2F6JA

Crystal structure of phd finger-linker-bromodomain fragment of human bptf in the h3(1-15)k4me3 bound state
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
168
structure length
168
Chain Sequence
DTKLYCICKTPYDESKFYIGCDRCQNWYHGRCVGILQSEAELIDEYVCPQCQSTEDAMTVLTPLTEKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLATMEERVQRRYYEKLTEFVADMTKIFDNCRYYNPSDSPFYQCAEVLESFFVQKLKGFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords bromodomain PHD finger transcription factor
publication title Molecular basis for site-specific read-out of histone H3K4me3 by the BPTF PHD finger of NURF.
pubmed doi rcsb
source organism Homo sapiens
total genus 49
structure length 168
sequence length 168
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2f6jA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2f6jA01
2D82A 4UYDA 4YK0A 2LGKA 3I2DA 2L5EA 2LXPC 5H1VA 5DFDA 3RCWA 5I86A 2KREA 4Z6HA 4WHUA 5CQ8A 5EU1A 5C4QA 2G43A 4TKPB 5E9MA 2YUCA 5ENCA 3IU6A 4PCEA 4HXPA 5II2A 5I89A 5LUUA 5DYUA 1MM3A 3QZVA 5B78A 3SOUA 2FUIA 4LADB 2VNFA 2D8SA 1N72A 2YQMA 5EI4A 5BT4A 1WFKA 2ECVA 1WILA 5HENA 4AP4A 3UVYA 4J3IA 4I7CA 1V87A 3EB5A 2DVQA 5FE2A 5CQ6A 5CUBA 2MNZA 4IOOA 4OGJA 4LDFA 4IR3A 3ZNIA 2ECJA 2LN0A 4UIZA 5LJ1A 4YYMA 5DLXA 3HCUA 5AMEA 2DATA 5TB6A 2NXBA 2RO1A 3HMFA 4LC2A 5I80A 5F3AA 3V43A 5E9KA 3MQMA 1WEWA 4TT6A 4X2IA 5E3GA 4YYGA 4NRAA 3N9NA 4HXKA 4MENA 3P1EA 5LKTA 4C67A 5I7YA 3KV6A 5DKAA 4IR4A 2JMDA 2LRIC 4A9MA 4B86C 4C9ZA 4NN2A 5F5ZA 4YAXA 5CRZA 4N4IA 5KH3A 3U5MA 3AADA 4BW1A 1T1HA 4TS8A 2LQ6A 4NS5A 4O70A 1FP0A 5ENIA 3LQHA 5DY7A 2ECNA 3MHSA 5LKZA 2KE1A 4CUPA 3N9QA 3SVGA 3LQIA 4MEOA 2Y1NA 5CFWA 5E73A 4UYFB 4J0RA 3JVMA 4PKLA 2K17A 2GRCA 4Z1SA 2KGIA 4YADA 4CURA 5EWWA 4MEQA 4LRGA 2L75A 5D0CA 5ACYA 3D7CA 4NYXA 4UYGA 4N4HA 2KWNA 3FKMX 3ZTGA 5IGLA 5E0RA 3O33A 4HXNA 4UYFA 1DVPA 2UZGA 1E4UA 2HYED 3K2JA 3UVDA 4TQNA 5FH6A 5B77A 3HMHA 5IGNA 4NR8A 5ENGA 5LVQA 2L0BA 5B8DA 3U5KA 5H1TA 5D24A 4L58A 4N4GA 4MR3A 2C2VS 1ZS5A 5FFYA 5B76A 3ZYUA 2HDPA 1U6GB 5C8GA 4LK9A 5EGUA 3QZTA 5E9YA 2M1RA 5HRVA 5ENEA 3GV4A 5F63A 3DAIA 4UYEA 4CUQA 2CSZA 2E6SA 2KU3A 4HBYA 4ZW1A 5L8UA 4QSQA 4OGIA 4UIWA 2LV9A 4IC2A 5E9LA 3LRQA 5D3HA 1XWHA 5AMFA 2MUMA 1WEUA 4UP5A 5F1HA 5H1UA 4UYHA 5CS8A 4TZ2A 4FIPA 4X3GA 5TABA 1WE9A 4TYLA 5EVAA 5I1QA 4WZ3B 5EWCA 3P1DA 2BAYA 5CQAA 3O37A 5CUDA 4NR9A 2YT5A 3HMEA 4A9KA 5D1LB 4TZ8A 4Q0NA 4YH3A 1F68A 4NQNA 4I7DA 4PPEA 4LLBA 4N3WA 4YH4A 4HBXA 4A9IA 5A5QA 4W4UA 5F1LA 4L7XA 1MM2A 2VPEA 4O74A 5AIUA 3T7LA 4YYIA 5I29A 2F6NA 5D7XA 5CQ4A 5IGMA 4QY4A 4FO9A 5FE8A 3N9PA 4ALHA 5C87A 1FBVA 2LDRA 3SOXA 3MB4A 3U5NA 5HEMA 1VYXA 2KIZA 5JWMA 4QF3A 4WHWA 2MA6A 5FE9A 1WUGA 4UITA 5CQ5A 4I7BA 2YYRA 3ZPVE 5HCLA 5FH8A 5A5OA 5CRMA 2PNXA 4Z1QA 2ECTA 1JM4B 5KTXA 2JMIA 3UW9A 2LGVA 4BW4A 1Z6UA 5FE4A 5CUCA 5D3NA 5L97A 3L1XA 5A5NA 5JI8A 5E74A 4C66A 3KV5A 1WEPA 2K16A 5FE7A 2YQLA 4IR6A 5E3DA 1N87A 4O7FA 4KCXA 2WP1A 5I88A 4WZ0A 5F60A 4QR4A 1WEEA 2N9GA 4LR6A 2YW8A 2XB1A 2WP2A 2VJEB 4MR4A 5A5PA 2EGPA 2FSAA 5D3SA 2DX8A 2H0DB 2JMJA 5C89A 3HCSA 2EODA 1EQFA 3MXFA 5D1MB 2QIZA 2D9EA 1RMDA 5TBNA 5F61A 5I7XA 3O34A 5H9MA 2AN6A 4AUQB 4UP0A 5DKDA 2L43A 5CP5A 5L98A 4HXSA 2I7KA 5FE0A 2OXQC 5I83A 4O71A 2H0DA 1IYMA 4MEPA 2YEKA 4TTEA 5DINA 5C13A 4Y03A 2LGLA 2DVRA 2R0YA 3P1CA 4HXRA 4BW2A 5L99A 5G05B 5K29A 4XI1A 4QSTA 2E6RA 5DKCA 2E3KA 3S92A 5A83A 4YBMA 1E6IA 5IBNA 4NUCA 5C7NA 4NR7A 3ZVYA 2YU4A 3MHHA 4UIXA 1JOCA 4B7YC 5CGPA 4O76A 5BT3A 2YELA 4FJCA 4QSRA 4NR5A 2Y43A 5IGKA 4O75A 5EWDA 4A9OA 3FL2A 4ZUXU 5FG5A 5G4RA 1WGMA 5D3TA 3NXBA 5DFBA 4YY4A 5TRBA 5FG4A 2MNYA 3UV2A 4YBTA 2C2LA 4XY9A 5DYAA 4XYAA 5D1KB 4A49A 3SVFA 4O7EA 4KV4A 4UIVA 5CTLA 2L5UA 4QYLA 4XUBA 1F62A 5FBXA 4R7EA 5CUGA 5HQ7A 5KO4A 3MUKA 1BORA 5LVRA 4YYJA 2DWWA 3C5KA 5FFWA 5KHMA 4QB3A 4AYCB 4NR4A 4QSXA 2M85A 3Q2FA 5ETDA 4YYDA 5F2PA 5DFCA 2YURA 2XEUA 4QEWA 2EA6A 4PCIA 5E9IA 4GB0A 3N9MA 4QBMA 1WEVA 4S3OC 4LZ2A 3IU5A 4O7AA 5CU8A 4YY6A 4PTBA 2L85A 4ZDTA 5A7CA 4NRCA 4QSSA 2G4AA 4AYCA 5CPEA 3T6RA 2E7NA 5L8TA 3DPLR 4IOQA 4GNDA 2FUUA 2MD7B 4FK5A 5A5RA 2RI7A 3U5OA 3N9OA 4NUEA 4CCGX 4BW3A 5HM0A 4R8PK 3LQJA 3KNVA 4Q6FA 3SHBA 1G25A 2RNXA 5L96A 5DKHA 5HFQA 5FERA 4KV1A 5HLSA 4V3LC 5C11A 4IC3A 2M3HA 4YABA 5EP7A 3GL6A 4O7BA 2YW5A 2K1JA 4NRBA 4CUSA 2I8NA 4UIUA 5KTUA 4ALGA 4DONA 2LXHC 1WENA 2CSYA 1WUMA 5B79A 4QUTA 5B75A 2KYUA 5FE1A 2YDWA 5D26A 5ETBA 3U5LA 4MR5A 4OUFA 4NYWA 3MB3A 5AD2A 1CHCA 1Z2QA 5KTWA 5CQTA 5DW2A 5D3RA 2KWKA 4Q0OA 1X4IA 4QEUA 5EICA 5CQ7A 2YSMA 5LKUA 5A5SA 4TU4A 2NAAA 2MT5A 2ECWA 4QR3A 3M62A 2DVSA 1X4JA 5KH9A 5DX4A 3MULA 4HXLA 3UVXA 4CFLA 5FB1A 2QJ0A 5LCWB 5A82A 2RNYA 3Q2EA 2IDAA 2G45A 4QSVA 4F52B 4NXJA 2G6QA 4GNFA 4A9LA 5F62A 4LJNA 1X4UA 4WIVA 5D3LA 4GPJA 3HTKC 1X0JA 4AVXA 2R0VA 3L1ZB 3QZSA 1HYJA 5IG6A 5HRWA 2DKWA 4QEVA 3JVJA 2F42A 1HYIA 4PS5A 2CKLB 3PHDA 5CZGA 4P5OB 2KWJA 1WEQA 2JRJA 4O78A 2VPGA 2R10A 4IORA 3LJWA 5EPBA 2ECGA 2I50A 3G0LA 4CFKA 4QZSA 3P5OA 4QSWA 5DLZA 1K2FA 4J0SA 5CUAA 2VPBA 5FG6A 4AKNA 3DWYA 2CKLA 2E7OA 3AQAA 5EK9A 5CUEA 4CLBA 4GNEA 4QC1A 5EISA 5LJ2A 5FEYA 2VJEA 4A9JA 2ZETC 5FDZA 2VPDA 2MD8C 2DVVA 4MR6A 2CT2A 5FH7A 4LZSA 4CUUA 5CY9A 3C6WA 2M6MA 4IR5A 2LGGA 4LKAA 4A4CA 5HRXA 3O70A 1WESA 3M99A 3PURA 5G04B 3RPGB 5DBMA 5EA1A 4MVTA 4BJXA 4F3IA 2K4DA 3EB6A 2MIQA 1JM7B 3UV5A 5D3PA 2ECIA 5JG6A 1Z60A 3RTRB 4LYIA 5FFVA 5I40A 3UV4A 4QSUA 3O7AA 3P1FA 4LYSA 4LZRA 4TT4A 3G0JA 2KTBB 4PY6A 2RNWA 5D25A 2KGGA 2YHNA 1LDKC 4A9FA 4J1PA 3L11A 3NG2A 4UI9B 2F6JA 2OSSA 4YC9A 4QYDA 2PUYA 3ZYQA 4QNSA 4Z6IA 3SVHA 1WEMA 3U5JA 4A9EA 2L80A 1ZBDB 4S3OB 5TDWA 1JM7A 4TT2A 1VFYA 2MA5A 3LXJA 3ASLA 3GG3A 3I3JA 3S91A 2RFJA 3JVKA 5FE6A 4CUTA 5KU3A 2YSJA 3ONIA 3PUQA 5LKXA 2VJFB 3M63A 3RPGC 5J0DA 4O77A 5DW1A 5EPRA 5E9VA 5G4SA 3HCTA 2QICA 5AD3A 3IHPA 1LDJB 2MJVB 5F25A 5HJCA 4QF2A 5G0FA 5IIDA 4O7CA 1JSPB 1WEOA 4HBWA 2VJFA 5EV9A 4TU6A 2YREA 4LYWA 5ENBA 2KR4A 4CL9A 4YBSA 5DYXA 4A9NA 5J3XA 4A9HA 5FB0A 4HBVA 5H85A 2KWOA 4A4BA 2RS9B 2OUOA 4V3KC 5D3JA 5EWVA 4R2YA 5AITA 4NQMA 4NUDA 2YHOA 4NYVA 2LSPB 3KQIA 2YEMA 4QC3A 4QR5A 5I3LA 4HXOA 5FE5A 4QSPA 1WIMA 4N4FA 5HQ5A 3N9LA 4A0CD 5KH7A 3ZVZB 5ENHA 5C85A 5LJ0A 2H60A 2YQDA 4XY8A 3VK6A 2Y1MA 4XUAA 2KFTA 4ZC9A 5ENFA 5CQ3A 5E7DA 5F36A 2RSDA 4CA1A 5HELA 5EPSA 2YYNA 4BBQA 5COIA 5EM3A 4RVRA 4Z93A 4FLPA 3JVLA 3U5PA 5HFRA 5EWHA 4ZQLA 4QUUA 3DQVR 5TDRA 4WZ2A 5HQ6A 4O72A 2L84A 4E96A 3O36A 5TCMA 2OO1A 4NR6A 5ENJA 3O35A 5FE3A 5A85A 3UVWA 4MSXA 4YATA 4YYKA 3TLPA 5EYAF 4YYHA 2VP7A 3ZPV1 5BT5A 4WA6A 5A81A 4UIYA 5II1A 5DYCA 4HXMA 4YYNA 4O64A 5EQ1A 3SOWA 1VD4A 4GNGA 2R0SA 4BHWA
chains in the Genus database with same CATH superfamily
2D82A 4UYDA 4YK0A 2LGKA 3I2DA 2L5EA 2LXPC 5H1VA 5DFDA 3RCWA 5I86A 2KREA 3DDTA 4Z6HA 4WHUA 5CQ8A 5EU1A 5C4QA 2G43A 2D8UA 4TKPB 5E9MA 2YUCA 5ENCA 3IU6A 4PCEA 4HXPA 5II2A 5I89A 5LUUA 5DYUA 1MM3A 3QZVA 5B78A 3SOUA 2FUIA 4LADB 2VNFA 2D8SA 1N72A 2YQMA 4Z0RA 5EI4A 5BT4A 1WFKA 2ECVA 1WILA 5HENA 4AP4A 3UVYA 4J3IA 4I7CA 3T9KA 1V87A 3EB5A 2DVQA 5FE2A 5CQ6A 5CUBA 2MNZA 4IOOA 4OGJA 4LDFA 4IR3A 3ZNIA 2ECJA 2DJAA 2LN0A 4UIZA 5LJ1A 4YYMA 5DLXA 3HCUA 5AMEA 2DATA 5TB6A 3LVRE 2NXBA 2RO1A 3HMFA 4LC2A 5I80A 5F3AA 3V43A 5E9KA 3MQMA 1WEWA 4TT6A 4X2IA 3DWDA 5E3GA 4YYGA 4NRAA 3FM8C 3N9NA 1PUOA 4HXKA 4MENA 3P1EA 5LKTA 4C67A 5I7YA 3KV6A 5DKAA 4IR4A 2JMDA 2LRIC 4A9MA 4B86C 4C9ZA 4NN2A 5F5ZA 4YAXA 5CRZA 4N4IA 5KH3A 3U5MA 3AADA 4BW1A 1T1HA 4TS8A 2LQ6A 4NS5A 4O70A 1FP0A 3JUEA 5ENIA 3LQHA 5DY7A 3H7HA 2ECNA 3MHSA 5LKZA 4AKHA 4CUPA 2KE1A 3N9QA 3SVGA 3LQIA 4MEOA 2Y1NA 5CFWA 5E73A 2P57A 4UYFB 4J0RA 3JVMA 4PKLA 2K17A 2GRCA 4Z1SA 2KGIA 4YADA 4CURA 5EWWA 4MEQA 4LRGA 2L75A 5D0CA 5ACYA 3D7CA 4NYXA 4UYGA 4N4HA 2KWNA 3FKMX 3ZTGA 5IGLA 2EGMA 5E0RA 3O33A 4HXNA 4UYFA 1DVPA 2UZGA 1E4UA 2HYED 3K2JA 3UVDA 4TQNA 5FH6A 5B77A 3HMHA 5IGNA 4NR8A 5ENGA 5LVQA 2L0BA 5B8DA 3U5KA 5H1TA 5D24A 4L58A 4N4GA 4MR3A 2C2VS 1ZS5A 4OGCA 5FFYA 2CSVA 3ZYUA 2HDPA 1U6GB 5C8GA 4LK9A 5B76A 5EGUA 3QZTA 5E9YA 4AKIA 2M1RA 5HRVA 3LJUX 5ENEA 3GV4A 5F63A 3DAIA 4UYEA 4CUQA 2CSZA 2E6SA 2KU3A 4HBYA 4ZW1A 5L8UA 4QSQA 4OGIA 4UIWA 2LV9A 4IC2A 5E9LA 3LRQA 5D3HA 1XWHA 5AMFA 2MUMA 1WEUA 4UP5A 5F1HA 5H1UA 4UYHA 5CS8A 4TZ2A 4FIPA 4X3GA 5TABA 3M7KA 4AKGA 3FEHA 1WE9A 4TYLA 5EVAA 5I1QA 4WZ3B 5EWCA 3P1DA 2JM3A 2BAYA 5CQAA 3O37A 5CUDA 4NR9A 2YT5A 3HMEA 4A9KA 5D1LB 5SVXA 4TZ8A 4Q0NA 4YH3A 1F68A 4NQNA 3FAOA 4I7DA 4PPEA 4LLBA 4N3WA 4YH4A 4HBXA 4A9IA 5A5QA 4W4UA 5F1LA 4L7XA 1MM2A 2VPEA 4O62A 4O74A 5AIUA 3T7LA 4YYIA 5I29A 2F6NA 5D7XA 5CQ4A 5IGMA 4QY4A 4FO9A 5FE8A 3N9PA 4ALHA 5C87A 1FBVA 2LDRA 3SOXA 3MB4A 3U5NA 5HEMA 1VYXA 2KIZA 5JWMA 4QF3A 4WHWA 2MA6A 5FE9A 1WUGA 4UITA 5CQ5A 4I7BA 2YYRA 3ZPVE 5HCLA 5FH8A 5A5OA 5CRMA 2PNXA 4Z1QA 2ECTA 1JM4B 5KTXA 2JMIA 3UW9A 2LGVA 4BW4A 1Z6UA 5FE4A 5CUCA 5D3NA 5L97A 3L1XA 5A5NA 5JI8A 5E74A 4C66A 3KV5A 1WEPA 2RR4A 2K16A 5FE7A 2YQLA 3ERRA 4IR6A 5E3DA 1N87A 4O7FA 4KCXA 2WP1A 5I88A 4WZ0A 2EXUA 5F60A 4QR4A 1WEEA 2N9GA 4LR6A 2FD4A 2YW8A 4QQ4A 2XB1A 2WP2A 2VJEB 4MR4A 5A5PA 2EGPA 2FSAA 5D3SA 2DX8A 2E61A 2H0DB 2JMJA 5C89A 3HCSA 2EODA 1EQFA 3MXFA 5D1MB 2QIZA 2D9EA 1RMDA 5TBNA 5F61A 5I7XA 3O34A 5H9MA 2AN6A 4AUQB 5K3QA 4UP0A 5DKDA 2L43A 5CP5A 5L98A 4HXSA 2I7KA 5FE0A 2OXQC 5I83A 4O71A 2H0DA 1IYMA 4MEPA 2YEKA 4TTEA 5DINA 5C13A 4Y03A 2L7PA 2LGLA 2DVRA 2R0YA 3P1CA 4HXRA 4BW2A 5L99A 5G05B 2CRRA 5K29A 4XI1A 3D1BA 4QSTA 2E6RA 5DKCA 2E3KA 3S92A 2YVRA 5A83A 4YBMA 1E6IA 5IBNA 4NUCA 5C7NA 4NR7A 3ZVYA 2YU4A 3MHHA 4UIXA 1JOCA 2B0OE 4B7YC 5CGPA 4O76A 5BT3A 2YELA 4FJCA 4QSRA 4NR5A 2Y43A 5IGKA 4O75A 5EWDA 4A9OA 1MBMA 3FL2A 4ZUXU 3VKGA 5FG5A 5G4RA 1WGMA 5D3TA 3NXBA 5DFBA 4YY4A 3PLWA 5TRBA 5FG4A 2MNYA 3UV2A 4YBTA 2DSMA 2C2LA 4XY9A 5DYAA 4H9DA 5SVYA 4XYAA 5D1KB 4A49A 3SVFA 4O7EA 4KV4A 4UIVA 5CTLA 2L5UA 4QYLA 4XUBA 1F62A 5FBXA 4R7EA 5CUGA 5HQ7A 5KO4A 3MUKA 1BORA 5LVRA 4YYJA 2DWWA 3C5KA 5FFWA 5KHMA 4QB3A 4AYCB 4NR4A 4QSXA 2M85A 3Q2FA 5ETDA 4YYDA 5F2PA 5DFCA 2YURA 2XEUA 4QEWA 2EA6A 4PCIA 5E9IA 4GB0A 3N9MA 4QBMA 1WEVA 4S3OC 4LZ2A 3IU5A 4O7AA 5CU8A 4YY6A 4PTBA 2L85A 4ZDTA 5A7CA 4NRCA 2EJNA 4QSSA 2G4AA 4AYCA 5CPEA 3T6RA 2E7NA 5L8TA 3DPLR 4IOQA 4GNDA 2FUUA 2MD7B 4FK5A 5A5RA 2RI7A 3U5OA 3N9OA 4NUEA 4CCGX 4BW3A 5HM0A 4R8PK 3LQJA 3KNVA 4Q6FA 3SHBA 1G25A 2RNXA 5L96A 5DKHA 3SUBA 5HFQA 2XOZA 5FERA 3KDEC 4KV1A 5HLSA 2OWAA 4V3LC 5C11A 4IC3A 2M3HA 4YABA 5EP7A 3GL6A 4O7BA 2YW5A 2K1JA 4NRBA 3D1DA 4CUSA 2I8NA 4UIUA 5KTUA 4ALGA 4DONA 2LXHC 1WENA 2CSYA 1WUMA 5B79A 4QUTA 5B75A 2KYUA 5FE1A 2YDWA 5D26A 5ETBA 2IQJA 3U5LA 4MR5A 4OUFA 4NYWA 3MB3A 5AD2A 1CHCA 1Z2QA 5KTWA 5CQTA 5DW2A 5D3RA 2KKYA 4Q0OA 2KWKA 1X4IA 4QEUA 5EICA 5CQ7A 2YSMA 1ZKRA 5LKUA 5A5SA 4TU4A 2NAAA 2MT5A 2ECWA 4QR3A 3M62A 2DVSA 1X4JA 5KH9A 5DX4A 3MULA 4HXLA 3UVXA 4CFLA 5FB1A 2QJ0A 5LCWB 5A82A 2RNYA 3Q2EA 2IDAA 2G45A 4QSVA 4F52B 4NXJA 2CONA 2G6QA 4GNFA 4A9LA 5F62A 4LJNA 1X4UA 4WIVA 5D3LA 3MDBC 4GPJA 3HTKC 1X0JA 4AVXA 2R0VA 3L1ZB 3QZSA 1HYJA 5IG6A 5HRWA 2DKWA 4QEVA 3JVJA 2F42A 1HYIA 4PS5A 2CKLB 3PHDA 5CZGA 4P5OB 2KWJA 2MKEA 1WEQA 2JRJA 2FFWA 4O78A 2VPGA 2R10A 2XOYA 4IORA 3LJWA 5EPBA 2ECGA 2I50A 3G0LA 4CFKA 2CRWA 4QZSA 3P5OA 4QSWA 5DLZA 1K2FA 4J0SA 5CUAA 2VPBA 5FG6A 4AKNA 3DWYA 2CKLA 2E7OA 3AQAA 2XP0A 5EK9A 5SVIB 5CUEA 4CLBA 4GNEA 4QC1A 5EISA 5LJ2A 3FANA 5FEYA 2VJEA 4A9JA 2ZETC 5FDZA 2VPDA 2MD8C 2DVVA 4MR6A 2CT2A 5FH7A 2JUNA 4LZSA 4CUUA 5CY9A 3C6WA 2M6MA 4IR5A 2LGGA 4LKAA 4A4CA 5HRXA 3O70A 1WESA 3M99A 3PURA 5G04B 3RPGB 5SVIA 5DBMA 2XOCA 5EA1A 3LVQE 4MVTA 4BJXA 4F3IA 2K4DA 3EB6A 2MIQA 1JM7B 3UV5A 5D3PA 2ECIA 5JG6A 1Z60A 3RTRB 4LYIA 5FFVA 5I40A 3UV4A 4QSUA 3O7AA 3P1FA 4LYSA 4LZRA 4TT4A 3G0JA 2KTBB 4PY6A 2RNWA 5D25A 2KGGA 2YHNA 1LDKC 4A9FA 4J1PA 2M13A 3L11A 3NG2A 4UI9B 2F6JA 2OSSA 4YC9A 4QYDA 2PUYA 3ZYQA 4QNSA 4Z6IA 3SVHA 1WEMA 3U5JA 4A9EA 2L80A 1ZBDB 4S3OB 5TDWA 1JM7A 4TT2A 1VFYA 2MA5A 3LXJA 3ASLA 4F1PA 3GG3A 3I3JA 3S91A 2RFJA 3JVKA 5FE6A 4CUTA 5KU3A 2YSJA 3ONIA 3PUQA 5LKXA 2VJFB 3M63A 3RPGC 5J0DA 4O77A 5DW1A 5EPRA 4OGEA 5E9VA 5G4SA 3HCTA 2QICA 5AD3A 1DCQA 3IHPA 1LDJB 2MJVB 5F25A 5HJCA 4QF2A 5G0FA 5IIDA 4O7CA 1JSPB 1WEOA 4HBWA 3VKHA 5EV9A 4TU6A 2VJFA 2YREA 4LYWA 5ENBA 2KR4A 4CL9A 4YBSA 5DYXA 4A9NA 5J3XA 4A9HA 5FB0A 4HBVA 5H85A 2KWOA 4A4BA 2RS9B 2OUOA 4V3KC 5D3JA 3E2DA 5EWVA 4R2YA 5AITA 4NQMA 4NUDA 2YHOA 4NYVA 2LSPB 3KQIA 2YEMA 4QC3A 4QR5A 3Q1DA 5I3LA 4HXOA 5FE5A 4QSPA 1WIMA 3O47A 4N4FA 5HQ5A 3N9LA 4A0CD 5KH7A 3ZVZB 5ENHA 5C85A 5LJ0A 2H60A 2YQDA 4XY8A 2LAUA 3VK6A 2Y1MA 4XUAA 2KFTA 4ZC9A 5ENFA 5CQ3A 5E7DA 5F36A 2RSDA 4CA1A 5HELA 3FJUB 5EPSA 2YYNA 4BBQA 5COIA 5EM3A 4RVRA 4Z93A 4FLPA 3JVLA 3U5PA 4Z0OA 4AI6A 5HFRA 5EWHA 4ZQLA 4QUUA 3DQVR 5TDRA 4WZ2A 5HQ6A 4O72A 2L84A 4E96A 3O36A 5TCMA 2OO1A 4NR6A 5ENJA 3O35A 5FE3A 5A85A 3UVWA 4MSXA 4YATA 3LDYA 4YYKA 3TLPA 2KKXA 5EYAF 4YYHA 2VP7A 3ZPV1 5BT5A 4WA6A 5A81A 4UIYA 5II1A 5DYCA 4HXMA 4YYNA 4O64A 5EQ1A 3SOWA 1VD4A 4GNGA 2R0SA 4BHWA
chains in the Genus database with same CATH topology
2D82A 4UYDA 4YK0A 2LGKA 3I2DA 2L5EA 2LXPC 5H1VA 5DFDA 3RCWA 5I86A 2KREA 4Z6HA 4WHUA 5CQ8A 5EU1A 5C4QA 2G43A 4TKPB 5E9MA 2YUCA 5ENCA 3IU6A 4PCEA 4HXPA 5II2A 5I89A 5LUUA 5DYUA 1MM3A 3QZVA 5B78A 3SOUA 2FUIA 4LADB 2VNFA 2D8SA 1N72A 2YQMA 5EI4A 5BT4A 1WFKA 2ECVA 1WILA 5HENA 4AP4A 3UVYA 4J3IA 4I7CA 1V87A 3EB5A 2DVQA 5FE2A 5CQ6A 5CUBA 2MNZA 4IOOA 4OGJA 4LDFA 4IR3A 3ZNIA 2ECJA 2LN0A 4UIZA 5LJ1A 4YYMA 5DLXA 3HCUA 5AMEA 2DATA 5TB6A 2NXBA 2RO1A 3HMFA 4LC2A 5I80A 5F3AA 3V43A 5E9KA 3MQMA 1WEWA 4TT6A 4X2IA 5E3GA 4YYGA 4NRAA 3N9NA 4HXKA 4MENA 3P1EA 5LKTA 4C67A 5I7YA 3KV6A 5DKAA 4IR4A 2JMDA 2LRIC 4A9MA 4B86C 4C9ZA 4NN2A 5F5ZA 4YAXA 5CRZA 4N4IA 5KH3A 3U5MA 3AADA 4BW1A 1T1HA 4TS8A 2LQ6A 4NS5A 4O70A 1FP0A 5ENIA 3LQHA 5DY7A 2ECNA 3MHSA 5LKZA 2KE1A 4CUPA 3N9QA 3SVGA 3LQIA 4MEOA 2Y1NA 5CFWA 5E73A 4UYFB 4J0RA 3JVMA 4PKLA 2K17A 2GRCA 4Z1SA 2KGIA 4YADA 4CURA 5EWWA 4MEQA 4LRGA 2L75A 5D0CA 5ACYA 3D7CA 4NYXA 4UYGA 4N4HA 2KWNA 3FKMX 3ZTGA 5IGLA 5E0RA 3O33A 4HXNA 4UYFA 1DVPA 2UZGA 1E4UA 2HYED 3K2JA 3UVDA 4TQNA 5FH6A 5B77A 3HMHA 5IGNA 4NR8A 5ENGA 5LVQA 2L0BA 5B8DA 3U5KA 5H1TA 5D24A 4L58A 4N4GA 4MR3A 2C2VS 1ZS5A 5FFYA 5B76A 3ZYUA 2HDPA 1U6GB 5C8GA 4LK9A 5EGUA 3QZTA 5E9YA 2M1RA 5HRVA 5ENEA 3GV4A 5F63A 3DAIA 4UYEA 4CUQA 2CSZA 2E6SA 2KU3A 4HBYA 4ZW1A 5L8UA 4QSQA 4OGIA 4UIWA 2LV9A 4IC2A 5E9LA 3LRQA 5D3HA 1XWHA 5AMFA 2MUMA 1WEUA 4UP5A 5F1HA 5H1UA 4UYHA 5CS8A 4TZ2A 4FIPA 4X3GA 5TABA 1WE9A 4TYLA 5EVAA 5I1QA 4WZ3B 5EWCA 3P1DA 2BAYA 5CQAA 3O37A 5CUDA 4NR9A 2YT5A 3HMEA 4A9KA 5D1LB 4TZ8A 4Q0NA 4YH3A 1F68A 4NQNA 4I7DA 4PPEA 4LLBA 4N3WA 4YH4A 4HBXA 4A9IA 5A5QA 4W4UA 5F1LA 4L7XA 1MM2A 2VPEA 4O74A 5AIUA 3T7LA 4YYIA 5I29A 2F6NA 5D7XA 5CQ4A 5IGMA 4QY4A 4FO9A 5FE8A 3N9PA 4ALHA 5C87A 1FBVA 2LDRA 3SOXA 3MB4A 3U5NA 5HEMA 1VYXA 2KIZA 5JWMA 4QF3A 4WHWA 2MA6A 5FE9A 1WUGA 4UITA 5CQ5A 4I7BA 2YYRA 3ZPVE 5HCLA 5FH8A 5A5OA 5CRMA 2PNXA 4Z1QA 2ECTA 1JM4B 5KTXA 2JMIA 3UW9A 2LGVA 4BW4A 1Z6UA 5FE4A 5CUCA 5D3NA 5L97A 3L1XA 5A5NA 5JI8A 5E74A 4C66A 3KV5A 1WEPA 2K16A 5FE7A 2YQLA 4IR6A 5E3DA 1N87A 4O7FA 4KCXA 2WP1A 5I88A 4WZ0A 5F60A 4QR4A 1WEEA 2N9GA 4LR6A 2YW8A 2XB1A 2WP2A 2VJEB 4MR4A 5A5PA 2EGPA 2FSAA 5D3SA 2DX8A 2H0DB 2JMJA 5C89A 3HCSA 2EODA 1EQFA 3MXFA 5D1MB 2QIZA 2D9EA 1RMDA 5TBNA 5F61A 5I7XA 3O34A 5H9MA 2AN6A 4AUQB 4UP0A 5DKDA 2L43A 5CP5A 5L98A 4HXSA 2I7KA 5FE0A 2OXQC 5I83A 4O71A 2H0DA 1IYMA 4MEPA 2YEKA 4TTEA 5DINA 5C13A 4Y03A 2LGLA 2DVRA 2R0YA 3P1CA 4HXRA 4BW2A 5L99A 5G05B 5K29A 4XI1A 4QSTA 2E6RA 5DKCA 2E3KA 3S92A 5A83A 4YBMA 1E6IA 5IBNA 4NUCA 5C7NA 4NR7A 3ZVYA 2YU4A 3MHHA 4UIXA 1JOCA 4B7YC 5CGPA 4O76A 5BT3A 2YELA 4FJCA 4QSRA 4NR5A 2Y43A 5IGKA 4O75A 5EWDA 4A9OA 3FL2A 4ZUXU 5FG5A 5G4RA 1WGMA 5D3TA 3NXBA 5DFBA 4YY4A 5TRBA 5FG4A 2MNYA 3UV2A 4YBTA 2C2LA 4XY9A 5DYAA 4XYAA 5D1KB 4A49A 3SVFA 4O7EA 4KV4A 4UIVA 5CTLA 2L5UA 4QYLA 4XUBA 1F62A 5FBXA 4R7EA 5CUGA 5HQ7A 5KO4A 3MUKA 1BORA 5LVRA 4YYJA 2DWWA 3C5KA 5FFWA 5KHMA 4QB3A 4AYCB 4NR4A 4QSXA 2M85A 3Q2FA 5ETDA 4YYDA 5F2PA 5DFCA 2YURA 2XEUA 4QEWA 2EA6A 4PCIA 5E9IA 4GB0A 3N9MA 4QBMA 1WEVA 4S3OC 4LZ2A 3IU5A 4O7AA 5CU8A 4YY6A 4PTBA 2L85A 4ZDTA 5A7CA 4NRCA 4QSSA 2G4AA 4AYCA 5CPEA 3T6RA 2E7NA 5L8TA 3DPLR 4IOQA 4GNDA 2FUUA 2MD7B 4FK5A 5A5RA 2RI7A 3U5OA 3N9OA 4NUEA 4CCGX 4BW3A 5HM0A 4R8PK 3LQJA 3KNVA 4Q6FA 3SHBA 1G25A 2RNXA 5L96A 5DKHA 5HFQA 5FERA 4KV1A 5HLSA 4V3LC 5C11A 4IC3A 2M3HA 4YABA 5EP7A 3GL6A 4O7BA 2YW5A 2K1JA 4NRBA 4CUSA 2I8NA 4UIUA 5KTUA 4ALGA 4DONA 2LXHC 1WENA 2CSYA 1WUMA 5B79A 4QUTA 5B75A 2KYUA 5FE1A 2YDWA 5D26A 5ETBA 3U5LA 4MR5A 4OUFA 4NYWA 3MB3A 5AD2A 1CHCA 1Z2QA 5KTWA 5CQTA 5DW2A 5D3RA 2KWKA 4Q0OA 1X4IA 4QEUA 5EICA 5CQ7A 2YSMA 5LKUA 5A5SA 4TU4A 2NAAA 2MT5A 2ECWA 4QR3A 3M62A 2DVSA 1X4JA 5KH9A 5DX4A 3MULA 4HXLA 3UVXA 4CFLA 5FB1A 2QJ0A 5LCWB 5A82A 2RNYA 3Q2EA 2IDAA 2G45A 4QSVA 4F52B 4NXJA 2G6QA 4GNFA 4A9LA 5F62A 4LJNA 1X4UA 4WIVA 5D3LA 4GPJA 3HTKC 1X0JA 4AVXA 2R0VA 3L1ZB 3QZSA 1HYJA 5IG6A 5HRWA 2DKWA 4QEVA 3JVJA 2F42A 1HYIA 4PS5A 2CKLB 3PHDA 5CZGA 4P5OB 2KWJA 1WEQA 2JRJA 4O78A 2VPGA 2R10A 4IORA 3LJWA 5EPBA 2ECGA 2I50A 3G0LA 4CFKA 4QZSA 3P5OA 4QSWA 5DLZA 1K2FA 4J0SA 5CUAA 2VPBA 5FG6A 4AKNA 3DWYA 2CKLA 2E7OA 3AQAA 5EK9A 5CUEA 4CLBA 4GNEA 4QC1A 5EISA 5LJ2A 5FEYA 2VJEA 4A9JA 2ZETC 5FDZA 2VPDA 2MD8C 2DVVA 4MR6A 2CT2A 5FH7A 4LZSA 4CUUA 5CY9A 3C6WA 2M6MA 4IR5A 2LGGA 4LKAA 4A4CA 5HRXA 3O70A 1WESA 3M99A 3PURA 5G04B 3RPGB 5DBMA 5EA1A 4MVTA 4BJXA 4F3IA 2K4DA 3EB6A 2MIQA 1JM7B 3UV5A 5D3PA 2ECIA 5JG6A 1Z60A 3RTRB 4LYIA 5FFVA 5I40A 3UV4A 4QSUA 3O7AA 3P1FA 4LYSA 4LZRA 4TT4A 3G0JA 2KTBB 4PY6A 2RNWA 5D25A 2KGGA 2YHNA 1LDKC 4A9FA 4J1PA 3L11A 3NG2A 4UI9B 2F6JA 2OSSA 4YC9A 4QYDA 2PUYA 3ZYQA 4QNSA 4Z6IA 3SVHA 1WEMA 3U5JA 4A9EA 2L80A 1ZBDB 4S3OB 5TDWA 1JM7A 4TT2A 1VFYA 2MA5A 3LXJA 3ASLA 3GG3A 3I3JA 3S91A 2RFJA 3JVKA 5FE6A 4CUTA 5KU3A 2YSJA 3ONIA 3PUQA 5LKXA 2VJFB 3M63A 3RPGC 5J0DA 4O77A 5DW1A 5EPRA 5E9VA 5G4SA 3HCTA 2QICA 5AD3A 3IHPA 1LDJB 2MJVB 5F25A 5HJCA 4QF2A 5G0FA 5IIDA 4O7CA 1JSPB 1WEOA 4HBWA 2VJFA 5EV9A 4TU6A 2YREA 4LYWA 5ENBA 2KR4A 4CL9A 4YBSA 5DYXA 4A9NA 5J3XA 4A9HA 5FB0A 4HBVA 5H85A 2KWOA 4A4BA 2RS9B 2OUOA 4V3KC 5D3JA 5EWVA 4R2YA 5AITA 4NQMA 4NUDA 2YHOA 4NYVA 2LSPB 3KQIA 2YEMA 4QC3A 4QR5A 5I3LA 4HXOA 5FE5A 4QSPA 1WIMA 4N4FA 5HQ5A 3N9LA 4A0CD 5KH7A 3ZVZB 5ENHA 5C85A 5LJ0A 2H60A 2YQDA 4XY8A 3VK6A 2Y1MA 4XUAA 2KFTA 4ZC9A 5ENFA 5CQ3A 5E7DA 5F36A 2RSDA 4CA1A 5HELA 5EPSA 2YYNA 4BBQA 5COIA 5EM3A 4RVRA 4Z93A 4FLPA 3JVLA 3U5PA 5HFRA 5EWHA 4ZQLA 4QUUA 3DQVR 5TDRA 4WZ2A 5HQ6A 4O72A 2L84A 4E96A 3O36A 5TCMA 2OO1A 4NR6A 5ENJA 3O35A 5FE3A 5A85A 3UVWA 4MSXA 4YATA 4YYKA 3TLPA 5EYAF 4YYHA 2VP7A 3ZPV1 5BT5A 4WA6A 5A81A 4UIYA 5II1A 5DYCA 4HXMA 4YYNA 4O64A 5EQ1A 3SOWA 1VD4A 4GNGA 2R0SA 4BHWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D82 A;  4UYD A;  4YK0 A;  2LGK A;  3I2D A;  2L5E A;  2LXP C;  5H1V A;  5DFD A;  3RCW A;  5I86 A;  2KRE A;  4Z6H A;  4WHU A;  5CQ8 A;  5EU1 A;  5C4Q A;  2G43 A;  4TKP B;  5E9M A;  2YUC A;  5ENC A;  3IU6 A;  4PCE A;  4HXP A;  5II2 A;  5I89 A;  5LUU A;  5DYU A;  1MM3 A;  3QZV A;  5B78 A;  3SOU A;  2FUI A;  4LAD B;  2VNF A;  2D8S A;  1N72 A;  2YQM A;  5EI4 A;  5BT4 A;  1WFK A;  2ECV A;  1WIL A;  5HEN A;  4AP4 A;  3UVY A;  4J3I A;  4I7C A;  1V87 A;  3EB5 A;  2DVQ A;  5FE2 A;  5CQ6 A;  5CUB A;  2MNZ A;  4IOO A;  4OGJ A;  4LDF A;  4IR3 A;  3ZNI A;  2ECJ A;  2LN0 A;  4UIZ A;  5LJ1 A;  4YYM A;  5DLX A;  3HCU A;  5AME A;  2DAT A;  5TB6 A;  2NXB A;  2RO1 A;  3HMF A;  4LC2 A;  5I80 A;  5F3A A;  3V43 A;  5E9K A;  3MQM A;  1WEW A;  4TT6 A;  4X2I A;  5E3G A;  4YYG A;  4NRA A;  3N9N A;  4HXK A;  4MEN A;  3P1E A;  5LKT A;  4C67 A;  5I7Y A;  3KV6 A;  5DKA A;  4IR4 A;  2JMD A;  2LRI C;  4A9M A;  4B86 C;  4C9Z A;  4NN2 A;  5F5Z A;  4YAX A;  5CRZ A;  4N4I A;  5KH3 A;  3U5M A;  3AAD A;  4BW1 A;  1T1H A;  4TS8 A;  2LQ6 A;  4NS5 A;  4O70 A;  1FP0 A;  5ENI A;  3LQH A;  5DY7 A;  2ECN A;  3MHS A;  5LKZ A;  2KE1 A;  4CUP A;  3N9Q A;  3SVG A;  3LQI A;  4MEO A;  2Y1N A;  5CFW A;  5E73 A;  4UYF B;  4J0R A;  3JVM A;  4PKL A;  2K17 A;  2GRC A;  4Z1S A;  2KGI A;  4YAD A;  4CUR A;  5EWW A;  4MEQ A;  4LRG A;  2L75 A;  5D0C A;  5ACY A;  3D7C A;  4NYX A;  4UYG A;  4N4H A;  2KWN A;  3FKM X;  3ZTG A;  5IGL A;  5E0R A;  3O33 A;  4HXN A;  4UYF A;  1DVP A;  2UZG A;  1E4U A;  2HYE D;  3K2J A;  3UVD A;  4TQN A;  5FH6 A;  5B77 A;  3HMH A;  5IGN A;  4NR8 A;  5ENG A;  5LVQ A;  2L0B A;  5B8D A;  3U5K A;  5H1T A;  5D24 A;  4L58 A;  4N4G A;  4MR3 A;  2C2V S;  1ZS5 A;  5FFY A;  5B76 A;  3ZYU A;  2HDP A;  1U6G B;  5C8G A;  4LK9 A;  5EGU A;  3QZT A;  5E9Y A;  2M1R A;  5HRV A;  5ENE A;  3GV4 A;  5F63 A;  3DAI A;  4UYE A;  4CUQ A;  2CSZ A;  2E6S A;  2KU3 A;  4HBY A;  4ZW1 A;  5L8U A;  4QSQ A;  4OGI A;  4UIW A;  2LV9 A;  4IC2 A;  5E9L A;  3LRQ A;  5D3H A;  1XWH A;  5AMF A;  2MUM A;  1WEU A;  4UP5 A;  5F1H A;  5H1U A;  4UYH A;  5CS8 A;  4TZ2 A;  4FIP A;  4X3G A;  5TAB A;  1WE9 A;  4TYL A;  5EVA A;  5I1Q A;  4WZ3 B;  5EWC A;  3P1D A;  2BAY A;  5CQA A;  3O37 A;  5CUD A;  4NR9 A;  2YT5 A;  3HME A;  4A9K A;  5D1L B;  4TZ8 A;  4Q0N A;  4YH3 A;  1F68 A;  4NQN A;  4I7D A;  4PPE A;  4LLB A;  4N3W A;  4YH4 A;  4HBX A;  4A9I A;  5A5Q A;  4W4U A;  5F1L A;  4L7X A;  1MM2 A;  2VPE A;  4O74 A;  5AIU A;  3T7L A;  4YYI A;  5I29 A;  2F6N A;  5D7X A;  5CQ4 A;  5IGM A;  4QY4 A;  4FO9 A;  5FE8 A;  3N9P A;  4ALH A;  5C87 A;  1FBV A;  2LDR A;  3SOX A;  3MB4 A;  3U5N A;  5HEM A;  1VYX A;  2KIZ A;  5JWM A;  4QF3 A;  4WHW A;  2MA6 A;  5FE9 A;  1WUG A;  4UIT A;  5CQ5 A;  4I7B A;  2YYR A;  3ZPV E;  5HCL A;  5FH8 A;  5A5O A;  5CRM A;  2PNX A;  4Z1Q A;  2ECT A;  1JM4 B;  5KTX A;  2JMI A;  3UW9 A;  2LGV A;  4BW4 A;  1Z6U A;  5FE4 A;  5CUC A;  5D3N A;  5L97 A;  3L1X A;  5A5N A;  5JI8 A;  5E74 A;  4C66 A;  3KV5 A;  1WEP A;  2K16 A;  5FE7 A;  2YQL A;  4IR6 A;  5E3D A;  1N87 A;  4O7F A;  4KCX A;  2WP1 A;  5I88 A;  4WZ0 A;  5F60 A;  4QR4 A;  1WEE A;  2N9G A;  4LR6 A;  2YW8 A;  2XB1 A;  2WP2 A;  2VJE B;  4MR4 A;  5A5P A;  2EGP A;  2FSA A;  5D3S A;  2DX8 A;  2H0D B;  2JMJ A;  5C89 A;  3HCS A;  2EOD A;  1EQF A;  3MXF A;  5D1M B;  2QIZ A;  2D9E A;  1RMD A;  5TBN A;  5F61 A;  5I7X A;  3O34 A;  5H9M A;  2AN6 A;  4AUQ B;  4UP0 A;  5DKD A;  2L43 A;  5CP5 A;  5L98 A;  4HXS A;  2I7K A;  5FE0 A;  2OXQ C;  5I83 A;  4O71 A;  2H0D A;  1IYM A;  4MEP A;  2YEK A;  4TTE A;  5DIN A;  5C13 A;  4Y03 A;  2LGL A;  2DVR A;  2R0Y A;  3P1C A;  4HXR A;  4BW2 A;  5L99 A;  5G05 B;  5K29 A;  4XI1 A;  4QST A;  2E6R A;  5DKC A;  2E3K A;  3S92 A;  5A83 A;  4YBM A;  1E6I A;  5IBN A;  4NUC A;  5C7N A;  4NR7 A;  3ZVY A;  2YU4 A;  3MHH A;  4UIX A;  1JOC A;  4B7Y C;  5CGP A;  4O76 A;  5BT3 A;  2YEL A;  4FJC A;  4QSR A;  4NR5 A;  2Y43 A;  5IGK A;  4O75 A;  5EWD A;  4A9O A;  3FL2 A;  4ZUX U;  5FG5 A;  5G4R A;  1WGM A;  5D3T A;  3NXB A;  5DFB A;  4YY4 A;  5TRB A;  5FG4 A;  2MNY A;  3UV2 A;  4YBT A;  2C2L A;  4XY9 A;  5DYA A;  4XYA A;  5D1K B;  4A49 A;  3SVF A;  4O7E A;  4KV4 A;  4UIV A;  5CTL A;  2L5U A;  4QYL A;  4XUB A;  1F62 A;  5FBX A;  4R7E A;  5CUG A;  5HQ7 A;  5KO4 A;  3MUK A;  1BOR A;  5LVR A;  4YYJ A;  2DWW A;  3C5K A;  5FFW A;  5KHM A;  4QB3 A;  4AYC B;  4NR4 A;  4QSX A;  2M85 A;  3Q2F A;  5ETD A;  4YYD A;  5F2P A;  5DFC A;  2YUR A;  2XEU A;  4QEW A;  2EA6 A;  4PCI A;  5E9I A;  4GB0 A;  3N9M A;  4QBM A;  1WEV A;  4S3O C;  4LZ2 A;  3IU5 A;  4O7A A;  5CU8 A;  4YY6 A;  4PTB A;  2L85 A;  4ZDT A;  5A7C A;  4NRC A;  4QSS A;  2G4A A;  4AYC A;  5CPE A;  3T6R A;  2E7N A;  5L8T A;  3DPL R;  4IOQ A;  4GND A;  2FUU A;  2MD7 B;  4FK5 A;  5A5R A;  2RI7 A;  3U5O A;  3N9O A;  4NUE A;  4CCG X;  4BW3 A;  5HM0 A;  4R8P K;  3LQJ A;  3KNV A;  4Q6F A;  3SHB A;  1G25 A;  2RNX A;  5L96 A;  5DKH A;  5HFQ A;  5FER A;  4KV1 A;  5HLS A;  4V3L C;  5C11 A;  4IC3 A;  2M3H A;  4YAB A;  5EP7 A;  3GL6 A;  4O7B A;  2YW5 A;  2K1J A;  4NRB A;  4CUS A;  2I8N A;  4UIU A;  5KTU A;  4ALG A;  4DON A;  2LXH C;  1WEN A;  2CSY A;  1WUM A;  5B79 A;  4QUT A;  5B75 A;  2KYU A;  5FE1 A;  2YDW A;  5D26 A;  5ETB A;  3U5L A;  4MR5 A;  4OUF A;  4NYW A;  3MB3 A;  5AD2 A;  1CHC A;  1Z2Q A;  5KTW A;  5CQT A;  5DW2 A;  5D3R A;  2KWK A;  4Q0O A;  1X4I A;  4QEU A;  5EIC A;  5CQ7 A;  2YSM A;  5LKU A;  5A5S A;  4TU4 A;  2NAA A;  2MT5 A;  2ECW A;  4QR3 A;  3M62 A;  2DVS A;  1X4J A;  5KH9 A;  5DX4 A;  3MUL A;  4HXL A;  3UVX A;  4CFL A;  5FB1 A;  2QJ0 A;  5LCW B;  5A82 A;  2RNY A;  3Q2E A;  2IDA A;  2G45 A;  4QSV A;  4F52 B;  4NXJ A;  2G6Q A;  4GNF A;  4A9L A;  5F62 A;  4LJN A;  1X4U A;  4WIV A;  5D3L A;  4GPJ A;  3HTK C;  1X0J A;  4AVX A;  2R0V A;  3L1Z B;  3QZS A;  1HYJ A;  5IG6 A;  5HRW A;  2DKW A;  4QEV A;  3JVJ A;  2F42 A;  1HYI A;  4PS5 A;  2CKL B;  3PHD A;  5CZG A;  4P5O B;  2KWJ A;  1WEQ A;  2JRJ A;  4O78 A;  2VPG A;  2R10 A;  4IOR A;  3LJW A;  5EPB A;  2ECG A;  2I50 A;  3G0L A;  4CFK A;  4QZS A;  3P5O A;  4QSW A;  5DLZ A;  1K2F A;  4J0S A;  5CUA A;  2VPB A;  5FG6 A;  4AKN A;  3DWY A;  2CKL A;  2E7O A;  3AQA A;  5EK9 A;  5CUE A;  4CLB A;  4GNE A;  4QC1 A;  5EIS A;  5LJ2 A;  5FEY A;  2VJE A;  4A9J A;  2ZET C;  5FDZ A;  2VPD A;  2MD8 C;  2DVV A;  4MR6 A;  2CT2 A;  5FH7 A;  4LZS A;  4CUU A;  5CY9 A;  3C6W A;  2M6M A;  4IR5 A;  2LGG A;  4LKA A;  4A4C A;  5HRX A;  3O70 A;  1WES A;  3M99 A;  3PUR A;  5G04 B;  3RPG B;  5DBM A;  5EA1 A;  4MVT A;  4BJX A;  4F3I A;  2K4D A;  3EB6 A;  2MIQ A;  1JM7 B;  3UV5 A;  5D3P A;  2ECI A;  5JG6 A;  1Z60 A;  3RTR B;  4LYI A;  5FFV A;  5I40 A;  3UV4 A;  4QSU A;  3O7A A;  3P1F A;  4LYS A;  4LZR A;  4TT4 A;  3G0J A;  2KTB B;  4PY6 A;  2RNW A;  5D25 A;  2KGG A;  2YHN A;  1LDK C;  4A9F A;  4J1P A;  3L11 A;  3NG2 A;  4UI9 B;  2F6J A;  2OSS A;  4YC9 A;  4QYD A;  2PUY A;  3ZYQ A;  4QNS A;  4Z6I A;  3SVH A;  1WEM A;  3U5J A;  4A9E A;  2L80 A;  1ZBD B;  4S3O B;  5TDW A;  1JM7 A;  4TT2 A;  1VFY A;  2MA5 A;  3LXJ A;  3ASL A;  3GG3 A;  3I3J A;  3S91 A;  2RFJ A;  3JVK A;  5FE6 A;  4CUT A;  5KU3 A;  2YSJ A;  3ONI A;  3PUQ A;  5LKX A;  2VJF B;  3M63 A;  3RPG C;  5J0D A;  4O77 A;  5DW1 A;  5EPR A;  5E9V A;  5G4S A;  3HCT A;  2QIC A;  5AD3 A;  3IHP A;  1LDJ B;  2MJV B;  5F25 A;  5HJC A;  4QF2 A;  5G0F A;  5IID A;  4O7C A;  1JSP B;  1WEO A;  4HBW A;  2VJF A;  5EV9 A;  4TU6 A;  2YRE A;  4LYW A;  5ENB A;  2KR4 A;  4CL9 A;  4YBS A;  5DYX A;  4A9N A;  5J3X A;  4A9H A;  5FB0 A;  4HBV A;  5H85 A;  2KWO A;  4A4B A;  2RS9 B;  2OUO A;  4V3K C;  5D3J A;  5EWV A;  4R2Y A;  5AIT A;  4NQM A;  4NUD A;  2YHO A;  4NYV A;  2LSP B;  3KQI A;  2YEM A;  4QC3 A;  4QR5 A;  5I3L A;  4HXO A;  5FE5 A;  4QSP A;  1WIM A;  4N4F A;  5HQ5 A;  3N9L A;  4A0C D;  5KH7 A;  3ZVZ B;  5ENH A;  5C85 A;  5LJ0 A;  2H60 A;  2YQD A;  4XY8 A;  3VK6 A;  2Y1M A;  4XUA A;  2KFT A;  4ZC9 A;  5ENF A;  5CQ3 A;  5E7D A;  5F36 A;  2RSD A;  4CA1 A;  5HEL A;  5EPS A;  2YYN A;  4BBQ A;  5COI A;  5EM3 A;  4RVR A;  4Z93 A;  4FLP A;  3JVL A;  3U5P A;  5HFR A;  5EWH A;  4ZQL A;  4QUU A;  3DQV R;  5TDR A;  4WZ2 A;  5HQ6 A;  4O72 A;  2L84 A;  4E96 A;  3O36 A;  5TCM A;  2OO1 A;  4NR6 A;  5ENJ A;  3O35 A;  5FE3 A;  5A85 A;  3UVW A;  4MSX A;  4YAT A;  4YYK A;  3TLP A;  5EYA F;  4YYH A;  2VP7 A;  3ZPV 1;  5BT5 A;  4WA6 A;  5A81 A;  4UIY A;  5II1 A;  5DYC A;  4HXM A;  4YYN A;  4O64 A;  5EQ1 A;  3SOW A;  1VD4 A;  4GNG A;  2R0S A;  4BHW A; 
#chains in the Genus database with same CATH topology
 2D82 A;  4UYD A;  4YK0 A;  2LGK A;  3I2D A;  2L5E A;  2LXP C;  5H1V A;  5DFD A;  3RCW A;  5I86 A;  2KRE A;  3DDT A;  4Z6H A;  4WHU A;  5CQ8 A;  5EU1 A;  5C4Q A;  2G43 A;  2D8U A;  4TKP B;  5E9M A;  2YUC A;  5ENC A;  3IU6 A;  4PCE A;  4HXP A;  5II2 A;  5I89 A;  5LUU A;  5DYU A;  1MM3 A;  3QZV A;  5B78 A;  3SOU A;  2FUI A;  4LAD B;  2VNF A;  2D8S A;  1N72 A;  2YQM A;  4Z0R A;  5EI4 A;  5BT4 A;  1WFK A;  2ECV A;  1WIL A;  5HEN A;  4AP4 A;  3UVY A;  4J3I A;  4I7C A;  3T9K A;  1V87 A;  3EB5 A;  2DVQ A;  5FE2 A;  5CQ6 A;  5CUB A;  2MNZ A;  4IOO A;  4OGJ A;  4LDF A;  4IR3 A;  3ZNI A;  2ECJ A;  2DJA A;  2LN0 A;  4UIZ A;  5LJ1 A;  4YYM A;  5DLX A;  3HCU A;  5AME A;  2DAT A;  5TB6 A;  3LVR E;  2NXB A;  2RO1 A;  3HMF A;  4LC2 A;  5I80 A;  5F3A A;  3V43 A;  5E9K A;  3MQM A;  1WEW A;  4TT6 A;  4X2I A;  3DWD A;  5E3G A;  4YYG A;  4NRA A;  3FM8 C;  3N9N A;  1PUO A;  4HXK A;  4MEN A;  3P1E A;  5LKT A;  4C67 A;  5I7Y A;  3KV6 A;  5DKA A;  4IR4 A;  2JMD A;  2LRI C;  4A9M A;  4B86 C;  4C9Z A;  4NN2 A;  5F5Z A;  4YAX A;  5CRZ A;  4N4I A;  5KH3 A;  3U5M A;  3AAD A;  4BW1 A;  1T1H A;  4TS8 A;  2LQ6 A;  4NS5 A;  4O70 A;  1FP0 A;  3JUE A;  5ENI A;  3LQH A;  5DY7 A;  3H7H A;  2ECN A;  3MHS A;  5LKZ A;  4AKH A;  4CUP A;  2KE1 A;  3N9Q A;  3SVG A;  3LQI A;  4MEO A;  2Y1N A;  5CFW A;  5E73 A;  2P57 A;  4UYF B;  4J0R A;  3JVM A;  4PKL A;  2K17 A;  2GRC A;  4Z1S A;  2KGI A;  4YAD A;  4CUR A;  5EWW A;  4MEQ A;  4LRG A;  2L75 A;  5D0C A;  5ACY A;  3D7C A;  4NYX A;  4UYG A;  4N4H A;  2KWN A;  3FKM X;  3ZTG A;  5IGL A;  2EGM A;  5E0R A;  3O33 A;  4HXN A;  4UYF A;  1DVP A;  2UZG A;  1E4U A;  2HYE D;  3K2J A;  3UVD A;  4TQN A;  5FH6 A;  5B77 A;  3HMH A;  5IGN A;  4NR8 A;  5ENG A;  5LVQ A;  2L0B A;  5B8D A;  3U5K A;  5H1T A;  5D24 A;  4L58 A;  4N4G A;  4MR3 A;  2C2V S;  1ZS5 A;  4OGC A;  5FFY A;  2CSV A;  3ZYU A;  2HDP A;  1U6G B;  5C8G A;  4LK9 A;  5B76 A;  5EGU A;  3QZT A;  5E9Y A;  4AKI A;  2M1R A;  5HRV A;  3LJU X;  5ENE A;  3GV4 A;  5F63 A;  3DAI A;  4UYE A;  4CUQ A;  2CSZ A;  2E6S A;  2KU3 A;  4HBY A;  4ZW1 A;  5L8U A;  4QSQ A;  4OGI A;  4UIW A;  2LV9 A;  4IC2 A;  5E9L A;  3LRQ A;  5D3H A;  1XWH A;  5AMF A;  2MUM A;  1WEU A;  4UP5 A;  5F1H A;  5H1U A;  4UYH A;  5CS8 A;  4TZ2 A;  4FIP A;  4X3G A;  5TAB A;  3M7K A;  4AKG A;  3FEH A;  1WE9 A;  4TYL A;  5EVA A;  5I1Q A;  4WZ3 B;  5EWC A;  3P1D A;  2JM3 A;  2BAY A;  5CQA A;  3O37 A;  5CUD A;  4NR9 A;  2YT5 A;  3HME A;  4A9K A;  5D1L B;  5SVX A;  4TZ8 A;  4Q0N A;  4YH3 A;  1F68 A;  4NQN A;  3FAO A;  4I7D A;  4PPE A;  4LLB A;  4N3W A;  4YH4 A;  4HBX A;  4A9I A;  5A5Q A;  4W4U A;  5F1L A;  4L7X A;  1MM2 A;  2VPE A;  4O62 A;  4O74 A;  5AIU A;  3T7L A;  4YYI A;  5I29 A;  2F6N A;  5D7X A;  5CQ4 A;  5IGM A;  4QY4 A;  4FO9 A;  5FE8 A;  3N9P A;  4ALH A;  5C87 A;  1FBV A;  2LDR A;  3SOX A;  3MB4 A;  3U5N A;  5HEM A;  1VYX A;  2KIZ A;  5JWM A;  4QF3 A;  4WHW A;  2MA6 A;  5FE9 A;  1WUG A;  4UIT A;  5CQ5 A;  4I7B A;  2YYR A;  3ZPV E;  5HCL A;  5FH8 A;  5A5O A;  5CRM A;  2PNX A;  4Z1Q A;  2ECT A;  1JM4 B;  5KTX A;  2JMI A;  3UW9 A;  2LGV A;  4BW4 A;  1Z6U A;  5FE4 A;  5CUC A;  5D3N A;  5L97 A;  3L1X A;  5A5N A;  5JI8 A;  5E74 A;  4C66 A;  3KV5 A;  1WEP A;  2RR4 A;  2K16 A;  5FE7 A;  2YQL A;  3ERR A;  4IR6 A;  5E3D A;  1N87 A;  4O7F A;  4KCX A;  2WP1 A;  5I88 A;  4WZ0 A;  2EXU A;  5F60 A;  4QR4 A;  1WEE A;  2N9G A;  4LR6 A;  2FD4 A;  2YW8 A;  4QQ4 A;  2XB1 A;  2WP2 A;  2VJE B;  4MR4 A;  5A5P A;  2EGP A;  2FSA A;  5D3S A;  2DX8 A;  2E61 A;  2H0D B;  2JMJ A;  5C89 A;  3HCS A;  2EOD A;  1EQF A;  3MXF A;  5D1M B;  2QIZ A;  2D9E A;  1RMD A;  5TBN A;  5F61 A;  5I7X A;  3O34 A;  5H9M A;  2AN6 A;  4AUQ B;  5K3Q A;  4UP0 A;  5DKD A;  2L43 A;  5CP5 A;  5L98 A;  4HXS A;  2I7K A;  5FE0 A;  2OXQ C;  5I83 A;  4O71 A;  2H0D A;  1IYM A;  4MEP A;  2YEK A;  4TTE A;  5DIN A;  5C13 A;  4Y03 A;  2L7P A;  2LGL A;  2DVR A;  2R0Y A;  3P1C A;  4HXR A;  4BW2 A;  5L99 A;  5G05 B;  2CRR A;  5K29 A;  4XI1 A;  3D1B A;  4QST A;  2E6R A;  5DKC A;  2E3K A;  3S92 A;  2YVR A;  5A83 A;  4YBM A;  1E6I A;  5IBN A;  4NUC A;  5C7N A;  4NR7 A;  3ZVY A;  2YU4 A;  3MHH A;  4UIX A;  1JOC A;  2B0O E;  4B7Y C;  5CGP A;  4O76 A;  5BT3 A;  2YEL A;  4FJC A;  4QSR A;  4NR5 A;  2Y43 A;  5IGK A;  4O75 A;  5EWD A;  4A9O A;  1MBM A;  3FL2 A;  4ZUX U;  3VKG A;  5FG5 A;  5G4R A;  1WGM A;  5D3T A;  3NXB A;  5DFB A;  4YY4 A;  3PLW A;  5TRB A;  5FG4 A;  2MNY A;  3UV2 A;  4YBT A;  2DSM A;  2C2L A;  4XY9 A;  5DYA A;  4H9D A;  5SVY A;  4XYA A;  5D1K B;  4A49 A;  3SVF A;  4O7E A;  4KV4 A;  4UIV A;  5CTL A;  2L5U A;  4QYL A;  4XUB A;  1F62 A;  5FBX A;  4R7E A;  5CUG A;  5HQ7 A;  5KO4 A;  3MUK A;  1BOR A;  5LVR A;  4YYJ A;  2DWW A;  3C5K A;  5FFW A;  5KHM A;  4QB3 A;  4AYC B;  4NR4 A;  4QSX A;  2M85 A;  3Q2F A;  5ETD A;  4YYD A;  5F2P A;  5DFC A;  2YUR A;  2XEU A;  4QEW A;  2EA6 A;  4PCI A;  5E9I A;  4GB0 A;  3N9M A;  4QBM A;  1WEV A;  4S3O C;  4LZ2 A;  3IU5 A;  4O7A A;  5CU8 A;  4YY6 A;  4PTB A;  2L85 A;  4ZDT A;  5A7C A;  4NRC A;  2EJN A;  4QSS A;  2G4A A;  4AYC A;  5CPE A;  3T6R A;  2E7N A;  5L8T A;  3DPL R;  4IOQ A;  4GND A;  2FUU A;  2MD7 B;  4FK5 A;  5A5R A;  2RI7 A;  3U5O A;  3N9O A;  4NUE A;  4CCG X;  4BW3 A;  5HM0 A;  4R8P K;  3LQJ A;  3KNV A;  4Q6F A;  3SHB A;  1G25 A;  2RNX A;  5L96 A;  5DKH A;  3SUB A;  5HFQ A;  2XOZ A;  5FER A;  3KDE C;  4KV1 A;  5HLS A;  2OWA A;  4V3L C;  5C11 A;  4IC3 A;  2M3H A;  4YAB A;  5EP7 A;  3GL6 A;  4O7B A;  2YW5 A;  2K1J A;  4NRB A;  3D1D A;  4CUS A;  2I8N A;  4UIU A;  5KTU A;  4ALG A;  4DON A;  2LXH C;  1WEN A;  2CSY A;  1WUM A;  5B79 A;  4QUT A;  5B75 A;  2KYU A;  5FE1 A;  2YDW A;  5D26 A;  5ETB A;  2IQJ A;  3U5L A;  4MR5 A;  4OUF A;  4NYW A;  3MB3 A;  5AD2 A;  1CHC A;  1Z2Q A;  5KTW A;  5CQT A;  5DW2 A;  5D3R A;  2KKY A;  4Q0O A;  2KWK A;  1X4I A;  4QEU A;  5EIC A;  5CQ7 A;  2YSM A;  1ZKR A;  5LKU A;  5A5S A;  4TU4 A;  2NAA A;  2MT5 A;  2ECW A;  4QR3 A;  3M62 A;  2DVS A;  1X4J A;  5KH9 A;  5DX4 A;  3MUL A;  4HXL A;  3UVX A;  4CFL A;  5FB1 A;  2QJ0 A;  5LCW B;  5A82 A;  2RNY A;  3Q2E A;  2IDA A;  2G45 A;  4QSV A;  4F52 B;  4NXJ A;  2CON A;  2G6Q A;  4GNF A;  4A9L A;  5F62 A;  4LJN A;  1X4U A;  4WIV A;  5D3L A;  3MDB C;  4GPJ A;  3HTK C;  1X0J A;  4AVX A;  2R0V A;  3L1Z B;  3QZS A;  1HYJ A;  5IG6 A;  5HRW A;  2DKW A;  4QEV A;  3JVJ A;  2F42 A;  1HYI A;  4PS5 A;  2CKL B;  3PHD A;  5CZG A;  4P5O B;  2KWJ A;  2MKE A;  1WEQ A;  2JRJ A;  2FFW A;  4O78 A;  2VPG A;  2R10 A;  2XOY A;  4IOR A;  3LJW A;  5EPB A;  2ECG A;  2I50 A;  3G0L A;  4CFK A;  2CRW A;  4QZS A;  3P5O A;  4QSW A;  5DLZ A;  1K2F A;  4J0S A;  5CUA A;  2VPB A;  5FG6 A;  4AKN A;  3DWY A;  2CKL A;  2E7O A;  3AQA A;  2XP0 A;  5EK9 A;  5SVI B;  5CUE A;  4CLB A;  4GNE A;  4QC1 A;  5EIS A;  5LJ2 A;  3FAN A;  5FEY A;  2VJE A;  4A9J A;  2ZET C;  5FDZ A;  2VPD A;  2MD8 C;  2DVV A;  4MR6 A;  2CT2 A;  5FH7 A;  2JUN A;  4LZS A;  4CUU A;  5CY9 A;  3C6W A;  2M6M A;  4IR5 A;  2LGG A;  4LKA A;  4A4C A;  5HRX A;  3O70 A;  1WES A;  3M99 A;  3PUR A;  5G04 B;  3RPG B;  5SVI A;  5DBM A;  2XOC A;  5EA1 A;  3LVQ E;  4MVT A;  4BJX A;  4F3I A;  2K4D A;  3EB6 A;  2MIQ A;  1JM7 B;  3UV5 A;  5D3P A;  2ECI A;  5JG6 A;  1Z60 A;  3RTR B;  4LYI A;  5FFV A;  5I40 A;  3UV4 A;  4QSU A;  3O7A A;  3P1F A;  4LYS A;  4LZR A;  4TT4 A;  3G0J A;  2KTB B;  4PY6 A;  2RNW A;  5D25 A;  2KGG A;  2YHN A;  1LDK C;  4A9F A;  4J1P A;  2M13 A;  3L11 A;  3NG2 A;  4UI9 B;  2F6J A;  2OSS A;  4YC9 A;  4QYD A;  2PUY A;  3ZYQ A;  4QNS A;  4Z6I A;  3SVH A;  1WEM A;  3U5J A;  4A9E A;  2L80 A;  1ZBD B;  4S3O B;  5TDW A;  1JM7 A;  4TT2 A;  1VFY A;  2MA5 A;  3LXJ A;  3ASL A;  4F1P A;  3GG3 A;  3I3J A;  3S91 A;  2RFJ A;  3JVK A;  5FE6 A;  4CUT A;  5KU3 A;  2YSJ A;  3ONI A;  3PUQ A;  5LKX A;  2VJF B;  3M63 A;  3RPG C;  5J0D A;  4O77 A;  5DW1 A;  5EPR A;  4OGE A;  5E9V A;  5G4S A;  3HCT A;  2QIC A;  5AD3 A;  1DCQ A;  3IHP A;  1LDJ B;  2MJV B;  5F25 A;  5HJC A;  4QF2 A;  5G0F A;  5IID A;  4O7C A;  1JSP B;  1WEO A;  4HBW A;  3VKH A;  5EV9 A;  4TU6 A;  2VJF A;  2YRE A;  4LYW A;  5ENB A;  2KR4 A;  4CL9 A;  4YBS A;  5DYX A;  4A9N A;  5J3X A;  4A9H A;  5FB0 A;  4HBV A;  5H85 A;  2KWO A;  4A4B A;  2RS9 B;  2OUO A;  4V3K C;  5D3J A;  3E2D A;  5EWV A;  4R2Y A;  5AIT A;  4NQM A;  4NUD A;  2YHO A;  4NYV A;  2LSP B;  3KQI A;  2YEM A;  4QC3 A;  4QR5 A;  3Q1D A;  5I3L A;  4HXO A;  5FE5 A;  4QSP A;  1WIM A;  3O47 A;  4N4F A;  5HQ5 A;  3N9L A;  4A0C D;  5KH7 A;  3ZVZ B;  5ENH A;  5C85 A;  5LJ0 A;  2H60 A;  2YQD A;  4XY8 A;  2LAU A;  3VK6 A;  2Y1M A;  4XUA A;  2KFT A;  4ZC9 A;  5ENF A;  5CQ3 A;  5E7D A;  5F36 A;  2RSD A;  4CA1 A;  5HEL A;  3FJU B;  5EPS A;  2YYN A;  4BBQ A;  5COI A;  5EM3 A;  4RVR A;  4Z93 A;  4FLP A;  3JVL A;  3U5P A;  4Z0O A;  4AI6 A;  5HFR A;  5EWH A;  4ZQL A;  4QUU A;  3DQV R;  5TDR A;  4WZ2 A;  5HQ6 A;  4O72 A;  2L84 A;  4E96 A;  3O36 A;  5TCM A;  2OO1 A;  4NR6 A;  5ENJ A;  3O35 A;  5FE3 A;  5A85 A;  3UVW A;  4MSX A;  4YAT A;  3LDY A;  4YYK A;  3TLP A;  2KKX A;  5EYA F;  4YYH A;  2VP7 A;  3ZPV 1;  5BT5 A;  4WA6 A;  5A81 A;  4UIY A;  5II1 A;  5DYC A;  4HXM A;  4YYN A;  4O64 A;  5EQ1 A;  3SOW A;  1VD4 A;  4GNG A;  2R0S A;  4BHW A; 
#chains in the Genus database with same CATH homology
 2D82 A;  4UYD A;  4YK0 A;  2LGK A;  3I2D A;  2L5E A;  2LXP C;  5H1V A;  5DFD A;  3RCW A;  5I86 A;  2KRE A;  4Z6H A;  4WHU A;  5CQ8 A;  5EU1 A;  5C4Q A;  2G43 A;  4TKP B;  5E9M A;  2YUC A;  5ENC A;  3IU6 A;  4PCE A;  4HXP A;  5II2 A;  5I89 A;  5LUU A;  5DYU A;  1MM3 A;  3QZV A;  5B78 A;  3SOU A;  2FUI A;  4LAD B;  2VNF A;  2D8S A;  1N72 A;  2YQM A;  5EI4 A;  5BT4 A;  1WFK A;  2ECV A;  1WIL A;  5HEN A;  4AP4 A;  3UVY A;  4J3I A;  4I7C A;  1V87 A;  3EB5 A;  2DVQ A;  5FE2 A;  5CQ6 A;  5CUB A;  2MNZ A;  4IOO A;  4OGJ A;  4LDF A;  4IR3 A;  3ZNI A;  2ECJ A;  2LN0 A;  4UIZ A;  5LJ1 A;  4YYM A;  5DLX A;  3HCU A;  5AME A;  2DAT A;  5TB6 A;  2NXB A;  2RO1 A;  3HMF A;  4LC2 A;  5I80 A;  5F3A A;  3V43 A;  5E9K A;  3MQM A;  1WEW A;  4TT6 A;  4X2I A;  5E3G A;  4YYG A;  4NRA A;  3N9N A;  4HXK A;  4MEN A;  3P1E A;  5LKT A;  4C67 A;  5I7Y A;  3KV6 A;  5DKA A;  4IR4 A;  2JMD A;  2LRI C;  4A9M A;  4B86 C;  4C9Z A;  4NN2 A;  5F5Z A;  4YAX A;  5CRZ A;  4N4I A;  5KH3 A;  3U5M A;  3AAD A;  4BW1 A;  1T1H A;  4TS8 A;  2LQ6 A;  4NS5 A;  4O70 A;  1FP0 A;  5ENI A;  3LQH A;  5DY7 A;  2ECN A;  3MHS A;  5LKZ A;  2KE1 A;  4CUP A;  3N9Q A;  3SVG A;  3LQI A;  4MEO A;  2Y1N A;  5CFW A;  5E73 A;  4UYF B;  4J0R A;  3JVM A;  4PKL A;  2K17 A;  2GRC A;  4Z1S A;  2KGI A;  4YAD A;  4CUR A;  5EWW A;  4MEQ A;  4LRG A;  2L75 A;  5D0C A;  5ACY A;  3D7C A;  4NYX A;  4UYG A;  4N4H A;  2KWN A;  3FKM X;  3ZTG A;  5IGL A;  5E0R A;  3O33 A;  4HXN A;  4UYF A;  1DVP A;  2UZG A;  1E4U A;  2HYE D;  3K2J A;  3UVD A;  4TQN A;  5FH6 A;  5B77 A;  3HMH A;  5IGN A;  4NR8 A;  5ENG A;  5LVQ A;  2L0B A;  5B8D A;  3U5K A;  5H1T A;  5D24 A;  4L58 A;  4N4G A;  4MR3 A;  2C2V S;  1ZS5 A;  5FFY A;  5B76 A;  3ZYU A;  2HDP A;  1U6G B;  5C8G A;  4LK9 A;  5EGU A;  3QZT A;  5E9Y A;  2M1R A;  5HRV A;  5ENE A;  3GV4 A;  5F63 A;  3DAI A;  4UYE A;  4CUQ A;  2CSZ A;  2E6S A;  2KU3 A;  4HBY A;  4ZW1 A;  5L8U A;  4QSQ A;  4OGI A;  4UIW A;  2LV9 A;  4IC2 A;  5E9L A;  3LRQ A;  5D3H A;  1XWH A;  5AMF A;  2MUM A;  1WEU A;  4UP5 A;  5F1H A;  5H1U A;  4UYH A;  5CS8 A;  4TZ2 A;  4FIP A;  4X3G A;  5TAB A;  1WE9 A;  4TYL A;  5EVA A;  5I1Q A;  4WZ3 B;  5EWC A;  3P1D A;  2BAY A;  5CQA A;  3O37 A;  5CUD A;  4NR9 A;  2YT5 A;  3HME A;  4A9K A;  5D1L B;  4TZ8 A;  4Q0N A;  4YH3 A;  1F68 A;  4NQN A;  4I7D A;  4PPE A;  4LLB A;  4N3W A;  4YH4 A;  4HBX A;  4A9I A;  5A5Q A;  4W4U A;  5F1L A;  4L7X A;  1MM2 A;  2VPE A;  4O74 A;  5AIU A;  3T7L A;  4YYI A;  5I29 A;  2F6N A;  5D7X A;  5CQ4 A;  5IGM A;  4QY4 A;  4FO9 A;  5FE8 A;  3N9P A;  4ALH A;  5C87 A;  1FBV A;  2LDR A;  3SOX A;  3MB4 A;  3U5N A;  5HEM A;  1VYX A;  2KIZ A;  5JWM A;  4QF3 A;  4WHW A;  2MA6 A;  5FE9 A;  1WUG A;  4UIT A;  5CQ5 A;  4I7B A;  2YYR A;  3ZPV E;  5HCL A;  5FH8 A;  5A5O A;  5CRM A;  2PNX A;  4Z1Q A;  2ECT A;  1JM4 B;  5KTX A;  2JMI A;  3UW9 A;  2LGV A;  4BW4 A;  1Z6U A;  5FE4 A;  5CUC A;  5D3N A;  5L97 A;  3L1X A;  5A5N A;  5JI8 A;  5E74 A;  4C66 A;  3KV5 A;  1WEP A;  2K16 A;  5FE7 A;  2YQL A;  4IR6 A;  5E3D A;  1N87 A;  4O7F A;  4KCX A;  2WP1 A;  5I88 A;  4WZ0 A;  5F60 A;  4QR4 A;  1WEE A;  2N9G A;  4LR6 A;  2YW8 A;  2XB1 A;  2WP2 A;  2VJE B;  4MR4 A;  5A5P A;  2EGP A;  2FSA A;  5D3S A;  2DX8 A;  2H0D B;  2JMJ A;  5C89 A;  3HCS A;  2EOD A;  1EQF A;  3MXF A;  5D1M B;  2QIZ A;  2D9E A;  1RMD A;  5TBN A;  5F61 A;  5I7X A;  3O34 A;  5H9M A;  2AN6 A;  4AUQ B;  4UP0 A;  5DKD A;  2L43 A;  5CP5 A;  5L98 A;  4HXS A;  2I7K A;  5FE0 A;  2OXQ C;  5I83 A;  4O71 A;  2H0D A;  1IYM A;  4MEP A;  2YEK A;  4TTE A;  5DIN A;  5C13 A;  4Y03 A;  2LGL A;  2DVR A;  2R0Y A;  3P1C A;  4HXR A;  4BW2 A;  5L99 A;  5G05 B;  5K29 A;  4XI1 A;  4QST A;  2E6R A;  5DKC A;  2E3K A;  3S92 A;  5A83 A;  4YBM A;  1E6I A;  5IBN A;  4NUC A;  5C7N A;  4NR7 A;  3ZVY A;  2YU4 A;  3MHH A;  4UIX A;  1JOC A;  4B7Y C;  5CGP A;  4O76 A;  5BT3 A;  2YEL A;  4FJC A;  4QSR A;  4NR5 A;  2Y43 A;  5IGK A;  4O75 A;  5EWD A;  4A9O A;  3FL2 A;  4ZUX U;  5FG5 A;  5G4R A;  1WGM A;  5D3T A;  3NXB A;  5DFB A;  4YY4 A;  5TRB A;  5FG4 A;  2MNY A;  3UV2 A;  4YBT A;  2C2L A;  4XY9 A;  5DYA A;  4XYA A;  5D1K B;  4A49 A;  3SVF A;  4O7E A;  4KV4 A;  4UIV A;  5CTL A;  2L5U A;  4QYL A;  4XUB A;  1F62 A;  5FBX A;  4R7E A;  5CUG A;  5HQ7 A;  5KO4 A;  3MUK A;  1BOR A;  5LVR A;  4YYJ A;  2DWW A;  3C5K A;  5FFW A;  5KHM A;  4QB3 A;  4AYC B;  4NR4 A;  4QSX A;  2M85 A;  3Q2F A;  5ETD A;  4YYD A;  5F2P A;  5DFC A;  2YUR A;  2XEU A;  4QEW A;  2EA6 A;  4PCI A;  5E9I A;  4GB0 A;  3N9M A;  4QBM A;  1WEV A;  4S3O C;  4LZ2 A;  3IU5 A;  4O7A A;  5CU8 A;  4YY6 A;  4PTB A;  2L85 A;  4ZDT A;  5A7C A;  4NRC A;  4QSS A;  2G4A A;  4AYC A;  5CPE A;  3T6R A;  2E7N A;  5L8T A;  3DPL R;  4IOQ A;  4GND A;  2FUU A;  2MD7 B;  4FK5 A;  5A5R A;  2RI7 A;  3U5O A;  3N9O A;  4NUE A;  4CCG X;  4BW3 A;  5HM0 A;  4R8P K;  3LQJ A;  3KNV A;  4Q6F A;  3SHB A;  1G25 A;  2RNX A;  5L96 A;  5DKH A;  5HFQ A;  5FER A;  4KV1 A;  5HLS A;  4V3L C;  5C11 A;  4IC3 A;  2M3H A;  4YAB A;  5EP7 A;  3GL6 A;  4O7B A;  2YW5 A;  2K1J A;  4NRB A;  4CUS A;  2I8N A;  4UIU A;  5KTU A;  4ALG A;  4DON A;  2LXH C;  1WEN A;  2CSY A;  1WUM A;  5B79 A;  4QUT A;  5B75 A;  2KYU A;  5FE1 A;  2YDW A;  5D26 A;  5ETB A;  3U5L A;  4MR5 A;  4OUF A;  4NYW A;  3MB3 A;  5AD2 A;  1CHC A;  1Z2Q A;  5KTW A;  5CQT A;  5DW2 A;  5D3R A;  2KWK A;  4Q0O A;  1X4I A;  4QEU A;  5EIC A;  5CQ7 A;  2YSM A;  5LKU A;  5A5S A;  4TU4 A;  2NAA A;  2MT5 A;  2ECW A;  4QR3 A;  3M62 A;  2DVS A;  1X4J A;  5KH9 A;  5DX4 A;  3MUL A;  4HXL A;  3UVX A;  4CFL A;  5FB1 A;  2QJ0 A;  5LCW B;  5A82 A;  2RNY A;  3Q2E A;  2IDA A;  2G45 A;  4QSV A;  4F52 B;  4NXJ A;  2G6Q A;  4GNF A;  4A9L A;  5F62 A;  4LJN A;  1X4U A;  4WIV A;  5D3L A;  4GPJ A;  3HTK C;  1X0J A;  4AVX A;  2R0V A;  3L1Z B;  3QZS A;  1HYJ A;  5IG6 A;  5HRW A;  2DKW A;  4QEV A;  3JVJ A;  2F42 A;  1HYI A;  4PS5 A;  2CKL B;  3PHD A;  5CZG A;  4P5O B;  2KWJ A;  1WEQ A;  2JRJ A;  4O78 A;  2VPG A;  2R10 A;  4IOR A;  3LJW A;  5EPB A;  2ECG A;  2I50 A;  3G0L A;  4CFK A;  4QZS A;  3P5O A;  4QSW A;  5DLZ A;  1K2F A;  4J0S A;  5CUA A;  2VPB A;  5FG6 A;  4AKN A;  3DWY A;  2CKL A;  2E7O A;  3AQA A;  5EK9 A;  5CUE A;  4CLB A;  4GNE A;  4QC1 A;  5EIS A;  5LJ2 A;  5FEY A;  2VJE A;  4A9J A;  2ZET C;  5FDZ A;  2VPD A;  2MD8 C;  2DVV A;  4MR6 A;  2CT2 A;  5FH7 A;  4LZS A;  4CUU A;  5CY9 A;  3C6W A;  2M6M A;  4IR5 A;  2LGG A;  4LKA A;  4A4C A;  5HRX A;  3O70 A;  1WES A;  3M99 A;  3PUR A;  5G04 B;  3RPG B;  5DBM A;  5EA1 A;  4MVT A;  4BJX A;  4F3I A;  2K4D A;  3EB6 A;  2MIQ A;  1JM7 B;  3UV5 A;  5D3P A;  2ECI A;  5JG6 A;  1Z60 A;  3RTR B;  4LYI A;  5FFV A;  5I40 A;  3UV4 A;  4QSU A;  3O7A A;  3P1F A;  4LYS A;  4LZR A;  4TT4 A;  3G0J A;  2KTB B;  4PY6 A;  2RNW A;  5D25 A;  2KGG A;  2YHN A;  1LDK C;  4A9F A;  4J1P A;  3L11 A;  3NG2 A;  4UI9 B;  2F6J A;  2OSS A;  4YC9 A;  4QYD A;  2PUY A;  3ZYQ A;  4QNS A;  4Z6I A;  3SVH A;  1WEM A;  3U5J A;  4A9E A;  2L80 A;  1ZBD B;  4S3O B;  5TDW A;  1JM7 A;  4TT2 A;  1VFY A;  2MA5 A;  3LXJ A;  3ASL A;  3GG3 A;  3I3J A;  3S91 A;  2RFJ A;  3JVK A;  5FE6 A;  4CUT A;  5KU3 A;  2YSJ A;  3ONI A;  3PUQ A;  5LKX A;  2VJF B;  3M63 A;  3RPG C;  5J0D A;  4O77 A;  5DW1 A;  5EPR A;  5E9V A;  5G4S A;  3HCT A;  2QIC A;  5AD3 A;  3IHP A;  1LDJ B;  2MJV B;  5F25 A;  5HJC A;  4QF2 A;  5G0F A;  5IID A;  4O7C A;  1JSP B;  1WEO A;  4HBW A;  2VJF A;  5EV9 A;  4TU6 A;  2YRE A;  4LYW A;  5ENB A;  2KR4 A;  4CL9 A;  4YBS A;  5DYX A;  4A9N A;  5J3X A;  4A9H A;  5FB0 A;  4HBV A;  5H85 A;  2KWO A;  4A4B A;  2RS9 B;  2OUO A;  4V3K C;  5D3J A;  5EWV A;  4R2Y A;  5AIT A;  4NQM A;  4NUD A;  2YHO A;  4NYV A;  2LSP B;  3KQI A;  2YEM A;  4QC3 A;  4QR5 A;  5I3L A;  4HXO A;  5FE5 A;  4QSP A;  1WIM A;  4N4F A;  5HQ5 A;  3N9L A;  4A0C D;  5KH7 A;  3ZVZ B;  5ENH A;  5C85 A;  5LJ0 A;  2H60 A;  2YQD A;  4XY8 A;  3VK6 A;  2Y1M A;  4XUA A;  2KFT A;  4ZC9 A;  5ENF A;  5CQ3 A;  5E7D A;  5F36 A;  2RSD A;  4CA1 A;  5HEL A;  5EPS A;  2YYN A;  4BBQ A;  5COI A;  5EM3 A;  4RVR A;  4Z93 A;  4FLP A;  3JVL A;  3U5P A;  5HFR A;  5EWH A;  4ZQL A;  4QUU A;  3DQV R;  5TDR A;  4WZ2 A;  5HQ6 A;  4O72 A;  2L84 A;  4E96 A;  3O36 A;  5TCM A;  2OO1 A;  4NR6 A;  5ENJ A;  3O35 A;  5FE3 A;  5A85 A;  3UVW A;  4MSX A;  4YAT A;  4YYK A;  3TLP A;  5EYA F;  4YYH A;  2VP7 A;  3ZPV 1;  5BT5 A;  4WA6 A;  5A81 A;  4UIY A;  5II1 A;  5DYC A;  4HXM A;  4YYN A;  4O64 A;  5EQ1 A;  3SOW A;  1VD4 A;  4GNG A;  2R0S A;  4BHW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...