EISA 1Z2QA 2MNYA 1FP0A 3LJUX 3C6WA 5ETDA 2FUIA 3EB6A 2G43A 3K2JA 5FFYA 1WEWA 2KGGA 5IGNA 3EB5A 1JOCA 4O75A 3PHDA 2KKXA 5EQ1A 5EV9A 2MJVB 4XYAA 3S92A 3UV2A 3HCTA 5II2A 5F5ZA 3KDEC 4ALHA 2OWAA 3D1BA 4R8PK 2DVSA 3T6RA 3MB4A 3RCWA 4QNSA 2M1RA 1IYMA 4MVTA 4QSUA 3P1DA 3KQIA 2B0OE 4F1PA 5A7CA 4P5OB 4N4IA 5LCWB 4Q0OA 1F68A 2K1JA 4S3OC 4NYWA 4XY9A 5AMFA 4TS8A 2ECIA 1WEPA 5I3LA 3HMHA 4IR3A 2ECTA 4LKAA 3LDYA 4MEOA 2M3HA 4N3WA 4Z1QA 2E6SA 3AQAA 4IR6A 3ERRA 4A9MA 4YADA 4N4FA 5J3XA 5D3HA 2D8UA 2VJFB 4HXKA 4TTEA 4XUAA 2KGIA 4NRCA 5DW2A 2XP0A 3DDTA 5I80A 3PURA 4ZC9A 5A85A 5CRMA 3SOXA 5F61A 2F42A 5LKUA 5I89A 5L97A 3O70A 5CQTA 3P1FA 4PY6A 5CY9A 2VPGA 4CCGX 5FH6A 2KIZA 2LGGA 5D24A 5CQ3A 1WEOA 4UYGA 5ENFA 2L7PA 5EI4A 4MR5A 2YURA 5SVXA 3LVRE 4IC2A 2YEKA 5DLXA 2JUNA 4QC3A 3KV6A 5A81A 5TCMA 3UV5A 2DVVA 3AADA 5LKTA 3VKHA 2HDPA 2KFTA 4IOQA 4O71A 5D3PA 4BW4A 2M13A 4O7EA 4O62A 2MD8C 5LJ2A 2DX8A 2VP7A 5B76A 4LR6A 5LUUA 5DBMA 1DCQA 4UIYA 4YYNA 4YC9A 5FBXA 4HXPA 5F1LA 5FFVA 2JMDA 4TQNA 5E9IA 2KYUA 5CZGA 3N9PA 1WEQA 3Q2EA 4A0CD 4PCEA 5KU3A 3RPGC 2WP1A 4NUCA 5LKZA 4L58A 2DVQA 3UW9A 3UVYA 1BORA 3LVQE 5DKAA 2L84A 5AIUA 5D3JA 4NUDA 3O7AA 4QR3A 3G0LA 2VJEA 4LC2A 4LYWA 2FSAA 5DKCA 5EWVA 5IIDA 2G6QA 4FK5A 3HCUA 5B8DA 4O7AA 4PTBA 3PUQA 3UVWA 5DW1A 4QR4A 5KTXA 5DYAA 2L0BA 5B78A 3QZVA 4YYMA 4A9LA 2JM3A 4FJCA 4A4CA 1ZKRA 4LRGA 5HQ7A 1E6IA 5KTUA 2XOYA 5HRWA 4QY4A 5TABA 2Y1MA 2KTBB 4UP5A 3DQVR 5A5NA 5EM3A 2D8SA 1K2FA 2DVRA 2OO1A 2R0SA 5EWWA 2CONA 2DATA 5F60A 4Z93A 5AMEA 5D0CA 3M63A 4MR4A 2IQJA 5FE7A 4QSQA 2HYED 4O7FA 4YYDA 5BT4A 2P57A 1MM2A 3IU6A 3L1ZB 4Z0OA 3ZTGA 5CUBA 4MR3A 5D26A 4LLBA 1E4UA 2OSSA 4WIVA 4A9FA 2KWJA 4Q6FA 5IBNA 4UYDA 2NAAA 2YW8A 2E7OA 5D3SA 5FH7A 3U5MA 2E6RA 5E9YA 5D25A 2DSMA 4QEUA 4Z6IA 4TT6A 5E7DA 5F25A 5H85A 2RS9B 2WP2A 4A9EA 3M99A 2YSMA 3I2DA 3O36A 4QYDA 4UYHA 4J3IA 5CQAA 2OXQC 3O33A 3FL2A 1Z6UA 3FM8C 4PCIA 2D82A 5FG6A 4Z1SA 5G05B 5LJ1A 2VPBA 5D3TA 5DFBA 2MD7B 2R0VA 4WHUA 4AKHA 2LAUA 5H1VA 2YQMA 4O7BA 4TKPB 4S3OB 4TZ2A 5D1LB 4MENA 1X4JA 4C67A 1CHCA 5ENEA 2K17A 1VYXA 2XOCA 3HCSA 2LXHC 2YUCA 2EGPA 4BHWA 5TBNA 3LQJA 1WE9A 5G4SA 2ECGA 2FD4A 2L75A 2YU4A 5SVIA 4LYSA 4A49A 4Y03A 2RI7A 4AKIA 2CSVA 5C11A 4XI1A 3U5NA 4YBSA 5HFQA 5HCLA 2QICA 2PUYA 2K4DA 2F6NA 3E2DA 5KH3A 5DKDA 3ZYQA 4I7BA 5A82A 2KWOA 2XB1A 3GL6A 4MR6A 1RMDA 2MKEA 5DYCA 4AP4A 4A9KA 2XOZA 4A9NA 4OUFA 2VPDA 4HXOA 5F62A 3PLWA 4Q0NA 4O74A 4A9IA 5H1TA 5FERA 3LJWA 1V87A 1HYIA 3I3JA 1WUGA 5A5SA 3H7HA 4KCXA 5HM0A 2C2LA 2MT5A 3ZNIA 4XUBA 3FANA 5A5RA 4I7CA 3JVLA 5F63A 2EJNA 1WFKA 2ECWA 4N4GA 3JUEA 4OGEA 4LJNA 1X4IA 5CQ6A 3T9KA 5SVYA 4CFLA 3O35A 3GG3A 5FFWA 5HJCA 4QUUA 5I83A 4IR5A 4CURA 5CRZA 5CUDA 2ECJA 5CU8A 3RPGB 2CSYA 4BW2A 2QJ0A 2YYNA 3U5KA 5FG5A 5FE1A 4NR5A 5D3NA 4YYJA 4NRAA 4BW3A 4ZDTA 1X0JA 5FG4A 5ENBA 2ECVA 3P5OA 3HTKC 2RSDA 2L43A 2EXUA 5CUCA 5FE8A 4LZ2A 4KV1A 4QF3A 3JVJA 4TZ8A 4FLPA 1MM3A 5HQ5A 2LDRA 1JM7A 4HXMA 5LVRA 5EP7A 2VPEA 4AKNA 5E73A 2E61A 5IGLA 3ZVYA 5TDWA 4YK0A 5K29A 4F3IA 3S91A 2Y43A 4QC1A 3U5OA 3N9MA 2RNYA 5FE0A 2GRCA 4J0RA 5CQ4A 5JWMA 4HXSA 4CUPA 5LJ0A 5KH9A 5FE5A 2MUMA 2L85A 5AD3A 1JM7B 1WEVA 3NG2A 2CT2A 2YELA 3MULA 3LQIA 4J1PA 3UVXA 5B77A 4FIPA 5L8TA 4YBTA 2KKYA 3HMFA 4TT4A 1Z60A 1PUOA 5EPRA 5EWHA 2LXPC 2QIZA 1T1HA 3MQMA 3SHBA 2VJEB 3C5KA 5CUEA 5JI8A 4QSWA 1F62A 5TB6A 4KV4A 2LQ6A 2KWKA 2YHNA 2KE1A 4QSVA 3SVFA 3L1XA 3VK6A 4C9ZA 2LGVA 4IOOA 4CL9A 3LQHA 5BT5A 2PNXA 2YSJA 4CUQA 1G25A 4HXRA 5ENGA 1WEUA 5I86A 2YQDA 4YATA 3NXBA 4O64A 3Q1DA 3RTRB 1X4UA 5FB0A 5FE6A 1N87A 5C7NA 2H60A 4L7XA 5TDRA 1U6GB 4HBVA 5EU1A 2KREA 3N9NA 5D7XA 4PKLA 3DAIA 5AITA 5FE4A 4QZSA 5EA1A 4X3GA 5A5OA 5EWCA 2YT5A 3D1DA 4UIWA 4NS5A 1N72A 5CGPA 5DY7A 3MB3A 5E9LA 1WEEA 5HRVA 5G04B 4MEPA 2JMIA 4QUTA 4WHWA 2LRIC 2YEMA 4DONA 4NRBA 5DLZA 4YYKA 3G0JA 5EK9A 5HEMA 4NR9A 5IGMA 2RFJA 1WEMA 2CRRA 4HBWA 3DPLR 5CS8A 3FKMX 4O72A 5F2PA 3IU5A 5CPEA 4FO9A 4WZ3B 4YH3A 2YVRA 2YQLA 4NQMA 2RO1A 5II1A 1WESA 5FE3A 4XY8A 5EYAF 4F52B 2L80A 4GNDA 4QSRA 5EVAA 4V3LC 1HYJA 5LKXA 4PPEA 4Z6HA 2IDAA 2F6JA 2FFWA 4CA1A 5L99A 2E7NA 4V3KC 4HBXA 4I7DA 4QYLA 3ONIA
chains in the Genus database with same CATH topology
3L11A 5E9MA 5E9KA 5G0FA 4QSXA 4QSSA 2UZGA 5D1MB 5ETBA 4NN2A 4UIVA 4IC3A 5LVQA 2MA6A 4ZW1A 3P1CA 4LYIA 4B7YC 4RVRA 5CQ7A 1WIMA 4A9JA 2ECNA 3MUKA 4QBMA 3N9QA 3ZVZB 4TU4A 4O70A 4CUSA 5CUAA 4LK9A 5DYUA 3SOUA 5ENHA 5DX4A 4NR4A 2VNFA 4UYFA 3N9OA 4ALGA 1EQFA 2I7KA 4NYXA 5CFWA 4CUUA 4QR5A 5FE2A 4LADB 4P5OB 3SOWA 2M6MA 4A9OA 5C4QA 2DWWA 5COIA 2EODA 5HRXA 4B86C 5ENIA 2NXBA 5BT3A 2OUOA 2BAYA 5FDZA 2RNWA 2N9GA 3MXFA 5F3AA 2MIQA 5A5PA 5C87A 5G4RA 3UVDA 2VJFA 4UIZA 5L96A 5H1UA 5KTWA 4UYFB 4GB0A 5D1KB 5FE9A 5C85A 4YY6A 4CLBA 1LDJB 3P1EA 4QEWA 5F36A 3M62A 5EGUA 4YYGA 5HLSA 4NR8A 4IORA 2AN6A 5L8UA 4HXLA 4LZRA 2YDWA 5C89A 1VD4A 1XWHA 2KWNA 2YHOA 4J0SA 3TLPA 4AYCA 4BBQA 5AD2A 5ENCA 4NYVA 2L5UA 2G4AA 4NXJA 5E74A 5I40A 1JSPB 4UI9B 3JVMA 4QB3A 1VFYA 2ZETC 2MA5A 4O7CA 4CFKA 1ZS5A 3ZPV1 2JRJA 2I50A 2KU3A 2DKWA 3ASLA 3N9LA 3O34A 5CQ8A 5D3RA 4YY4A 2C2VS 2M85A 2MNZA 2LGLA 4C66A 4AYCB 5C13A 4GNFA 4A4BA 2Y1NA 4LZSA 5I1QA 3ZPVE 2I8NA 5CQ5A 3JVKA 5CUGA 4YH4A 5FH8A 4YYHA 4W4UA 5CP5A 5HFRA 3SVHA 1FBVA 3ZYUA 3KNVA 5DINA 4TU6A 2E3KA 5EICA 5KO4A 3U5JA 4AUQB 2L5EA 2LSPB 3D7CA 4NR6A 5L98A 5IGKA 2FUUA 3QZTA 5I88A 4QEVA 3QZSA 5JG6A 3MHHA 5H9MA 1ZBDB 4WZ2A 5FB1A 5HQ6A 4MEQA 4OGJA 5E0RA 4YYIA 2XEUA 5CTLA 4NUEA 5D3LA 5TRBA 2EA6A 3SVGA 4ZQLA 5E3DA 5F1HA 5B79A 5EPSA 3LRQA 1WENA 2D9EA 5EPBA 2JMJA 2LN0A 5DFCA 2K16A 2CSZA 4MSXA 4WA6A 4WZ0A 4QF2A 1JM4B 4GNGA 4UITA 4QSTA 1LDKC 3GV4A 4BJXA 5I7YA 5E3GA 5FEYA 5KH7A 5J0DA 3MHSA 4YAXA 2CKLA 4X2IA 4CUTA 5HENA 3LXJA 4HXNA 4HBYA 4O78A 2LGKA 4GPJA 4N4HA 1WILA 2H0DA 5ACYA 3U5LA 5DFDA 3V43A 4R2YA 2KR4A 3UV4A 5E9VA 1WGMA 4O76A 5KHMA 2LV9A 3KV5A 2CKLB 2G45A 4NQNA 5I7XA 3DWYA 5I29A 2RNXA 4E96A 4O77A 4UIUA 4UYEA 2H0DB 2YYRA 4OGIA 4YBMA 4YABA 4AVXA 4UP0A 5ENJA 4LDFA 5DKHA 3HMEA 5A5QA 3O37A 5C8GA 2R10A 5A83A 4R7EA 5HELA 3Q2FA 3IHPA 1WUMA 4UIXA 5B75A 5DYXA 2YREA 2R0YA 4PS5A 4GNEA 3T7LA 4NR7A 4TT2A 5IG6A 4A9HA 2YW5A 3U5PA 4ZUXU 4IR4A 4BW1A 4QSPA 1DVPA 5EWDA 4TYLA 5EISA 1Z2QA 2MNYA 1FP0A 3C6WA 5ETDA 2FUIA 3EB6A 2G43A 3K2JA 5FFYA 1WEWA 2KGGA 5IGNA 3EB5A 1JOCA 4O75A 3PHDA 5EQ1A 5EV9A 2MJVB 4XYAA 3S92A 3UV2A 3HCTA 5II2A 5F5ZA 4ALHA 4R8PK 2DVSA 3T6RA 3MB4A 3RCWA 4QNSA 2M1RA 1IYMA 4MVTA 4QSUA 3P1DA 3KQIA 5A7CA 4N4IA 5LCWB 4Q0OA 1F68A 2K1JA 4S3OC 4NYWA 4XY9A 5AMFA 4TS8A 2ECIA 1WEPA 5I3LA 3HMHA 4IR3A 2ECTA 4LKAA 4MEOA 2M3HA 4N3WA 4Z1QA 2E6SA 3AQAA 4IR6A 4A9MA 4YADA 4N4FA 5J3XA 5D3HA 2VJFB 4HXKA 4TTEA 4XUAA 2KGIA 4NRCA 5DW2A 5I80A 3PURA 4ZC9A 5A85A 5CRMA 3SOXA 5F61A 2F42A 5LKUA 5I89A 5L97A 3O70A 5CQTA 3P1FA 4PY6A 5CY9A 2VPGA 4CCGX 5FH6A 2KIZA 2LGGA 5D24A 5CQ3A 1WEOA 4UYGA 5ENFA 5EI4A 4MR5A 2YURA 4IC2A 2YEKA 5DLXA 4QC3A 3KV6A 5A81A 5TCMA 3UV5A 2DVVA 3AADA 5LKTA 2HDPA 2KFTA 4IOQA 4O71A 5D3PA 4BW4A 2MD8C 4O7EA 5LJ2A 2DX8A 2VP7A 5B76A 4LR6A 5LUUA 5DBMA 4UIYA 4YYNA 4YC9A 5FBXA 4HXPA 5F1LA 5FFVA 2JMDA 4TQNA 5E9IA 2KYUA 5CZGA 3N9PA 1WEQA 3Q2EA 4A0CD 4PCEA 5KU3A 3RPGC 2WP1A 4NUCA 5LKZA 4L58A 2DVQA 3UW9A 3UVYA 1BORA 5DKAA 2L84A 5AIUA 5D3JA 4NUDA 3O7AA 4QR3A 3G0LA 2VJEA 4LC2A 4LYWA 2FSAA 5DKCA 5EWVA 5IIDA 2G6QA 4FK5A 3HCUA 5B8DA 4O7AA 4PTBA 3PUQA 3UVWA 5DW1A 4QR4A 5KTXA 5DYAA 2L0BA 5B78A 3QZVA 4YYMA 4A9LA 4FJCA 4A4CA 4LRGA 5HQ7A 5KTUA 1E6IA 5HRWA 4QY4A 5TABA 2Y1MA 2KTBB 4UP5A 3DQVR 5A5NA 5EM3A 2D8SA 1K2FA 2DVRA 2OO1A 2R0SA 5EWWA 2DATA 5F60A 4Z93A 5AMEA 5D0CA 3M63A 4MR4A 5FE7A 4QSQA 2HYED 4O7FA 4YYDA 5BT4A 3L1ZB 1MM2A 3IU6A 3ZTGA 5CUBA 4MR3A 5D26A 4LLBA 1E4UA 2OSSA 4WIVA 4A9FA 2KWJA 4Q6FA 5IBNA 4UYDA 2NAAA 2YW8A 2E7OA 5D3SA 5FH7A 3U5MA 2E6RA 5E9YA 5D25A 4QEUA 4Z6IA 4TT6A 5E7DA 5F25A 5H85A 2RS9B 2WP2A 4A9EA 3M99A 2YSMA 3I2DA 3O36A 4QYDA 4UYHA 4J3IA 5CQAA 2OXQC 3O33A 3FL2A 1Z6UA 4PCIA 2D82A 5FG6A 4Z1SA 5G05B 5LJ1A 2VPBA 5D3TA 5DFBA 2MD7B 2R0VA 4WHUA 2YQMA 5H1VA 4TKPB 4O7BA 4S3OB 4TZ2A 5D1LB 4MENA 1X4JA 4C67A 1CHCA 5ENEA 2K17A 1VYXA 3HCSA 2LXHC 2YUCA 2EGPA 4BHWA 5TBNA 3LQJA 1WE9A 5G4SA 2ECGA 2YU4A 2L75A 4LYSA 4A49A 4Y03A 2RI7A 5C11A 4XI1A 3U5NA 4YBSA 5HFQA 5HCLA 2QICA 2PUYA 2K4DA 2F6NA 5KH3A 5DKDA 3ZYQA 4I7BA 5A82A 2KWOA 2XB1A 3GL6A 4MR6A 1RMDA 5DYCA 4AP4A 4A9KA 4A9NA 4OUFA 2VPDA 4HXOA 5F62A 4Q0NA 4O74A 4A9IA 5H1TA 5FERA 3LJWA 1V87A 1HYIA 3I3JA 1WUGA 5A5SA 4KCXA 5HM0A 2C2LA 2MT5A 3ZNIA 4XUBA 5A5RA 4I7CA 3JVLA 5F63A 1WFKA 2ECWA 4N4GA 4LJNA 1X4IA 5CQ6A 4CFLA 3O35A 3GG3A 5FFWA 5HJCA 4QUUA 5I83A 4IR5A 4CURA 5CRZA 5CUDA 2ECJA 5CU8A 3RPGB 2CSYA 4BW2A 2QJ0A 2YYNA 3U5KA 5FG5A 5FE1A 4NR5A 5D3NA 4YYJA 4NRAA 4BW3A 4ZDTA 1X0JA 5FG4A 5ENBA 2ECVA 3P5OA 3HTKC 2RSDA 2L43A 5CUCA 5FE8A 4LZ2A 4KV1A 4QF3A 3JVJA 4TZ8A 4FLPA 1MM3A 5HQ5A 2LDRA 1JM7A 4HXMA 5LVRA 5EP7A 2VPEA 4AKNA 5E73A 5IGLA 3ZVYA 5TDWA 4YK0A 5K29A 4F3IA 3S91A 2Y43A 4QC1A 3U5OA 3N9MA 2RNYA 5FE0A 2GRCA 4J0RA 5CQ4A 5JWMA 4HXSA 4CUPA 5LJ0A 5KH9A 5FE5A 2MUMA 2L85A 5AD3A 1JM7B 1WEVA 3NG2A 2CT2A 2YELA 3MULA 3LQIA 4J1PA 3UVXA 5B77A 4FIPA 5L8TA 4YBTA 3HMFA 4TT4A 1Z60A 5EPRA 5EWHA 2LXPC 2QIZA 1T1HA 3MQMA 3SHBA 2VJEB 3C5KA 5CUEA 5JI8A 4QSWA 1F62A 5TB6A 4KV4A 2LQ6A 2KWKA 2YHNA 2KE1A 4QSVA 3SVFA 3L1XA 3VK6A 4C9ZA 2LGVA 4IOOA 4CL9A 3LQHA 5BT5A 2PNXA 2YSJA 4CUQA 1G25A 4HXRA 5ENGA 1WEUA 5I86A 2YQDA 4YATA 3NXBA 4O64A 3RTRB 1X4UA 5FB0A 5FE6A 1N87A 5C7NA 2H60A 4L7XA 5TDRA 1U6GB 4HBVA 5EU1A 2KREA 3N9NA 5D7XA 4PKLA 3DAIA 5AITA 5FE4A 4QZSA 5EA1A 4X3GA 5A5OA 5EWCA 2YT5A 4UIWA 4NS5A 1N72A 5CGPA 5DY7A 3MB3A 5E9LA 1WEEA 5HRVA 5G04B 4MEPA 2JMIA 4QUTA 4WHWA 2LRIC 2YEMA 4DONA 4NRBA 5DLZA 4YYKA 3G0JA 5EK9A 5HEMA 4NR9A 5IGMA 2RFJA 1WEMA 4HBWA 3DPLR 5CS8A 3FKMX 4O72A 5F2PA 3IU5A 5CPEA 4FO9A 4WZ3B 4YH3A 2YQLA 4NQMA 2RO1A 5II1A 1WESA 5FE3A 4XY8A 5EYAF 4F52B 2L80A 4GNDA 4QSRA 5EVAA 4V3LC 1HYJA 5LKXA 4PPEA 4Z6HA 2IDAA 2F6JA 4CA1A 5L99A 2E7NA 4V3KC 4HBXA 4I7DA 4QYLA 3ONIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L11 A;  5E9M A;  5E9K A;  5G0F A;  4QSX A;  4QSS A;  2UZG A;  5D1M B;  5ETB A;  4NN2 A;  4UIV A;  4IC3 A;  5LVQ A;  2MA6 A;  4ZW1 A;  3P1C A;  4LYI A;  4B7Y C;  4RVR A;  5CQ7 A;  1WIM A;  4A9J A;  2ECN A;  3MUK A;  4QBM A;  3N9Q A;  3ZVZ B;  4TU4 A;  4O70 A;  4CUS A;  5CUA A;  4LK9 A;  5DYU A;  3SOU A;  5ENH A;  5DX4 A;  4NR4 A;  2VNF A;  4UYF A;  3N9O A;  4ALG A;  1EQF A;  2I7K A;  4NYX A;  5CFW A;  4CUU A;  4QR5 A;  5FE2 A;  4LAD B;  4P5O B;  3SOW A;  2M6M A;  4A9O A;  5C4Q A;  2DWW A;  5COI A;  2EOD A;  5HRX A;  4B86 C;  5ENI A;  2NXB A;  5BT3 A;  2OUO A;  2BAY A;  5FDZ A;  2RNW A;  2N9G A;  3MXF A;  5F3A A;  2MIQ A;  5A5P A;  5C87 A;  5G4R A;  3UVD A;  2VJF A;  4UIZ A;  5L96 A;  5H1U A;  5KTW A;  4UYF B;  4GB0 A;  5D1K B;  5FE9 A;  5C85 A;  4YY6 A;  4CLB A;  1LDJ B;  3P1E A;  4QEW A;  5F36 A;  3M62 A;  5EGU A;  4YYG A;  5HLS A;  4NR8 A;  4IOR A;  2AN6 A;  5L8U A;  4HXL A;  4LZR A;  2YDW A;  5C89 A;  1VD4 A;  1XWH A;  2KWN A;  2YHO A;  4J0S A;  3TLP A;  4AYC A;  4BBQ A;  5AD2 A;  5ENC A;  4NYV A;  2L5U A;  2G4A A;  4NXJ A;  5E74 A;  5I40 A;  1JSP B;  4UI9 B;  3JVM A;  4QB3 A;  1VFY A;  2ZET C;  2MA5 A;  4O7C A;  4CFK A;  1ZS5 A;  3ZPV 1;  2JRJ A;  2I50 A;  2KU3 A;  2DKW A;  3ASL A;  3N9L A;  3O34 A;  5CQ8 A;  5D3R A;  4YY4 A;  2C2V S;  2M85 A;  2MNZ A;  2LGL A;  4C66 A;  4AYC B;  5C13 A;  4GNF A;  4A4B A;  2Y1N A;  4LZS A;  5I1Q A;  3ZPV E;  2I8N A;  5CQ5 A;  3JVK A;  5CUG A;  4YH4 A;  5FH8 A;  4YYH A;  4W4U A;  5CP5 A;  5HFR A;  3SVH A;  1FBV A;  3ZYU A;  3KNV A;  5DIN A;  4TU6 A;  2E3K A;  5EIC A;  5KO4 A;  3U5J A;  4AUQ B;  2L5E A;  2LSP B;  3D7C A;  4NR6 A;  5L98 A;  5IGK A;  2FUU A;  3QZT A;  5I88 A;  4QEV A;  3QZS A;  5JG6 A;  3MHH A;  5H9M A;  1ZBD B;  4WZ2 A;  5FB1 A;  5HQ6 A;  4MEQ A;  4OGJ A;  5E0R A;  4YYI A;  2XEU A;  5CTL A;  4NUE A;  5D3L A;  5TRB A;  2EA6 A;  3SVG A;  4ZQL A;  5E3D A;  5F1H A;  5B79 A;  5EPS A;  3LRQ A;  1WEN A;  2D9E A;  5EPB A;  2JMJ A;  2LN0 A;  5DFC A;  2K16 A;  2CSZ A;  4MSX A;  4WA6 A;  4WZ0 A;  4QF2 A;  1JM4 B;  4GNG A;  4UIT A;  4QST A;  1LDK C;  3GV4 A;  4BJX A;  5I7Y A;  5E3G A;  5FEY A;  5KH7 A;  5J0D A;  3MHS A;  4YAX A;  2CKL A;  4X2I A;  4CUT A;  5HEN A;  3LXJ A;  4HXN A;  4HBY A;  4O78 A;  2LGK A;  4GPJ A;  4N4H A;  1WIL A;  2H0D A;  5ACY A;  3U5L A;  5DFD A;  3V43 A;  4R2Y A;  2KR4 A;  3UV4 A;  5E9V A;  1WGM A;  4O76 A;  5KHM A;  2LV9 A;  3KV5 A;  2CKL B;  2G45 A;  4NQN A;  5I7X A;  3DWY A;  5I29 A;  2RNX A;  4E96 A;  4O77 A;  4UIU A;  4UYE A;  2H0D B;  2YYR A;  4OGI A;  4YBM A;  4YAB A;  4AVX A;  4UP0 A;  5ENJ A;  4LDF A;  5DKH A;  3HME A;  5A5Q A;  3O37 A;  5C8G A;  2R10 A;  5A83 A;  4R7E A;  5HEL A;  3Q2F A;  3IHP A;  1WUM A;  4UIX A;  5B75 A;  5DYX A;  2YRE A;  2R0Y A;  4PS5 A;  4GNE A;  3T7L A;  4NR7 A;  4TT2 A;  5IG6 A;  4A9H A;  2YW5 A;  3U5P A;  4ZUX U;  4IR4 A;  4BW1 A;  4QSP A;  1DVP A;  5EWD A;  4TYL A;  5EIS A;  1Z2Q A;  2MNY A;  1FP0 A;  3C6W A;  5ETD A;  2FUI A;  3EB6 A;  2G43 A;  3K2J A;  5FFY A;  1WEW A;  2KGG A;  5IGN A;  3EB5 A;  1JOC A;  4O75 A;  3PHD A;  5EQ1 A;  5EV9 A;  2MJV B;  4XYA A;  3S92 A;  3UV2 A;  3HCT A;  5II2 A;  5F5Z A;  4ALH A;  4R8P K;  2DVS A;  3T6R A;  3MB4 A;  3RCW A;  4QNS A;  2M1R A;  1IYM A;  4MVT A;  4QSU A;  3P1D A;  3KQI A;  5A7C A;  4N4I A;  5LCW B;  4Q0O A;  1F68 A;  2K1J A;  4S3O C;  4NYW A;  4XY9 A;  5AMF A;  4TS8 A;  2ECI A;  1WEP A;  5I3L A;  3HMH A;  4IR3 A;  2ECT A;  4LKA A;  4MEO A;  2M3H A;  4N3W A;  4Z1Q A;  2E6S A;  3AQA A;  4IR6 A;  4A9M A;  4YAD A;  4N4F A;  5J3X A;  5D3H A;  2VJF B;  4HXK A;  4TTE A;  4XUA A;  2KGI A;  4NRC A;  5DW2 A;  5I80 A;  3PUR A;  4ZC9 A;  5A85 A;  5CRM A;  3SOX A;  5F61 A;  2F42 A;  5LKU A;  5I89 A;  5L97 A;  3O70 A;  5CQT A;  3P1F A;  4PY6 A;  5CY9 A;  2VPG A;  4CCG X;  5FH6 A;  2KIZ A;  2LGG A;  5D24 A;  5CQ3 A;  1WEO A;  4UYG A;  5ENF A;  5EI4 A;  4MR5 A;  2YUR A;  4IC2 A;  2YEK A;  5DLX A;  4QC3 A;  3KV6 A;  5A81 A;  5TCM A;  3UV5 A;  2DVV A;  3AAD A;  5LKT A;  2HDP A;  2KFT A;  4IOQ A;  4O71 A;  5D3P A;  4BW4 A;  2MD8 C;  4O7E A;  5LJ2 A;  2DX8 A;  2VP7 A;  5B76 A;  4LR6 A;  5LUU A;  5DBM A;  4UIY A;  4YYN A;  4YC9 A;  5FBX A;  4HXP A;  5F1L A;  5FFV A;  2JMD A;  4TQN A;  5E9I A;  2KYU A;  5CZG A;  3N9P A;  1WEQ A;  3Q2E A;  4A0C D;  4PCE A;  5KU3 A;  3RPG C;  2WP1 A;  4NUC A;  5LKZ A;  4L58 A;  2DVQ A;  3UW9 A;  3UVY A;  1BOR A;  5DKA A;  2L84 A;  5AIU A;  5D3J A;  4NUD A;  3O7A A;  4QR3 A;  3G0L A;  2VJE A;  4LC2 A;  4LYW A;  2FSA A;  5DKC A;  5EWV A;  5IID A;  2G6Q A;  4FK5 A;  3HCU A;  5B8D A;  4O7A A;  4PTB A;  3PUQ A;  3UVW A;  5DW1 A;  4QR4 A;  5KTX A;  5DYA A;  2L0B A;  5B78 A;  3QZV A;  4YYM A;  4A9L A;  4FJC A;  4A4C A;  4LRG A;  5HQ7 A;  5KTU A;  1E6I A;  5HRW A;  4QY4 A;  5TAB A;  2Y1M A;  2KTB B;  4UP5 A;  3DQV R;  5A5N A;  5EM3 A;  2D8S A;  1K2F A;  2DVR A;  2OO1 A;  2R0S A;  5EWW A;  2DAT A;  5F60 A;  4Z93 A;  5AME A;  5D0C A;  3M63 A;  4MR4 A;  5FE7 A;  4QSQ A;  2HYE D;  4O7F A;  4YYD A;  5BT4 A;  3L1Z B;  1MM2 A;  3IU6 A;  3ZTG A;  5CUB A;  4MR3 A;  5D26 A;  4LLB A;  1E4U A;  2OSS A;  4WIV A;  4A9F A;  2KWJ A;  4Q6F A;  5IBN A;  4UYD A;  2NAA A;  2YW8 A;  2E7O A;  5D3S A;  5FH7 A;  3U5M A;  2E6R A;  5E9Y A;  5D25 A;  4QEU A;  4Z6I A;  4TT6 A;  5E7D A;  5F25 A;  5H85 A;  2RS9 B;  2WP2 A;  4A9E A;  3M99 A;  2YSM A;  3I2D A;  3O36 A;  4QYD A;  4UYH A;  4J3I A;  5CQA A;  2OXQ C;  3O33 A;  3FL2 A;  1Z6U A;  4PCI A;  2D82 A;  5FG6 A;  4Z1S A;  5G05 B;  5LJ1 A;  2VPB A;  5D3T A;  5DFB A;  2MD7 B;  2R0V A;  4WHU A;  2YQM A;  5H1V A;  4TKP B;  4O7B A;  4S3O B;  4TZ2 A;  5D1L B;  4MEN A;  1X4J A;  4C67 A;  1CHC A;  5ENE A;  2K17 A;  1VYX A;  3HCS A;  2LXH C;  2YUC A;  2EGP A;  4BHW A;  5TBN A;  3LQJ A;  1WE9 A;  5G4S A;  2ECG A;  2YU4 A;  2L75 A;  4LYS A;  4A49 A;  4Y03 A;  2RI7 A;  5C11 A;  4XI1 A;  3U5N A;  4YBS A;  5HFQ A;  5HCL A;  2QIC A;  2PUY A;  2K4D A;  2F6N A;  5KH3 A;  5DKD A;  3ZYQ A;  4I7B A;  5A82 A;  2KWO A;  2XB1 A;  3GL6 A;  4MR6 A;  1RMD A;  5DYC A;  4AP4 A;  4A9K A;  4A9N A;  4OUF A;  2VPD A;  4HXO A;  5F62 A;  4Q0N A;  4O74 A;  4A9I A;  5H1T A;  5FER A;  3LJW A;  1V87 A;  1HYI A;  3I3J A;  1WUG A;  5A5S A;  4KCX A;  5HM0 A;  2C2L A;  2MT5 A;  3ZNI A;  4XUB A;  5A5R A;  4I7C A;  3JVL A;  5F63 A;  1WFK A;  2ECW A;  4N4G A;  4LJN A;  1X4I A;  5CQ6 A;  4CFL A;  3O35 A;  3GG3 A;  5FFW A;  5HJC A;  4QUU A;  5I83 A;  4IR5 A;  4CUR A;  5CRZ A;  5CUD A;  2ECJ A;  5CU8 A;  3RPG B;  2CSY A;  4BW2 A;  2QJ0 A;  2YYN A;  3U5K A;  5FG5 A;  5FE1 A;  4NR5 A;  5D3N A;  4YYJ A;  4NRA A;  4BW3 A;  4ZDT A;  1X0J A;  5FG4 A;  5ENB A;  2ECV A;  3P5O A;  3HTK C;  2RSD A;  2L43 A;  5CUC A;  5FE8 A;  4LZ2 A;  4KV1 A;  4QF3 A;  3JVJ A;  4TZ8 A;  4FLP A;  1MM3 A;  5HQ5 A;  2LDR A;  1JM7 A;  4HXM A;  5LVR A;  5EP7 A;  2VPE A;  4AKN A;  5E73 A;  5IGL A;  3ZVY A;  5TDW A;  4YK0 A;  5K29 A;  4F3I A;  3S91 A;  2Y43 A;  4QC1 A;  3U5O A;  3N9M A;  2RNY A;  5FE0 A;  2GRC A;  4J0R A;  5CQ4 A;  5JWM A;  4HXS A;  4CUP A;  5LJ0 A;  5KH9 A;  5FE5 A;  2MUM A;  2L85 A;  5AD3 A;  1JM7 B;  1WEV A;  3NG2 A;  2CT2 A;  2YEL A;  3MUL A;  3LQI A;  4J1P A;  3UVX A;  5B77 A;  4FIP A;  5L8T A;  4YBT A;  3HMF A;  4TT4 A;  1Z60 A;  5EPR A;  5EWH A;  2LXP C;  2QIZ A;  1T1H A;  3MQM A;  3SHB A;  2VJE B;  3C5K A;  5CUE A;  5JI8 A;  4QSW A;  1F62 A;  5TB6 A;  4KV4 A;  2LQ6 A;  2KWK A;  2YHN A;  2KE1 A;  4QSV A;  3SVF A;  3L1X A;  3VK6 A;  4C9Z A;  2LGV A;  4IOO A;  4CL9 A;  3LQH A;  5BT5 A;  2PNX A;  2YSJ A;  4CUQ A;  1G25 A;  4HXR A;  5ENG A;  1WEU A;  5I86 A;  2YQD A;  4YAT A;  3NXB A;  4O64 A;  3RTR B;  1X4U A;  5FB0 A;  5FE6 A;  1N87 A;  5C7N A;  2H60 A;  4L7X A;  5TDR A;  1U6G B;  4HBV A;  5EU1 A;  2KRE A;  3N9N A;  5D7X A;  4PKL A;  3DAI A;  5AIT A;  5FE4 A;  4QZS A;  5EA1 A;  4X3G A;  5A5O A;  5EWC A;  2YT5 A;  4UIW A;  4NS5 A;  1N72 A;  5CGP A;  5DY7 A;  3MB3 A;  5E9L A;  1WEE A;  5HRV A;  5G04 B;  4MEP A;  2JMI A;  4QUT A;  4WHW A;  2LRI C;  2YEM A;  4DON A;  4NRB A;  5DLZ A;  4YYK A;  3G0J A;  5EK9 A;  5HEM A;  4NR9 A;  5IGM A;  2RFJ A;  1WEM A;  4HBW A;  3DPL R;  5CS8 A;  3FKM X;  4O72 A;  5F2P A;  3IU5 A;  5CPE A;  4FO9 A;  4WZ3 B;  4YH3 A;  2YQL A;  4NQM A;  2RO1 A;  5II1 A;  1WES A;  5FE3 A;  4XY8 A;  5EYA F;  4F52 B;  2L80 A;  4GND A;  4QSR A;  5EVA A;  4V3L C;  1HYJ A;  5LKX A;  4PPE A;  4Z6H A;  2IDA A;  2F6J A;  4CA1 A;  5L99 A;  2E7N A;  4V3K C;  4HBX A;  4I7D A;  4QYL A;  3ONI A; 
#chains in the Genus database with same CATH topology
 3L11 A;  5E9M A;  5E9K A;  5G0F A;  4QSX A;  4QSS A;  2UZG A;  5D1M B;  5ETB A;  4NN2 A;  4UIV A;  4IC3 A;  5LVQ A;  2MA6 A;  4ZW1 A;  3P1C A;  4LYI A;  4B7Y C;  4RVR A;  5CQ7 A;  1WIM A;  4A9J A;  2ECN A;  3MUK A;  4QBM A;  3N9Q A;  3ZVZ B;  4TU4 A;  4O70 A;  4CUS A;  5CUA A;  4LK9 A;  5DYU A;  3SOU A;  5ENH A;  5DX4 A;  4NR4 A;  2VNF A;  4UYF A;  3N9O A;  4ALG A;  1EQF A;  2I7K A;  4NYX A;  5CFW A;  4CUU A;  4QR5 A;  5FE2 A;  3MDB C;  4LAD B;  4QQ4 A;  3SOW A;  2M6M A;  4A9O A;  5C4Q A;  2DWW A;  5COI A;  2EOD A;  5HRX A;  4B86 C;  5ENI A;  2NXB A;  5BT3 A;  2OUO A;  2BAY A;  5FDZ A;  2RNW A;  2N9G A;  3MXF A;  5F3A A;  2MIQ A;  5A5P A;  5C87 A;  5G4R A;  3UVD A;  2RR4 A;  2VJF A;  4UIZ A;  5L96 A;  5H1U A;  5KTW A;  4UYF B;  4GB0 A;  5D1K B;  5FE9 A;  5C85 A;  4YY6 A;  4CLB A;  1LDJ B;  3P1E A;  4QEW A;  5F36 A;  3M62 A;  5EGU A;  4YYG A;  5HLS A;  4NR8 A;  4IOR A;  2AN6 A;  5L8U A;  4HXL A;  4LZR A;  2YDW A;  5C89 A;  1VD4 A;  1XWH A;  2KWN A;  2YHO A;  4J0S A;  3TLP A;  4AYC A;  4BBQ A;  5AD2 A;  5ENC A;  4NYV A;  2L5U A;  2G4A A;  4NXJ A;  5E74 A;  5I40 A;  1JSP B;  4UI9 B;  3JVM A;  4QB3 A;  1VFY A;  2ZET C;  2MA5 A;  4O7C A;  4CFK A;  1ZS5 A;  3ZPV 1;  2JRJ A;  2I50 A;  2KU3 A;  2DKW A;  3ASL A;  5SVI B;  3N9L A;  3O34 A;  5CQ8 A;  5D3R A;  4YY4 A;  2C2V S;  2M85 A;  2MNZ A;  2LGL A;  4C66 A;  4AYC B;  5C13 A;  4GNF A;  4A4B A;  2Y1N A;  4LZS A;  5I1Q A;  3ZPV E;  2I8N A;  5CQ5 A;  3JVK A;  5CUG A;  4YH4 A;  5FH8 A;  4YYH A;  4W4U A;  5CP5 A;  5HFR A;  3SVH A;  1FBV A;  3ZYU A;  3KNV A;  5DIN A;  4TU6 A;  2E3K A;  5K3Q A;  5EIC A;  5KO4 A;  3U5J A;  4OGC A;  4AUQ B;  2L5E A;  4AKG A;  3D7C A;  2LSP B;  4NR6 A;  5L98 A;  5IGK A;  2FUU A;  3QZT A;  5I88 A;  4QEV A;  3QZS A;  5JG6 A;  3MHH A;  3VKG A;  5H9M A;  1ZBD B;  4WZ2 A;  2DJA A;  5FB1 A;  5HQ6 A;  4MEQ A;  4OGJ A;  5E0R A;  4YYI A;  2XEU A;  5CTL A;  4NUE A;  5D3L A;  5TRB A;  2EA6 A;  3SVG A;  4ZQL A;  5E3D A;  5F1H A;  5B79 A;  5EPS A;  3M7K A;  3FAO A;  3LRQ A;  1WEN A;  2D9E A;  5EPB A;  2JMJ A;  2LN0 A;  5DFC A;  2K16 A;  2CSZ A;  4MSX A;  4WA6 A;  4WZ0 A;  4QF2 A;  1JM4 B;  4GNG A;  4UIT A;  4QST A;  1LDK C;  3GV4 A;  4BJX A;  5I7Y A;  1MBM A;  5E3G A;  5FEY A;  5KH7 A;  5J0D A;  3MHS A;  4YAX A;  2CKL A;  4X2I A;  4CUT A;  5HEN A;  3LXJ A;  4HXN A;  4HBY A;  4O78 A;  2LGK A;  4GPJ A;  4N4H A;  1WIL A;  2H0D A;  5ACY A;  3U5L A;  5DFD A;  4AI6 A;  3V43 A;  4R2Y A;  2KR4 A;  3UV4 A;  5E9V A;  1WGM A;  4O76 A;  5KHM A;  2LV9 A;  3KV5 A;  2CKL B;  2G45 A;  4NQN A;  3SUB A;  5I7X A;  2CRW A;  3DWD A;  3DWY A;  5I29 A;  4H9D A;  2RNX A;  4E96 A;  4O77 A;  4UIU A;  4UYE A;  2H0D B;  2YYR A;  4OGI A;  4YBM A;  4YAB A;  4AVX A;  4UP0 A;  5ENJ A;  4LDF A;  3O47 A;  5DKH A;  3HME A;  5A5Q A;  3FEH A;  3O37 A;  5C8G A;  2R10 A;  5A83 A;  4R7E A;  5HEL A;  3Q2F A;  3FJU B;  3IHP A;  1WUM A;  4UIX A;  5B75 A;  5DYX A;  2YRE A;  2R0Y A;  4Z0R A;  4PS5 A;  4GNE A;  3T7L A;  4NR7 A;  4TT2 A;  5IG6 A;  4A9H A;  2YW5 A;  3U5P A;  4ZUX U;  4IR4 A;  2EGM A;  4BW1 A;  4QSP A;  1DVP A;  5EWD A;  4TYL A;  5EIS A;  1Z2Q A;  2MNY A;  1FP0 A;  3LJU X;  3C6W A;  5ETD A;  2FUI A;  3EB6 A;  2G43 A;  3K2J A;  5FFY A;  1WEW A;  2KGG A;  5IGN A;  3EB5 A;  1JOC A;  4O75 A;  3PHD A;  2KKX A;  5EQ1 A;  5EV9 A;  2MJV B;  4XYA A;  3S92 A;  3UV2 A;  3HCT A;  5II2 A;  5F5Z A;  3KDE C;  4ALH A;  2OWA A;  3D1B A;  4R8P K;  2DVS A;  3T6R A;  3MB4 A;  3RCW A;  4QNS A;  2M1R A;  1IYM A;  4MVT A;  4QSU A;  3P1D A;  3KQI A;  2B0O E;  4F1P A;  5A7C A;  4P5O B;  4N4I A;  5LCW B;  4Q0O A;  1F68 A;  2K1J A;  4S3O C;  4NYW A;  4XY9 A;  5AMF A;  4TS8 A;  2ECI A;  1WEP A;  5I3L A;  3HMH A;  4IR3 A;  2ECT A;  4LKA A;  3LDY A;  4MEO A;  2M3H A;  4N3W A;  4Z1Q A;  2E6S A;  3AQA A;  4IR6 A;  3ERR A;  4A9M A;  4YAD A;  4N4F A;  5J3X A;  5D3H A;  2D8U A;  2VJF B;  4HXK A;  4TTE A;  4XUA A;  2KGI A;  4NRC A;  5DW2 A;  2XP0 A;  3DDT A;  5I80 A;  3PUR A;  4ZC9 A;  5A85 A;  5CRM A;  3SOX A;  5F61 A;  2F42 A;  5LKU A;  5I89 A;  5L97 A;  3O70 A;  5CQT A;  3P1F A;  4PY6 A;  5CY9 A;  2VPG A;  4CCG X;  5FH6 A;  2KIZ A;  2LGG A;  5D24 A;  5CQ3 A;  1WEO A;  4UYG A;  5ENF A;  2L7P A;  5EI4 A;  4MR5 A;  2YUR A;  5SVX A;  3LVR E;  4IC2 A;  2YEK A;  5DLX A;  2JUN A;  4QC3 A;  3KV6 A;  5A81 A;  5TCM A;  3UV5 A;  2DVV A;  3AAD A;  5LKT A;  3VKH A;  2HDP A;  2KFT A;  4IOQ A;  4O71 A;  5D3P A;  4BW4 A;  2M13 A;  4O7E A;  4O62 A;  2MD8 C;  5LJ2 A;  2DX8 A;  2VP7 A;  5B76 A;  4LR6 A;  5LUU A;  5DBM A;  1DCQ A;  4UIY A;  4YYN A;  4YC9 A;  5FBX A;  4HXP A;  5F1L A;  5FFV A;  2JMD A;  4TQN A;  5E9I A;  2KYU A;  5CZG A;  3N9P A;  1WEQ A;  3Q2E A;  4A0C D;  4PCE A;  5KU3 A;  3RPG C;  2WP1 A;  4NUC A;  5LKZ A;  4L58 A;  2DVQ A;  3UW9 A;  3UVY A;  1BOR A;  3LVQ E;  5DKA A;  2L84 A;  5AIU A;  5D3J A;  4NUD A;  3O7A A;  4QR3 A;  3G0L A;  2VJE A;  4LC2 A;  4LYW A;  2FSA A;  5DKC A;  5EWV A;  5IID A;  2G6Q A;  4FK5 A;  3HCU A;  5B8D A;  4O7A A;  4PTB A;  3PUQ A;  3UVW A;  5DW1 A;  4QR4 A;  5KTX A;  5DYA A;  2L0B A;  5B78 A;  3QZV A;  4YYM A;  4A9L A;  2JM3 A;  4FJC A;  4A4C A;  1ZKR A;  4LRG A;  5HQ7 A;  1E6I A;  5KTU A;  2XOY A;  5HRW A;  4QY4 A;  5TAB A;  2Y1M A;  2KTB B;  4UP5 A;  3DQV R;  5A5N A;  5EM3 A;  2D8S A;  1K2F A;  2DVR A;  2OO1 A;  2R0S A;  5EWW A;  2CON A;  2DAT A;  5F60 A;  4Z93 A;  5AME A;  5D0C A;  3M63 A;  4MR4 A;  2IQJ A;  5FE7 A;  4QSQ A;  2HYE D;  4O7F A;  4YYD A;  5BT4 A;  2P57 A;  1MM2 A;  3IU6 A;  3L1Z B;  4Z0O A;  3ZTG A;  5CUB A;  4MR3 A;  5D26 A;  4LLB A;  1E4U A;  2OSS A;  4WIV A;  4A9F A;  2KWJ A;  4Q6F A;  5IBN A;  4UYD A;  2NAA A;  2YW8 A;  2E7O A;  5D3S A;  5FH7 A;  3U5M A;  2E6R A;  5E9Y A;  5D25 A;  2DSM A;  4QEU A;  4Z6I A;  4TT6 A;  5E7D A;  5F25 A;  5H85 A;  2RS9 B;  2WP2 A;  4A9E A;  3M99 A;  2YSM A;  3I2D A;  3O36 A;  4QYD A;  4UYH A;  4J3I A;  5CQA A;  2OXQ C;  3O33 A;  3FL2 A;  1Z6U A;  3FM8 C;  4PCI A;  2D82 A;  5FG6 A;  4Z1S A;  5G05 B;  5LJ1 A;  2VPB A;  5D3T A;  5DFB A;  2MD7 B;  2R0V A;  4WHU A;  4AKH A;  2LAU A;  5H1V A;  2YQM A;  4O7B A;  4TKP B;  4S3O B;  4TZ2 A;  5D1L B;  4MEN A;  1X4J A;  4C67 A;  1CHC A;  5ENE A;  2K17 A;  1VYX A;  2XOC A;  3HCS A;  2LXH C;  2YUC A;  2EGP A;  4BHW A;  5TBN A;  3LQJ A;  1WE9 A;  5G4S A;  2ECG A;  2FD4 A;  2L75 A;  2YU4 A;  5SVI A;  4LYS A;  4A49 A;  4Y03 A;  2RI7 A;  4AKI A;  2CSV A;  5C11 A;  4XI1 A;  3U5N A;  4YBS A;  5HFQ A;  5HCL A;  2QIC A;  2PUY A;  2K4D A;  2F6N A;  3E2D A;  5KH3 A;  5DKD A;  3ZYQ A;  4I7B A;  5A82 A;  2KWO A;  2XB1 A;  3GL6 A;  4MR6 A;  1RMD A;  2MKE A;  5DYC A;  4AP4 A;  4A9K A;  2XOZ A;  4A9N A;  4OUF A;  2VPD A;  4HXO A;  5F62 A;  3PLW A;  4Q0N A;  4O74 A;  4A9I A;  5H1T A;  5FER A;  3LJW A;  1V87 A;  1HYI A;  3I3J A;  1WUG A;  5A5S A;  3H7H A;  4KCX A;  5HM0 A;  2C2L A;  2MT5 A;  3ZNI A;  4XUB A;  3FAN A;  5A5R A;  4I7C A;  3JVL A;  5F63 A;  2EJN A;  1WFK A;  2ECW A;  4N4G A;  3JUE A;  4OGE A;  4LJN A;  1X4I A;  5CQ6 A;  3T9K A;  5SVY A;  4CFL A;  3O35 A;  3GG3 A;  5FFW A;  5HJC A;  4QUU A;  5I83 A;  4IR5 A;  4CUR A;  5CRZ A;  5CUD A;  2ECJ A;  5CU8 A;  3RPG B;  2CSY A;  4BW2 A;  2QJ0 A;  2YYN A;  3U5K A;  5FG5 A;  5FE1 A;  4NR5 A;  5D3N A;  4YYJ A;  4NRA A;  4BW3 A;  4ZDT A;  1X0J A;  5FG4 A;  5ENB A;  2ECV A;  3P5O A;  3HTK C;  2RSD A;  2L43 A;  2EXU A;  5CUC A;  5FE8 A;  4LZ2 A;  4KV1 A;  4QF3 A;  3JVJ A;  4TZ8 A;  4FLP A;  1MM3 A;  5HQ5 A;  2LDR A;  1JM7 A;  4HXM A;  5LVR A;  5EP7 A;  2VPE A;  4AKN A;  5E73 A;  2E61 A;  5IGL A;  3ZVY A;  5TDW A;  4YK0 A;  5K29 A;  4F3I A;  3S91 A;  2Y43 A;  4QC1 A;  3U5O A;  3N9M A;  2RNY A;  5FE0 A;  2GRC A;  4J0R A;  5CQ4 A;  5JWM A;  4HXS A;  4CUP A;  5LJ0 A;  5KH9 A;  5FE5 A;  2MUM A;  2L85 A;  5AD3 A;  1JM7 B;  1WEV A;  3NG2 A;  2CT2 A;  2YEL A;  3MUL A;  3LQI A;  4J1P A;  3UVX A;  5B77 A;  4FIP A;  5L8T A;  4YBT A;  2KKY A;  3HMF A;  4TT4 A;  1Z60 A;  1PUO A;  5EPR A;  5EWH A;  2LXP C;  2QIZ A;  1T1H A;  3MQM A;  3SHB A;  2VJE B;  3C5K A;  5CUE A;  5JI8 A;  4QSW A;  1F62 A;  5TB6 A;  4KV4 A;  2LQ6 A;  2KWK A;  2YHN A;  2KE1 A;  4QSV A;  3SVF A;  3L1X A;  3VK6 A;  4C9Z A;  2LGV A;  4IOO A;  4CL9 A;  3LQH A;  5BT5 A;  2PNX A;  2YSJ A;  4CUQ A;  1G25 A;  4HXR A;  5ENG A;  1WEU A;  5I86 A;  2YQD A;  4YAT A;  3NXB A;  4O64 A;  3Q1D A;  3RTR B;  1X4U A;  5FB0 A;  5FE6 A;  1N87 A;  5C7N A;  2H60 A;  4L7X A;  5TDR A;  1U6G B;  4HBV A;  5EU1 A;  2KRE A;  3N9N A;  5D7X A;  4PKL A;  3DAI A;  5AIT A;  5FE4 A;  4QZS A;  5EA1 A;  4X3G A;  5A5O A;  5EWC A;  2YT5 A;  3D1D A;  4UIW A;  4NS5 A;  1N72 A;  5CGP A;  5DY7 A;  3MB3 A;  5E9L A;  1WEE A;  5HRV A;  5G04 B;  4MEP A;  2JMI A;  4QUT A;  4WHW A;  2LRI C;  2YEM A;  4DON A;  4NRB A;  5DLZ A;  4YYK A;  3G0J A;  5EK9 A;  5HEM A;  4NR9 A;  5IGM A;  2RFJ A;  1WEM A;  2CRR A;  4HBW A;  3DPL R;  5CS8 A;  3FKM X;  4O72 A;  5F2P A;  3IU5 A;  5CPE A;  4FO9 A;  4WZ3 B;  4YH3 A;  2YVR A;  2YQL A;  4NQM A;  2RO1 A;  5II1 A;  1WES A;  5FE3 A;  4XY8 A;  5EYA F;  4F52 B;  2L80 A;  4GND A;  4QSR A;  5EVA A;  4V3L C;  1HYJ A;  5LKX A;  4PPE A;  4Z6H A;  2IDA A;  2F6J A;  2FFW A;  4CA1 A;  5L99 A;  2E7N A;  4V3K C;  4HBX A;  4I7D A;  4QYL A;  3ONI A; 
#chains in the Genus database with same CATH homology
 3L11 A;  5E9M A;  5E9K A;  5G0F A;  4QSX A;  4QSS A;  2UZG A;  5D1M B;  5ETB A;  4NN2 A;  4UIV A;  4IC3 A;  5LVQ A;  2MA6 A;  4ZW1 A;  3P1C A;  4LYI A;  4B7Y C;  4RVR A;  5CQ7 A;  1WIM A;  4A9J A;  2ECN A;  3MUK A;  4QBM A;  3N9Q A;  3ZVZ B;  4TU4 A;  4O70 A;  4CUS A;  5CUA A;  4LK9 A;  5DYU A;  3SOU A;  5ENH A;  5DX4 A;  4NR4 A;  2VNF A;  4UYF A;  3N9O A;  4ALG A;  1EQF A;  2I7K A;  4NYX A;  5CFW A;  4CUU A;  4QR5 A;  5FE2 A;  4LAD B;  4P5O B;  3SOW A;  2M6M A;  4A9O A;  5C4Q A;  2DWW A;  5COI A;  2EOD A;  5HRX A;  4B86 C;  5ENI A;  2NXB A;  5BT3 A;  2OUO A;  2BAY A;  5FDZ A;  2RNW A;  2N9G A;  3MXF A;  5F3A A;  2MIQ A;  5A5P A;  5C87 A;  5G4R A;  3UVD A;  2VJF A;  4UIZ A;  5L96 A;  5H1U A;  5KTW A;  4UYF B;  4GB0 A;  5D1K B;  5FE9 A;  5C85 A;  4YY6 A;  4CLB A;  1LDJ B;  3P1E A;  4QEW A;  5F36 A;  3M62 A;  5EGU A;  4YYG A;  5HLS A;  4NR8 A;  4IOR A;  2AN6 A;  5L8U A;  4HXL A;  4LZR A;  2YDW A;  5C89 A;  1VD4 A;  1XWH A;  2KWN A;  2YHO A;  4J0S A;  3TLP A;  4AYC A;  4BBQ A;  5AD2 A;  5ENC A;  4NYV A;  2L5U A;  2G4A A;  4NXJ A;  5E74 A;  5I40 A;  1JSP B;  4UI9 B;  3JVM A;  4QB3 A;  1VFY A;  2ZET C;  2MA5 A;  4O7C A;  4CFK A;  1ZS5 A;  3ZPV 1;  2JRJ A;  2I50 A;  2KU3 A;  2DKW A;  3ASL A;  3N9L A;  3O34 A;  5CQ8 A;  5D3R A;  4YY4 A;  2C2V S;  2M85 A;  2MNZ A;  2LGL A;  4C66 A;  4AYC B;  5C13 A;  4GNF A;  4A4B A;  2Y1N A;  4LZS A;  5I1Q A;  3ZPV E;  2I8N A;  5CQ5 A;  3JVK A;  5CUG A;  4YH4 A;  5FH8 A;  4YYH A;  4W4U A;  5CP5 A;  5HFR A;  3SVH A;  1FBV A;  3ZYU A;  3KNV A;  5DIN A;  4TU6 A;  2E3K A;  5EIC A;  5KO4 A;  3U5J A;  4AUQ B;  2L5E A;  2LSP B;  3D7C A;  4NR6 A;  5L98 A;  5IGK A;  2FUU A;  3QZT A;  5I88 A;  4QEV A;  3QZS A;  5JG6 A;  3MHH A;  5H9M A;  1ZBD B;  4WZ2 A;  5FB1 A;  5HQ6 A;  4MEQ A;  4OGJ A;  5E0R A;  4YYI A;  2XEU A;  5CTL A;  4NUE A;  5D3L A;  5TRB A;  2EA6 A;  3SVG A;  4ZQL A;  5E3D A;  5F1H A;  5B79 A;  5EPS A;  3LRQ A;  1WEN A;  2D9E A;  5EPB A;  2JMJ A;  2LN0 A;  5DFC A;  2K16 A;  2CSZ A;  4MSX A;  4WA6 A;  4WZ0 A;  4QF2 A;  1JM4 B;  4GNG A;  4UIT A;  4QST A;  1LDK C;  3GV4 A;  4BJX A;  5I7Y A;  5E3G A;  5FEY A;  5KH7 A;  5J0D A;  3MHS A;  4YAX A;  2CKL A;  4X2I A;  4CUT A;  5HEN A;  3LXJ A;  4HXN A;  4HBY A;  4O78 A;  2LGK A;  4GPJ A;  4N4H A;  1WIL A;  2H0D A;  5ACY A;  3U5L A;  5DFD A;  3V43 A;  4R2Y A;  2KR4 A;  3UV4 A;  5E9V A;  1WGM A;  4O76 A;  5KHM A;  2LV9 A;  3KV5 A;  2CKL B;  2G45 A;  4NQN A;  5I7X A;  3DWY A;  5I29 A;  2RNX A;  4E96 A;  4O77 A;  4UIU A;  4UYE A;  2H0D B;  2YYR A;  4OGI A;  4YBM A;  4YAB A;  4AVX A;  4UP0 A;  5ENJ A;  4LDF A;  5DKH A;  3HME A;  5A5Q A;  3O37 A;  5C8G A;  2R10 A;  5A83 A;  4R7E A;  5HEL A;  3Q2F A;  3IHP A;  1WUM A;  4UIX A;  5B75 A;  5DYX A;  2YRE A;  2R0Y A;  4PS5 A;  4GNE A;  3T7L A;  4NR7 A;  4TT2 A;  5IG6 A;  4A9H A;  2YW5 A;  3U5P A;  4ZUX U;  4IR4 A;  4BW1 A;  4QSP A;  1DVP A;  5EWD A;  4TYL A;  5EIS A;  1Z2Q A;  2MNY A;  1FP0 A;  3C6W A;  5ETD A;  2FUI A;  3EB6 A;  2G43 A;  3K2J A;  5FFY A;  1WEW A;  2KGG A;  5IGN A;  3EB5 A;  1JOC A;  4O75 A;  3PHD A;  5EQ1 A;  5EV9 A;  2MJV B;  4XYA A;  3S92 A;  3UV2 A;  3HCT A;  5II2 A;  5F5Z A;  4ALH A;  4R8P K;  2DVS A;  3T6R A;  3MB4 A;  3RCW A;  4QNS A;  2M1R A;  1IYM A;  4MVT A;  4QSU A;  3P1D A;  3KQI A;  5A7C A;  4N4I A;  5LCW B;  4Q0O A;  1F68 A;  2K1J A;  4S3O C;  4NYW A;  4XY9 A;  5AMF A;  4TS8 A;  2ECI A;  1WEP A;  5I3L A;  3HMH A;  4IR3 A;  2ECT A;  4LKA A;  4MEO A;  2M3H A;  4N3W A;  4Z1Q A;  2E6S A;  3AQA A;  4IR6 A;  4A9M A;  4YAD A;  4N4F A;  5J3X A;  5D3H A;  2VJF B;  4HXK A;  4TTE A;  4XUA A;  2KGI A;  4NRC A;  5DW2 A;  5I80 A;  3PUR A;  4ZC9 A;  5A85 A;  5CRM A;  3SOX A;  5F61 A;  2F42 A;  5LKU A;  5I89 A;  5L97 A;  3O70 A;  5CQT A;  3P1F A;  4PY6 A;  5CY9 A;  2VPG A;  4CCG X;  5FH6 A;  2KIZ A;  2LGG A;  5D24 A;  5CQ3 A;  1WEO A;  4UYG A;  5ENF A;  5EI4 A;  4MR5 A;  2YUR A;  4IC2 A;  2YEK A;  5DLX A;  4QC3 A;  3KV6 A;  5A81 A;  5TCM A;  3UV5 A;  2DVV A;  3AAD A;  5LKT A;  2HDP A;  2KFT A;  4IOQ A;  4O71 A;  5D3P A;  4BW4 A;  2MD8 C;  4O7E A;  5LJ2 A;  2DX8 A;  2VP7 A;  5B76 A;  4LR6 A;  5LUU A;  5DBM A;  4UIY A;  4YYN A;  4YC9 A;  5FBX A;  4HXP A;  5F1L A;  5FFV A;  2JMD A;  4TQN A;  5E9I A;  2KYU A;  5CZG A;  3N9P A;  1WEQ A;  3Q2E A;  4A0C D;  4PCE A;  5KU3 A;  3RPG C;  2WP1 A;  4NUC A;  5LKZ A;  4L58 A;  2DVQ A;  3UW9 A;  3UVY A;  1BOR A;  5DKA A;  2L84 A;  5AIU A;  5D3J A;  4NUD A;  3O7A A;  4QR3 A;  3G0L A;  2VJE A;  4LC2 A;  4LYW A;  2FSA A;  5DKC A;  5EWV A;  5IID A;  2G6Q A;  4FK5 A;  3HCU A;  5B8D A;  4O7A A;  4PTB A;  3PUQ A;  3UVW A;  5DW1 A;  4QR4 A;  5KTX A;  5DYA A;  2L0B A;  5B78 A;  3QZV A;  4YYM A;  4A9L A;  4FJC A;  4A4C A;  4LRG A;  5HQ7 A;  5KTU A;  1E6I A;  5HRW A;  4QY4 A;  5TAB A;  2Y1M A;  2KTB B;  4UP5 A;  3DQV R;  5A5N A;  5EM3 A;  2D8S A;  1K2F A;  2DVR A;  2OO1 A;  2R0S A;  5EWW A;  2DAT A;  5F60 A;  4Z93 A;  5AME A;  5D0C A;  3M63 A;  4MR4 A;  5FE7 A;  4QSQ A;  2HYE D;  4O7F A;  4YYD A;  5BT4 A;  3L1Z B;  1MM2 A;  3IU6 A;  3ZTG A;  5CUB A;  4MR3 A;  5D26 A;  4LLB A;  1E4U A;  2OSS A;  4WIV A;  4A9F A;  2KWJ A;  4Q6F A;  5IBN A;  4UYD A;  2NAA A;  2YW8 A;  2E7O A;  5D3S A;  5FH7 A;  3U5M A;  2E6R A;  5E9Y A;  5D25 A;  4QEU A;  4Z6I A;  4TT6 A;  5E7D A;  5F25 A;  5H85 A;  2RS9 B;  2WP2 A;  4A9E A;  3M99 A;  2YSM A;  3I2D A;  3O36 A;  4QYD A;  4UYH A;  4J3I A;  5CQA A;  2OXQ C;  3O33 A;  3FL2 A;  1Z6U A;  4PCI A;  2D82 A;  5FG6 A;  4Z1S A;  5G05 B;  5LJ1 A;  2VPB A;  5D3T A;  5DFB A;  2MD7 B;  2R0V A;  4WHU A;  2YQM A;  5H1V A;  4TKP B;  4O7B A;  4S3O B;  4TZ2 A;  5D1L B;  4MEN A;  1X4J A;  4C67 A;  1CHC A;  5ENE A;  2K17 A;  1VYX A;  3HCS A;  2LXH C;  2YUC A;  2EGP A;  4BHW A;  5TBN A;  3LQJ A;  1WE9 A;  5G4S A;  2ECG A;  2YU4 A;  2L75 A;  4LYS A;  4A49 A;  4Y03 A;  2RI7 A;  5C11 A;  4XI1 A;  3U5N A;  4YBS A;  5HFQ A;  5HCL A;  2QIC A;  2PUY A;  2K4D A;  2F6N A;  5KH3 A;  5DKD A;  3ZYQ A;  4I7B A;  5A82 A;  2KWO A;  2XB1 A;  3GL6 A;  4MR6 A;  1RMD A;  5DYC A;  4AP4 A;  4A9K A;  4A9N A;  4OUF A;  2VPD A;  4HXO A;  5F62 A;  4Q0N A;  4O74 A;  4A9I A;  5H1T A;  5FER A;  3LJW A;  1V87 A;  1HYI A;  3I3J A;  1WUG A;  5A5S A;  4KCX A;  5HM0 A;  2C2L A;  2MT5 A;  3ZNI A;  4XUB A;  5A5R A;  4I7C A;  3JVL A;  5F63 A;  1WFK A;  2ECW A;  4N4G A;  4LJN A;  1X4I A;  5CQ6 A;  4CFL A;  3O35 A;  3GG3 A;  5FFW A;  5HJC A;  4QUU A;  5I83 A;  4IR5 A;  4CUR A;  5CRZ A;  5CUD A;  2ECJ A;  5CU8 A;  3RPG B;  2CSY A;  4BW2 A;  2QJ0 A;  2YYN A;  3U5K A;  5FG5 A;  5FE1 A;  4NR5 A;  5D3N A;  4YYJ A;  4NRA A;  4BW3 A;  4ZDT A;  1X0J A;  5FG4 A;  5ENB A;  2ECV A;  3P5O A;  3HTK C;  2RSD A;  2L43 A;  5CUC A;  5FE8 A;  4LZ2 A;  4KV1 A;  4QF3 A;  3JVJ A;  4TZ8 A;  4FLP A;  1MM3 A;  5HQ5 A;  2LDR A;  1JM7 A;  4HXM A;  5LVR A;  5EP7 A;  2VPE A;  4AKN A;  5E73 A;  5IGL A;  3ZVY A;  5TDW A;  4YK0 A;  5K29 A;  4F3I A;  3S91 A;  2Y43 A;  4QC1 A;  3U5O A;  3N9M A;  2RNY A;  5FE0 A;  2GRC A;  4J0R A;  5CQ4 A;  5JWM A;  4HXS A;  4CUP A;  5LJ0 A;  5KH9 A;  5FE5 A;  2MUM A;  2L85 A;  5AD3 A;  1JM7 B;  1WEV A;  3NG2 A;  2CT2 A;  2YEL A;  3MUL A;  3LQI A;  4J1P A;  3UVX A;  5B77 A;  4FIP A;  5L8T A;  4YBT A;  3HMF A;  4TT4 A;  1Z60 A;  5EPR A;  5EWH A;  2LXP C;  2QIZ A;  1T1H A;  3MQM A;  3SHB A;  2VJE B;  3C5K A;  5CUE A;  5JI8 A;  4QSW A;  1F62 A;  5TB6 A;  4KV4 A;  2LQ6 A;  2KWK A;  2YHN A;  2KE1 A;  4QSV A;  3SVF A;  3L1X A;  3VK6 A;  4C9Z A;  2LGV A;  4IOO A;  4CL9 A;  3LQH A;  5BT5 A;  2PNX A;  2YSJ A;  4CUQ A;  1G25 A;  4HXR A;  5ENG A;  1WEU A;  5I86 A;  2YQD A;  4YAT A;  3NXB A;  4O64 A;  3RTR B;  1X4U A;  5FB0 A;  5FE6 A;  1N87 A;  5C7N A;  2H60 A;  4L7X A;  5TDR A;  1U6G B;  4HBV A;  5EU1 A;  2KRE A;  3N9N A;  5D7X A;  4PKL A;  3DAI A;  5AIT A;  5FE4 A;  4QZS A;  5EA1 A;  4X3G A;  5A5O A;  5EWC A;  2YT5 A;  4UIW A;  4NS5 A;  1N72 A;  5CGP A;  5DY7 A;  3MB3 A;  5E9L A;  1WEE A;  5HRV A;  5G04 B;  4MEP A;  2JMI A;  4QUT A;  4WHW A;  2LRI C;  2YEM A;  4DON A;  4NRB A;  5DLZ A;  4YYK A;  3G0J A;  5EK9 A;  5HEM A;  4NR9 A;  5IGM A;  2RFJ A;  1WEM A;  4HBW A;  3DPL R;  5CS8 A;  3FKM X;  4O72 A;  5F2P A;  3IU5 A;  5CPE A;  4FO9 A;  4WZ3 B;  4YH3 A;  2YQL A;  4NQM A;  2RO1 A;  5II1 A;  1WES A;  5FE3 A;  4XY8 A;  5EYA F;  4F52 B;  2L80 A;  4GND A;  4QSR A;  5EVA A;  4V3L C;  1HYJ A;  5LKX A;  4PPE A;  4Z6H A;  2IDA A;  2F6J A;  4CA1 A;  5L99 A;  2E7N A;  4V3K C;  4HBX A;  4I7D A;  4QYL A;  3ONI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...