2F6JA

Crystal structure of phd finger-linker-bromodomain fragment of human bptf in the h3(1-15)k4me3 bound state
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
168
structure length
168
Chain Sequence
b'DTKLYCICKTPYDESKFYIGCDRCQNWYHGRCVGILQSEAELIDEYVCPQCQSTEDAMTVLTPLTEKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLATMEERVQRRYYEKLTEFVADMTKIFDNCRYYNPSDSPFYQCAEVLESFFVQKLKGFK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords bromodomain PHD finger transcription factor
publication title Molecular basis for site-specific read-out of histone H3K4me3 by the BPTF PHD finger of NURF.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 49
structure length 168
sequence length 168
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2f6jA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2f6jA01
5FG4A 4MR4A 5CUDA 5I7XA 5D3TA 4QEUA 5FFWA 5BT4A 2KR4A 2HDPA 3ZPVE 5LKUA 3PUQA 3UVXA 5JG6A 2YHOA 3UV5A 4F52B 5EWHA 4BW4A 4UIUA 5CS8A 4HXSA 5HQ7A 4OUFA 2YSJA 5C85A 4HXRA 2L0BA 4O7CA 2WP1A 5EA1A 4CCGX 4XI1A 5H9MA 2LV9A 5EVAA 2Y1NA 2RNYA 5E73A 5II2A 2KFTA 4A9LA 2PNXA 5KTWA 5EQ1A 2R10A 2MIQA 4FIPA 4KV1A 5A7CA 5LUUA 3ZVZB 3SVFA 4YY4A 1LDJB 1HYIA 5AD3A 4HXMA 2LQ6A 3Q2EA 1WESA 4QBMA 2RI7A 4NXJA 4Q0OA 4QF3A 5I40A 4R7EA 4MEOA 4O64A 4UIXA 2R0VA 4LYWA 4MR6A 3MHHA 4NRBA 4QSXA 4NR9A 3U5JA 1JSPB 5B76A 5J3XA 2YURA 4UYDA 4ZQLA 5IIDA 3MB3A 2VP7A 3O37A 4A9IA 5B8DA 2ZETC 4GB0A 2KGIA 4MVTA 5CUEA 5LKZA 3SOUA 4YYJA 4O72A 2K1JA 5D3JA 5ENGA 2YQMA 5E3DA 4ALGA 4L7XA 5A5RA 5CRZA 5TDWA 4TQNA 5E3GA 3EB5A 3MQMA 3G0LA 5EPSA 3LQHA 5FE6A 4CUPA 4RVRA 4GNDA 2OXQC 5KH3A 4A9EA 5EPBA 2LGVA 4PCEA 4NR7A 2L5UA 5H1TA 5I29A 3O33A 2LXPC 2VPEA 3U5KA 4WZ2A 4LZ2A 3LQIA 4QUUA 4Z93A 1JM4B 2QICA 2YW8A 2VPGA 5A82A 5G04B 3U5NA 5EI4A 4LR6A 5CQ4A 4PTBA 5FE3A 3U5OA 2YYRA 3N9NA 5FDZA 4LKAA 2OSSA 2UZGA 4TT6A 2KWJA 3JVKA 1IYMA 2FSAA 4UYGA 5COIA 1WFKA 5ENHA 4GNGA 5E74A 4A9NA 5CUBA 4YYKA 5F36A 5C13A 5CQ8A 5B78A 4OGJA 2DWWA 5LKTA 2YEKA 2KE1A 1DVPA 3NG2A 5FH7A 4TT2A 4S3OC 1JM7B 4V3KC 3JVMA 5ETDA 4LRGA 3DAIA 5FE2A 5L96A 4QZSA 4UIZA 2RFJA 3HTKC 4LZSA 4MR3A 5C89A 1EQFA 4P5OB 5FG6A 5DW2A 4O7FA 3L1ZB 4NYWA 2KU3A 3O36A 2GRCA 4F3IA 5D3RA 3I3JA 2H60A 2RO1A 5F5ZA 5FFYA 5DKCA 5IGKA 1LDKC 4ZDTA 4O75A 4NS5A 4WHWA 5HRVA 4A9FA 3GL6A 4ZW1A 5HLSA 3C5KA 2F42A 5E9KA 2VJFB 4O71A 5HM0A 1F62A 4IC2A 4GNFA 1BORA 4X3GA 5EV9A 4HXOA 4A9OA 4A0CD 4OGIA 1U6GB 2JMDA 3GG3A 4CUUA 2HYED 4ZC9A 2CT2A 3HCTA 4WA6A 4PY6A 3NXBA 2YW5A 4UITA 3T6RA 2NXBA 4B7YC 3ZYUA 5FB0A 5DW1A 5HJCA 4IR5A 2VJEA 2G43A 3P1FA 5F61A 4IR6A 2ECNA 5FERA 3RTRB 5E9IA 5IBNA 2DVQA 5AMFA 1WEPA 4YAXA 3VK6A 4QSRA 5CQ6A 5J0DA 5FB1A 4XUBA 1RMDA 2MA5A 3RPGB 5DKDA 4QSWA 2D8SA 5DFBA 5F63A 1E4UA 2E7NA 4MSXA 2BAYA 5ACYA 5FE9A 2XEUA 1WE9A 5A5QA 1WEOA 4NR5A 2I50A 4MENA 4O7EA 5F3AA 3UVYA 2XB1A 3MUKA 3D7CA 5CY9A 2KREA 5LJ1A 5B75A 3AADA 3IU6A 4HXPA 3QZTA 5EISA 1X0JA 3Q2FA 5DYAA 5G0FA 5F60A 4J0RA 4E96A 4Z6IA 5EGUA 2E6SA 4FLPA 2CSYA 4AYCB 3QZSA 5CRMA 5EWWA 3LQJA 2I7KA 2DVRA 5CPEA 5L8TA 1WEMA 2LGLA 5FE5A 5C8GA 4QR4A 5C87A 5H1VA 4A4BA 4QYLA 4YATA 2VJFA 3PHDA 3P1CA 3ZPV1 3O35A 5EPRA 5HQ5A 5ENFA 5K29A 5D7XA 2FUIA 5HEMA 4UP0A 4LDFA 4YYMA 2KGGA 2VPBA 3T7LA 3MHSA 4NUDA 5A5SA 4O74A 5DYUA 3RPGC 5HCLA 5I86A 3RCWA 5KH9A 2JMIA 5DYXA 5D25A 3M99A 5DFCA 2KTBB 4HBWA 5F62A 2CSZA 2MJVB 3DPLR 4I7CA 5H85A 4S3OB 4CUQA 2YUCA 3PURA 2CKLB 4QSTA 4NQMA 5IGLA 2YDWA 5AITA 4O78A 4HBVA 4IOQA 2M6MA 3ZVYA 5TABA 4R8PK 5DYCA 4NR8A 5DBMA 3IU5A 4YH4A 4NQNA 5ENCA 4Z1QA 5I88A 2ECWA 3UV4A 2VPDA 4QC3A 3QZVA 4KV4A 1T1HA 2K16A 4N4GA 5HFRA 3N9LA 1WENA 4BJXA 5ENBA 4Q0NA 5KHMA 4C9ZA 1WUMA 3AQAA 4HBYA 4QR5A 5E9MA 5EU1A 5D24A 4CFLA 4QY4A 4QB3A 2MNZA 4UP5A 3P1EA 1XWHA 3SVGA 4UIWA 5EICA 4A9MA 4N4FA 4TZ8A 5CQTA 5EP7A 5EWVA 4A9KA 2QJ0A 3SOXA 3ZYQA 2DVVA 4AYCA 5B79A 5FE8A 5ENJA 4C66A 2LDRA 3LXJA 4UYEA 4AUQB 3HMFA 4TKPB 5L99A 3O7AA 5HQ6A 4BBQA 5FE0A 2RS9B 5DLXA 5KTUA 4YADA 4YBTA 2Y1MA 1ZS5A 3EB6A 5LJ2A 5EWDA 4QSQA 4BHWA 1VD4A 4YC9A 2L84A 5F25A 5TDRA 2LSPB 5LCWB 2DVSA 2YREA 4FK5A 5II1A 4Z6HA 4YH3A 2JRJA 4UI9B 3DWYA 4O76A 5CQ5A 5KTXA 5DFDA 4LK9A 2LN0A 4N4IA 4I7BA 4XUAA 3HMEA 5DKAA 4LYIA 3KNVA 3JVLA 2ECGA 3HCSA 4Y03A 5FH6A 5FH8A 3MULA 4NUEA 4DONA 4IOOA 5C7NA 5I7YA 2MA6A 5D1MB 2MD7B 5E0RA 5A5NA 4GNEA 2R0SA 4QSPA 3MXFA 3ASLA 4NR6A 3HCUA 1WEEA 4TYLA 5TCMA 5CP5A 1F68A 1Z2QA 4R2YA 4UIVA 4YYHA 1K2FA 2E7OA 5I3LA 2H0DB 4Q6FA 3S91A 3N9OA 4TS8A 5F2PA 5CZGA 2IDAA 4CLBA 5HRXA 2F6NA 4CUTA 3FKMX 4IORA 4TU4A 4X2IA 1V87A 4I7DA 2L75A 5EM3A 2N9GA 4PKLA 3ONIA 2LGKA 5HENA 2KWNA 4CURA 2DX8A 4Z1SA 3HMHA 4BW3A 2LRIC 5BT3A 4YYNA 4A9HA 4AVXA 4CL9A 5AMEA 4MEQA 1JM7A 4C67A 3G0JA 5I89A 5LJ0A 3C6WA 3K2JA 5E9YA 4LC2A 4NRAA 3FL2A 3P5OA 5DY7A 1WILA 3SHBA 5FE1A 3SVHA 2MNYA 4CUSA 4FJCA 4XYAA 5CQAA 4XY9A 3S92A 3DQVR 2G45A 4QF2A 1WGMA 5TBNA 4UYFB 5FEYA 3UVWA 3KQIA 5HRWA 1MM2A 2PUYA 5DX4A 2L5EA 5ENEA 2G4AA 3ZNIA 5CQ7A 5L98A 2I8NA 2C2LA 2RNXA 4UIYA 2YU4A 4PS5A 3SOWA 3P1DA 5DKHA 5FBXA 4CA1A 2K17A 4QEVA 4IR3A 4BW1A 1X4JA 5LVQA 4QR3A 2JMJA 3U5LA 5CQ3A 5EYAF 1WUGA 2YQDA 5ETBA 4ZUXU 3JVJA 4PPEA 5C11A 4WIVA 5A5PA 2H0DA 4AP4A 2OUOA 4QSUA 5I80A 3N9QA 5JWMA 1FP0A 5ENIA 4O7AA 2D82A 4LYSA 4QYDA 4YYIA 4AKNA 3KV6A 5FG5A 2L85A 4ALHA 4WHUA 5B77A 1N87A 2C2VS 2YQLA 3IHPA 5EK9A 4QC1A 4QEWA 4LLBA 2RNWA 5D26A 2EODA 4J0SA 4WZ3B 5G05B 4QSSA 4NR4A 1X4IA 5L97A 5A83A 2ECIA 4HXNA 5A85A 5DLZA 1Z6UA 2MT5A 2DKWA 4PCIA 2L80A 5G4SA 5A5OA 2F6JA 3U5MA 4W4UA 4O7BA 5I83A 4HBXA 4J1PA 1ZBDB 3MB4A 4FO9A 5I1QA 4LJNA 5CGPA 4TZ2A 3L1XA 5A81A 2YT5A 5HFQA 1VFYA 1Z60A 2M1RA 2K4DA 4J3IA 2YELA 3O34A 5JI8A 1WEVA 4LADB 5HELA 4UYFA 2LXHC 2MUMA 2EA6A 4B86C 2WP2A 1FBVA 5D0CA 3M62A 5KH7A 3N9PA 2AN6A 5D3HA 4HXLA 2KWOA 4QUTA 5E7DA 1HYJA 1JOCA 5EWCA 2YYNA 1WEUA 4IR4A 2YSMA 2ECTA 4V3LC 4A9JA 2DATA 3O70A 4TU6A 4NRCA 2E3KA 5IGNA 3ZTGA 5FFVA 2E6RA 3GV4A 4N3WA 4NUCA 1MM3A 5D1LB 1E6IA 2KIZA 2YHNA 4XY8A 1N72A 4YYGA 4NN2A 2YEMA 2RSDA 2M3HA 2G6QA 4CFKA 5FE7A 5CTLA 5D1KB 4YY6A 2VJEB 2D9EA 4NYXA 5DINA 2CKLA 5BT5A 1G25A 2OO1A 4A4CA 3UVDA 4HXKA 5CFWA 3TLPA 1X4UA 2ECVA 4BW2A 3LJWA 5LVRA 2LGGA 5F1LA 3I2DA 3L11A 2QIZA 5KO4A 5D3SA 5LKXA 5KU3A 5TRBA 5IG6A 2KYUA 4YBMA 3LRQA 5D3PA 4WZ0A 1WEQA 4YK0A 5L8UA 2M85A 4L58A 5F1HA 5H1UA 3M63A 4LZRA 5CU8A 4TT4A 3N9MA 4GPJA 4MEPA 4QSVA 4A49A 3UV2A 4YABA 2VNFA 5D3LA 2FUUA 4TTEA 2EGPA 4UYHA 4O77A 4NYVA 5TB6A 5E9LA 5AD2A 5CUAA 1WIMA 3V43A 3UW9A 1CHCA 4KCXA 5D3NA 4MR5A 2L43A 2NAAA 2R0YA 5E9VA 4N4HA 2Y43A 2MD8C 2ECJA 5C4QA 1VYXA 4O70A 5CUCA 4QNSA 4YYDA 3KV5A 5G4RA 4IC3A 5IGMA 5FE4A 3U5PA 5CUGA 2KWKA 5AIUA 1WEWA 4YBSA
chains in the Genus database with same CATH superfamily
5FG4A 4MR4A 5CUDA 5I7XA 5D3TA 4QEUA 5FFWA 5BT4A 2KKXA 2CRWA 2HDPA 3ZPVE 2P57A 5LKUA 3PUQA 2JUNA 3UVXA 5JG6A 2YHOA 3UV5A 4F52B 5EWHA 4BW4A 4UIUA 5CS8A 4HXSA 5HQ7A 4OUFA 2YSJA 5C85A 4HXRA 2L0BA 4O7CA 2WP1A 5EA1A 4CCGX 4XI1A 5H9MA 2LV9A 5EVAA 2Y1NA 2RNYA 5E73A 5II2A 2KFTA 4A9LA 2PNXA 5KTWA 5EQ1A 2R10A 2MIQA 4FIPA 4KV1A 5A7CA 5LUUA 3ZVZB 3SVFA 4YY4A 1LDJB 1HYIA 5AD3A 4HXMA 2XOZA 2LQ6A 3Q2EA 1WESA 4QBMA 2KKYA 2RI7A 4NXJA 4Q0OA 4QF3A 5SVYA 5I40A 4R7EA 4MEOA 4O64A 4UIXA 2R0VA 4LYWA 4MR6A 3MHHA 2XOCA 4NRBA 4QSXA 4NR9A 3U5JA 1JSPB 5B76A 5J3XA 2DSMA 2YURA 4UYDA 4ZQLA 5IIDA 3MB3A 2VP7A 3O37A 4A9IA 5B8DA 2YVRA 2ZETC 4GB0A 2KGIA 3FM8C 4MVTA 5CUEA 5LKZA 3SOUA 4YYJA 4O72A 3DWDA 2K1JA 5D3JA 5ENGA 2YQMA 5E3DA 4ALGA 4L7XA 5A5RA 3M7KA 5CRZA 5TDWA 4TQNA 5E3GA 2L7PA 3EB5A 3MQMA 3G0LA 5EPSA 3LQHA 5FE6A 4CUPA 2EGMA 4RVRA 4GNDA 2OXQC 5KH3A 4A9EA 5EPBA 2LGVA 4PCEA 4NR7A 2L5UA 5H1TA 5I29A 3O33A 2LXPC 2VPEA 3U5KA 4WZ2A 4LZ2A 3LQIA 4QUUA 4Z93A 1JM4B 2QICA 2YW8A 2VPGA 5A82A 5G04B 3U5NA 5EI4A 4LR6A 5CQ4A 4PTBA 5FE3A 3U5OA 2YYRA 2IQJA 3N9NA 3LDYA 5FDZA 4LKAA 2OSSA 2UZGA 4TT6A 2KWJA 3JVKA 1IYMA 2FSAA 4UYGA 5COIA 4AKIA 1WFKA 5ENHA 4GNGA 5E74A 4A9NA 2LAUA 5CUBA 4YYKA 5F36A 5C13A 5CQ8A 5B78A 4OGJA 2DWWA 5LKTA 3FJUB 2YEKA 2KE1A 1DVPA 3NG2A 5FH7A 4TT2A 4S3OC 1JM7B 4V3KC 3JVMA 5ETDA 4LRGA 3DAIA 5FE2A 5L96A 4QZSA 4UIZA 2RFJA 3HTKC 4LZSA 4MR3A 5C89A 1EQFA 4P5OB 5FG6A 2M13A 5DW2A 4Z0RA 4O7FA 3L1ZB 2RR4A 4NYWA 2KU3A 3O36A 2GRCA 3O47A 4F3IA 5D3RA 3I3JA 2H60A 2RO1A 4O62A 5F5ZA 5FFYA 5DKCA 5IGKA 1LDKC 4ZDTA 4O75A 4NS5A 4WHWA 5HRVA 4A9FA 3GL6A 4ZW1A 5HLSA 3C5KA 2F42A 5E9KA 3FAOA 5SVIB 2VJFB 4O71A 5HM0A 1F62A 4IC2A 4GNFA 1BORA 4X3GA 5EV9A 4HXOA 4A9OA 4A0CD 4OGIA 1U6GB 2JMDA 3GG3A 4CUUA 2D8UA 2HYED 4ZC9A 2CT2A 2OWAA 3DDTA 3HCTA 4WA6A 4PY6A 3NXBA 2YW5A 4UITA 3T6RA 2NXBA 4B7YC 3ZYUA 5FB0A 5DW1A 5HJCA 4IR5A 2VJEA 2G43A 3P1FA 5F61A 4IR6A 1MBMA 2ECNA 5FERA 3RTRB 5E9IA 5IBNA 2DVQA 5AMFA 1WEPA 4YAXA 3VK6A 4QSRA 5CQ6A 5J0DA 5FB1A 4XUBA 1RMDA 2MA5A 3RPGB 5DKDA 4QSWA 2D8SA 5DFBA 5F63A 1E4UA 2E7NA 4MSXA 2BAYA 5ACYA 5FE9A 2XEUA 1WE9A 5A5QA 1WEOA 4NR5A 2I50A 4MENA 4O7EA 5F3AA 3UVYA 2XB1A 3MUKA 3D7CA 5CY9A 2KREA 5LJ1A 5B75A 3AADA 3IU6A 4HXPA 3QZTA 5EISA 1X0JA 3Q2FA 5DYAA 5G0FA 5F60A 4J0RA 4WZ3B 4E96A 4Z6IA 5EGUA 2E6SA 4FLPA 4Z0OA 3LVRE 2CSYA 4AYCB 3QZSA 5CRMA 5EWWA 3LQJA 2I7KA 2DVRA 5CPEA 5L8TA 1WEMA 2LGLA 5FE5A 5C8GA 4QR4A 5C87A 5H1VA 4A4BA 4QYLA 4YATA 5SVIA 2VJFA 3PHDA 3P1CA 3ZPV1 3O35A 5EPRA 5HQ5A 5ENFA 5K29A 3VKHA 5D7XA 2FUIA 5HEMA 3SUBA 4UP0A 4LDFA 4YYMA 2KGGA 2VPBA 3T7LA 3D1BA 3MHSA 4NUDA 5A5SA 4O74A 5DYUA 3RPGC 5HCLA 5I86A 3RCWA 5KH9A 2JMIA 5DYXA 5D25A 3M99A 5DFCA 2KTBB 4HBWA 5F62A 2CSZA 2MJVB 3DPLR 4I7CA 4QQ4A 5H85A 4S3OB 4CUQA 2YUCA 3PURA 2CKLB 4QSTA 4NQMA 5IGLA 2YDWA 3ERRA 4O78A 4HBVA 4IOQA 5AITA 2M6MA 3ZVYA 5TABA 4R8PK 5DYCA 4NR8A 5DBMA 3IU5A 4YH4A 4NQNA 5ENCA 4Z1QA 5I88A 1ZKRA 2ECWA 3UV4A 4AKHA 2VPDA 4QC3A 2CRRA 3QZVA 4KV4A 1T1HA 2K16A 4N4GA 5HFRA 3N9LA 1WENA 4BJXA 5ENBA 4Q0NA 2KR4A 5KHMA 4C9ZA 1WUMA 3AQAA 4HBYA 4QR5A 5E9MA 5EU1A 5D24A 4CFLA 4QY4A 4QB3A 2MNZA 4UP5A 3P1EA 1XWHA 3SVGA 4UIWA 5EICA 4A9MA 4N4FA 4TZ8A 5CQTA 5EP7A 5EWVA 4A9KA 2QJ0A 3SOXA 3ZYQA 2DVVA 4AYCA 5B79A 5FE8A 5ENJA 4C66A 2LDRA 3LXJA 4UYEA 2MKEA 3HMFA 4AUQB 4TKPB 5L99A 4AKGA 3FANA 5HQ6A 3O7AA 4BBQA 5FE0A 2RS9B 5DLXA 5KTUA 2XOYA 4YADA 4YBTA 2Y1MA 1ZS5A 3EB6A 5LJ2A 5EWDA 4QSQA 4BHWA 1VD4A 4YC9A 2L84A 5F25A 5TDRA 2LSPB 4OGCA 2EJNA 5LCWB 2DVSA 2YREA 4FK5A 5II1A 4Z6HA 4YH3A 2JRJA 4UI9B 3DWYA 4O76A 5CQ5A 5KTXA 5DFDA 4LK9A 2LN0A 4N4IA 4I7BA 4XUAA 3HMEA 5DKAA 4LYIA 2EXUA 3KNVA 3JVLA 2ECGA 3HCSA 4Y03A 3JUEA 5FH6A 5FH8A 3MULA 2DJAA 4NUEA 4DONA 4IOOA 5C7NA 5I7YA 2CONA 2MA6A 3LJUX 2MD7B 5D1MB 5E0RA 5A5NA 4GNEA 2R0SA 4QSPA 3MXFA 3ASLA 3D1DA 4NR6A 1WEEA 4TYLA 5TCMA 5CP5A 1F68A 1Z2QA 3HCUA 4H9DA 4UIVA 4YYHA 4R2YA 1K2FA 2E7OA 5I3LA 2H0DB 4Q6FA 3S91A 3N9OA 4TS8A 5F2PA 5CZGA 2IDAA 4CLBA 5HRXA 2F6NA 4CUTA 3FKMX 4IORA 4TU4A 4X2IA 1V87A 4I7DA 2L75A 5EM3A 2N9GA 4PKLA 3ONIA 2LGKA 5HENA 2KWNA 4CURA 2DX8A 4Z1SA 3HMHA 4BW3A 2LRIC 5BT3A 4YYNA 4A9HA 4AVXA 4CL9A 5AMEA 4MEQA 1JM7A 4C67A 3G0JA 5I89A 5LJ0A 3C6WA 3K2JA 5E9YA 4LC2A 4NRAA 3FL2A 3P5OA 5DY7A 1WILA 3SHBA 5FE1A 3SVHA 2MNYA 5SVXA 4CUSA 4FJCA 4XYAA 5CQAA 4XY9A 3S92A 3DQVR 2G45A 4QF2A 1WGMA 5TBNA 4UYFB 2FFWA 5FEYA 3H7HA 3UVWA 3KQIA 5HRWA 1MM2A 2PUYA 5DX4A 2L5EA 5ENEA 3T9KA 2G4AA 3ZNIA 5CQ7A 5L98A 2I8NA 2C2LA 2RNXA 4UIYA 2YU4A 4PS5A 3SOWA 3P1DA 5DKHA 5FBXA 4CA1A 2K17A 4QEVA 4IR3A 4BW1A 1X4JA 5LVQA 4QR3A 2JMJA 3U5LA 5CQ3A 5EYAF 1WUGA 2YQDA 5ETBA 4ZUXU 3JVJA 4PPEA 5C11A 4WIVA 5A5PA 2H0DA 4AP4A 2OUOA 4QSUA 5I80A 3N9QA 5JWMA 1FP0A 5ENIA 4O7AA 2D82A 4LYSA 4QYDA 3FEHA 4YYIA 4AKNA 3KV6A 3Q1DA 5FG5A 2L85A 1PUOA 4ALHA 4WHUA 5B77A 1N87A 2C2VS 2YQLA 3IHPA 5EK9A 4QC1A 4QEWA 4LLBA 2RNWA 5D26A 2EODA 4J0SA 2FD4A 5G05B 4QSSA 4NR4A 1X4IA 5L97A 5A83A 2JM3A 2ECIA 4HXNA 5A85A 5DLZA 1Z6UA 2MT5A 2DKWA 4PCIA 2L80A 5G4SA 5A5OA 2B0OE 2F6JA 3U5MA 4W4UA 4O7BA 5I83A 4HBXA 4J1PA 1ZBDB 3MB4A 4FO9A 5I1QA 4LJNA 5CGPA 4TZ2A 1DCQA 3L1XA 5A81A 2YT5A 5HFQA 1VFYA 1Z60A 5K3QA 2M1RA 3LVQE 2K4DA 4J3IA 2YELA 3O34A 5JI8A 1WEVA 4LADB 5HELA 4UYFA 2LXHC 2MUMA 2EA6A 4B86C 2WP2A 1FBVA 5D0CA 3M62A 5KH7A 3N9PA 2AN6A 5D3HA 4HXLA 2KWOA 4QUTA 5E7DA 1HYJA 1JOCA 4F1PA 5EWCA 2YYNA 1WEUA 4IR4A 2YSMA 2ECTA 4V3LC 3MDBC 4A9JA 2DATA 3O70A 4TU6A 4NRCA 2E3KA 5IGNA 3ZTGA 5FFVA 2E6RA 3GV4A 4N3WA 4NUCA 3VKGA 1MM3A 1E6IA 2KIZA 5D1LB 2CSVA 4AI6A 2YHNA 4XY8A 1N72A 4YYGA 4NN2A 2YEMA 2RSDA 2M3HA 2G6QA 4CFKA 5FE7A 5CTLA 5D1KB 4YY6A 2VJEB 2D9EA 3KDEC 4NYXA 5DINA 2CKLA 3PLWA 5BT5A 1G25A 2OO1A 4A4CA 3UVDA 4HXKA 5CFWA 3TLPA 1X4UA 2ECVA 4BW2A 3LJWA 5LVRA 2LGGA 5F1LA 3I2DA 3L11A 2QIZA 5KO4A 5D3SA 5LKXA 5KU3A 5TRBA 5IG6A 2KYUA 2XP0A 4YBMA 3LRQA 5D3PA 4WZ0A 1WEQA 4YK0A 5L8UA 2M85A 4L58A 5F1HA 5H1UA 3M63A 4LZRA 5CU8A 4TT4A 3N9MA 2E61A 4GPJA 4MEPA 4QSVA 4OGEA 4A49A 3UV2A 4YABA 2VNFA 5D3LA 2FUUA 4TTEA 2EGPA 4UYHA 4O77A 4NYVA 5TB6A 5E9LA 5AD2A 5CUAA 1WIMA 3V43A 3UW9A 1CHCA 4KCXA 5D3NA 4MR5A 2L43A 2NAAA 2R0YA 5E9VA 4N4HA 2Y43A 2MD8C 2ECJA 5C4QA 1VYXA 4O70A 5CUCA 4QNSA 4YYDA 3KV5A 5G4RA 4IC3A 5IGMA 5FE4A 3U5PA 5CUGA 2KWKA 5AIUA 1WEWA 3E2DA 4YBSA
chains in the Genus database with same CATH topology
5FG4A 4MR4A 5CUDA 5I7XA 5D3TA 4QEUA 5FFWA 5BT4A 2KR4A 2HDPA 3ZPVE 5LKUA 3PUQA 3UVXA 5JG6A 2YHOA 3UV5A 4F52B 5EWHA 4BW4A 4UIUA 5CS8A 4HXSA 5HQ7A 4OUFA 2YSJA 5C85A 4HXRA 2L0BA 4O7CA 2WP1A 5EA1A 4CCGX 4XI1A 5H9MA 2LV9A 5EVAA 2Y1NA 2RNYA 5E73A 5II2A 2KFTA 4A9LA 2PNXA 5KTWA 5EQ1A 2R10A 2MIQA 4FIPA 4KV1A 5A7CA 5LUUA 3ZVZB 3SVFA 4YY4A 1LDJB 1HYIA 5AD3A 4HXMA 2LQ6A 3Q2EA 1WESA 4QBMA 2RI7A 4NXJA 4Q0OA 4QF3A 5I40A 4R7EA 4MEOA 4O64A 4UIXA 2R0VA 4LYWA 4MR6A 3MHHA 4NRBA 4QSXA 4NR9A 3U5JA 1JSPB 5B76A 5J3XA 2YURA 4UYDA 4ZQLA 5IIDA 3MB3A 2VP7A 3O37A 4A9IA 5B8DA 2ZETC 4GB0A 2KGIA 4MVTA 5CUEA 5LKZA 3SOUA 4YYJA 4O72A 2K1JA 5D3JA 5ENGA 2YQMA 5E3DA 4ALGA 4L7XA 5A5RA 5CRZA 5TDWA 4TQNA 5E3GA 3EB5A 3MQMA 3G0LA 5EPSA 3LQHA 5FE6A 4CUPA 4RVRA 4GNDA 2OXQC 5KH3A 4A9EA 5EPBA 2LGVA 4PCEA 4NR7A 2L5UA 5H1TA 5I29A 3O33A 2LXPC 2VPEA 3U5KA 4WZ2A 4LZ2A 3LQIA 4QUUA 4Z93A 1JM4B 2QICA 2YW8A 2VPGA 5A82A 5G04B 3U5NA 5EI4A 4LR6A 5CQ4A 4PTBA 5FE3A 3U5OA 2YYRA 3N9NA 5FDZA 4LKAA 2OSSA 2UZGA 4TT6A 2KWJA 3JVKA 1IYMA 2FSAA 4UYGA 5COIA 1WFKA 5ENHA 4GNGA 5E74A 4A9NA 5CUBA 4YYKA 5F36A 5C13A 5CQ8A 5B78A 4OGJA 2DWWA 5LKTA 2YEKA 2KE1A 1DVPA 3NG2A 5FH7A 4TT2A 4S3OC 1JM7B 4V3KC 3JVMA 5ETDA 4LRGA 3DAIA 5FE2A 5L96A 4QZSA 4UIZA 2RFJA 3HTKC 4LZSA 4MR3A 5C89A 1EQFA 4P5OB 5FG6A 5DW2A 4O7FA 3L1ZB 4NYWA 2KU3A 3O36A 2GRCA 4F3IA 5D3RA 3I3JA 2H60A 2RO1A 5F5ZA 5FFYA 5DKCA 5IGKA 1LDKC 4ZDTA 4O75A 4NS5A 4WHWA 5HRVA 4A9FA 3GL6A 4ZW1A 5HLSA 3C5KA 2F42A 5E9KA 2VJFB 4O71A 5HM0A 1F62A 4IC2A 4GNFA 1BORA 4X3GA 5EV9A 4HXOA 4A9OA 4A0CD 4OGIA 1U6GB 2JMDA 3GG3A 4CUUA 2HYED 4ZC9A 2CT2A 3HCTA 4WA6A 4PY6A 3NXBA 2YW5A 4UITA 3T6RA 2NXBA 4B7YC 3ZYUA 5FB0A 5DW1A 5HJCA 4IR5A 2VJEA 2G43A 3P1FA 5F61A 4IR6A 2ECNA 5FERA 3RTRB 5E9IA 5IBNA 2DVQA 5AMFA 1WEPA 4YAXA 3VK6A 4QSRA 5CQ6A 5J0DA 5FB1A 4XUBA 1RMDA 2MA5A 3RPGB 5DKDA 4QSWA 2D8SA 5DFBA 5F63A 1E4UA 2E7NA 4MSXA 2BAYA 5ACYA 5FE9A 2XEUA 1WE9A 5A5QA 1WEOA 4NR5A 2I50A 4MENA 4O7EA 5F3AA 3UVYA 2XB1A 3MUKA 3D7CA 5CY9A 2KREA 5LJ1A 5B75A 3AADA 3IU6A 4HXPA 3QZTA 5EISA 1X0JA 3Q2FA 5DYAA 5G0FA 5F60A 4J0RA 4E96A 4Z6IA 5EGUA 2E6SA 4FLPA 2CSYA 4AYCB 3QZSA 5CRMA 5EWWA 3LQJA 2I7KA 2DVRA 5CPEA 5L8TA 1WEMA 2LGLA 5FE5A 5C8GA 4QR4A 5C87A 5H1VA 4A4BA 4QYLA 4YATA 2VJFA 3PHDA 3P1CA 3ZPV1 3O35A 5EPRA 5HQ5A 5ENFA 5K29A 5D7XA 2FUIA 5HEMA 4UP0A 4LDFA 4YYMA 2KGGA 2VPBA 3T7LA 3MHSA 4NUDA 5A5SA 4O74A 5DYUA 3RPGC 5HCLA 5I86A 3RCWA 5KH9A 2JMIA 5DYXA 5D25A 3M99A 5DFCA 2KTBB 4HBWA 5F62A 2CSZA 2MJVB 3DPLR 4I7CA 5H85A 4S3OB 4CUQA 2YUCA 3PURA 2CKLB 4QSTA 4NQMA 5IGLA 2YDWA 5AITA 4O78A 4HBVA 4IOQA 2M6MA 3ZVYA 5TABA 4R8PK 5DYCA 4NR8A 5DBMA 3IU5A 4YH4A 4NQNA 5ENCA 4Z1QA 5I88A 2ECWA 3UV4A 2VPDA 4QC3A 3QZVA 4KV4A 1T1HA 2K16A 4N4GA 5HFRA 3N9LA 1WENA 4BJXA 5ENBA 4Q0NA 5KHMA 4C9ZA 1WUMA 3AQAA 4HBYA 4QR5A 5E9MA 5EU1A 5D24A 4CFLA 4QY4A 4QB3A 2MNZA 4UP5A 3P1EA 1XWHA 3SVGA 4UIWA 5EICA 4A9MA 4N4FA 4TZ8A 5CQTA 5EP7A 5EWVA 4A9KA 2QJ0A 3SOXA 3ZYQA 2DVVA 4AYCA 5B79A 5FE8A 5ENJA 4C66A 2LDRA 3LXJA 4UYEA 4AUQB 3HMFA 4TKPB 5L99A 3O7AA 5HQ6A 4BBQA 5FE0A 2RS9B 5DLXA 5KTUA 4YADA 4YBTA 2Y1MA 1ZS5A 3EB6A 5LJ2A 5EWDA 4QSQA 4BHWA 1VD4A 4YC9A 2L84A 5F25A 5TDRA 2LSPB 5LCWB 2DVSA 2YREA 4FK5A 5II1A 4Z6HA 4YH3A 2JRJA 4UI9B 3DWYA 4O76A 5CQ5A 5KTXA 5DFDA 4LK9A 2LN0A 4N4IA 4I7BA 4XUAA 3HMEA 5DKAA 4LYIA 3KNVA 3JVLA 2ECGA 3HCSA 4Y03A 5FH6A 5FH8A 3MULA 4NUEA 4DONA 4IOOA 5C7NA 5I7YA 2MA6A 5D1MB 2MD7B 5E0RA 5A5NA 4GNEA 2R0SA 4QSPA 3MXFA 3ASLA 4NR6A 3HCUA 1WEEA 4TYLA 5TCMA 5CP5A 1F68A 1Z2QA 4R2YA 4UIVA 4YYHA 1K2FA 2E7OA 5I3LA 2H0DB 4Q6FA 3S91A 3N9OA 4TS8A 5F2PA 5CZGA 2IDAA 4CLBA 5HRXA 2F6NA 4CUTA 3FKMX 4IORA 4TU4A 4X2IA 1V87A 4I7DA 2L75A 5EM3A 2N9GA 4PKLA 3ONIA 2LGKA 5HENA 2KWNA 4CURA 2DX8A 4Z1SA 3HMHA 4BW3A 2LRIC 5BT3A 4YYNA 4A9HA 4AVXA 4CL9A 5AMEA 4MEQA 1JM7A 4C67A 3G0JA 5I89A 5LJ0A 3C6WA 3K2JA 5E9YA 4LC2A 4NRAA 3FL2A 3P5OA 5DY7A 1WILA 3SHBA 5FE1A 3SVHA 2MNYA 4CUSA 4FJCA 4XYAA 5CQAA 4XY9A 3S92A 3DQVR 2G45A 4QF2A 1WGMA 5TBNA 4UYFB 5FEYA 3UVWA 3KQIA 5HRWA 1MM2A 2PUYA 5DX4A 2L5EA 5ENEA 2G4AA 3ZNIA 5CQ7A 5L98A 2I8NA 2C2LA 2RNXA 4UIYA 2YU4A 4PS5A 3SOWA 3P1DA 5DKHA 5FBXA 4CA1A 2K17A 4QEVA 4IR3A 4BW1A 1X4JA 5LVQA 4QR3A 2JMJA 3U5LA 5CQ3A 5EYAF 1WUGA 2YQDA 5ETBA 4ZUXU 3JVJA 4PPEA 5C11A 4WIVA 5A5PA 2H0DA 4AP4A 2OUOA 4QSUA 5I80A 3N9QA 5JWMA 1FP0A 5ENIA 4O7AA 2D82A 4LYSA 4QYDA 4YYIA 4AKNA 3KV6A 5FG5A 2L85A 4ALHA 4WHUA 5B77A 1N87A 2C2VS 2YQLA 3IHPA 5EK9A 4QC1A 4QEWA 4LLBA 2RNWA 5D26A 2EODA 4J0SA 4WZ3B 5G05B 4QSSA 4NR4A 1X4IA 5L97A 5A83A 2ECIA 4HXNA 5A85A 5DLZA 1Z6UA 2MT5A 2DKWA 4PCIA 2L80A 5G4SA 5A5OA 2F6JA 3U5MA 4W4UA 4O7BA 5I83A 4HBXA 4J1PA 1ZBDB 3MB4A 4FO9A 5I1QA 4LJNA 5CGPA 4TZ2A 3L1XA 5A81A 2YT5A 5HFQA 1VFYA 1Z60A 2M1RA 2K4DA 4J3IA 2YELA 3O34A 5JI8A 1WEVA 4LADB 5HELA 4UYFA 2LXHC 2MUMA 2EA6A 4B86C 2WP2A 1FBVA 5D0CA 3M62A 5KH7A 3N9PA 2AN6A 5D3HA 4HXLA 2KWOA 4QUTA 5E7DA 1HYJA 1JOCA 5EWCA 2YYNA 1WEUA 4IR4A 2YSMA 2ECTA 4V3LC 4A9JA 2DATA 3O70A 4TU6A 4NRCA 2E3KA 5IGNA 3ZTGA 5FFVA 2E6RA 3GV4A 4N3WA 4NUCA 1MM3A 5D1LB 1E6IA 2KIZA 2YHNA 4XY8A 1N72A 4YYGA 4NN2A 2YEMA 2RSDA 2M3HA 2G6QA 4CFKA 5FE7A 5CTLA 5D1KB 4YY6A 2VJEB 2D9EA 4NYXA 5DINA 2CKLA 5BT5A 1G25A 2OO1A 4A4CA 3UVDA 4HXKA 5CFWA 3TLPA 1X4UA 2ECVA 4BW2A 3LJWA 5LVRA 2LGGA 5F1LA 3I2DA 3L11A 2QIZA 5KO4A 5D3SA 5LKXA 5KU3A 5TRBA 5IG6A 2KYUA 4YBMA 3LRQA 5D3PA 4WZ0A 1WEQA 4YK0A 5L8UA 2M85A 4L58A 5F1HA 5H1UA 3M63A 4LZRA 5CU8A 4TT4A 3N9MA 4GPJA 4MEPA 4QSVA 4A49A 3UV2A 4YABA 2VNFA 5D3LA 2FUUA 4TTEA 2EGPA 4UYHA 4O77A 4NYVA 5TB6A 5E9LA 5AD2A 5CUAA 1WIMA 3V43A 3UW9A 1CHCA 4KCXA 5D3NA 4MR5A 2L43A 2NAAA 2R0YA 5E9VA 4N4HA 2Y43A 2MD8C 2ECJA 5C4QA 1VYXA 4O70A 5CUCA 4QNSA 4YYDA 3KV5A 5G4RA 4IC3A 5IGMA 5FE4A 3U5PA 5CUGA 2KWKA 5AIUA 1WEWA 4YBSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FG4 A;  4MR4 A;  5CUD A;  5I7X A;  5D3T A;  4QEU A;  5FFW A;  5BT4 A;  2KR4 A;  2HDP A;  3ZPV E;  5LKU A;  3PUQ A;  3UVX A;  5JG6 A;  2YHO A;  3UV5 A;  4F52 B;  5EWH A;  4BW4 A;  4UIU A;  5CS8 A;  4HXS A;  5HQ7 A;  4OUF A;  2YSJ A;  5C85 A;  4HXR A;  2L0B A;  4O7C A;  2WP1 A;  5EA1 A;  4CCG X;  4XI1 A;  5H9M A;  2LV9 A;  5EVA A;  2Y1N A;  2RNY A;  5E73 A;  5II2 A;  2KFT A;  4A9L A;  2PNX A;  5KTW A;  5EQ1 A;  2R10 A;  2MIQ A;  4FIP A;  4KV1 A;  5A7C A;  5LUU A;  3ZVZ B;  3SVF A;  4YY4 A;  1LDJ B;  1HYI A;  5AD3 A;  4HXM A;  2LQ6 A;  3Q2E A;  1WES A;  4QBM A;  2RI7 A;  4NXJ A;  4Q0O A;  4QF3 A;  5I40 A;  4R7E A;  4MEO A;  4O64 A;  4UIX A;  2R0V A;  4LYW A;  4MR6 A;  3MHH A;  4NRB A;  4QSX A;  4NR9 A;  3U5J A;  1JSP B;  5B76 A;  5J3X A;  2YUR A;  4UYD A;  4ZQL A;  5IID A;  3MB3 A;  2VP7 A;  3O37 A;  4A9I A;  5B8D A;  2ZET C;  4GB0 A;  2KGI A;  4MVT A;  5CUE A;  5LKZ A;  3SOU A;  4YYJ A;  4O72 A;  2K1J A;  5D3J A;  5ENG A;  2YQM A;  5E3D A;  4ALG A;  4L7X A;  5A5R A;  5CRZ A;  5TDW A;  4TQN A;  5E3G A;  3EB5 A;  3MQM A;  3G0L A;  5EPS A;  3LQH A;  5FE6 A;  4CUP A;  4RVR A;  4GND A;  2OXQ C;  5KH3 A;  4A9E A;  5EPB A;  2LGV A;  4PCE A;  4NR7 A;  2L5U A;  5H1T A;  5I29 A;  3O33 A;  2LXP C;  2VPE A;  3U5K A;  4WZ2 A;  4LZ2 A;  3LQI A;  4QUU A;  4Z93 A;  1JM4 B;  2QIC A;  2YW8 A;  2VPG A;  5A82 A;  5G04 B;  3U5N A;  5EI4 A;  4LR6 A;  5CQ4 A;  4PTB A;  5FE3 A;  3U5O A;  2YYR A;  3N9N A;  5FDZ A;  4LKA A;  2OSS A;  2UZG A;  4TT6 A;  2KWJ A;  3JVK A;  1IYM A;  2FSA A;  4UYG A;  5COI A;  1WFK A;  5ENH A;  4GNG A;  5E74 A;  4A9N A;  5CUB A;  4YYK A;  5F36 A;  5C13 A;  5CQ8 A;  5B78 A;  4OGJ A;  2DWW A;  5LKT A;  2YEK A;  2KE1 A;  1DVP A;  3NG2 A;  5FH7 A;  4TT2 A;  4S3O C;  1JM7 B;  4V3K C;  3JVM A;  5ETD A;  4LRG A;  3DAI A;  5FE2 A;  5L96 A;  4QZS A;  4UIZ A;  2RFJ A;  3HTK C;  4LZS A;  4MR3 A;  5C89 A;  1EQF A;  4P5O B;  5FG6 A;  5DW2 A;  4O7F A;  3L1Z B;  4NYW A;  2KU3 A;  3O36 A;  2GRC A;  4F3I A;  5D3R A;  3I3J A;  2H60 A;  2RO1 A;  5F5Z A;  5FFY A;  5DKC A;  5IGK A;  1LDK C;  4ZDT A;  4O75 A;  4NS5 A;  4WHW A;  5HRV A;  4A9F A;  3GL6 A;  4ZW1 A;  5HLS A;  3C5K A;  2F42 A;  5E9K A;  2VJF B;  4O71 A;  5HM0 A;  1F62 A;  4IC2 A;  4GNF A;  1BOR A;  4X3G A;  5EV9 A;  4HXO A;  4A9O A;  4A0C D;  4OGI A;  1U6G B;  2JMD A;  3GG3 A;  4CUU A;  2HYE D;  4ZC9 A;  2CT2 A;  3HCT A;  4WA6 A;  4PY6 A;  3NXB A;  2YW5 A;  4UIT A;  3T6R A;  2NXB A;  4B7Y C;  3ZYU A;  5FB0 A;  5DW1 A;  5HJC A;  4IR5 A;  2VJE A;  2G43 A;  3P1F A;  5F61 A;  4IR6 A;  2ECN A;  5FER A;  3RTR B;  5E9I A;  5IBN A;  2DVQ A;  5AMF A;  1WEP A;  4YAX A;  3VK6 A;  4QSR A;  5CQ6 A;  5J0D A;  5FB1 A;  4XUB A;  1RMD A;  2MA5 A;  3RPG B;  5DKD A;  4QSW A;  2D8S A;  5DFB A;  5F63 A;  1E4U A;  2E7N A;  4MSX A;  2BAY A;  5ACY A;  5FE9 A;  2XEU A;  1WE9 A;  5A5Q A;  1WEO A;  4NR5 A;  2I50 A;  4MEN A;  4O7E A;  5F3A A;  3UVY A;  2XB1 A;  3MUK A;  3D7C A;  5CY9 A;  2KRE A;  5LJ1 A;  5B75 A;  3AAD A;  3IU6 A;  4HXP A;  3QZT A;  5EIS A;  1X0J A;  3Q2F A;  5DYA A;  5G0F A;  5F60 A;  4J0R A;  4E96 A;  4Z6I A;  5EGU A;  2E6S A;  4FLP A;  2CSY A;  4AYC B;  3QZS A;  5CRM A;  5EWW A;  3LQJ A;  2I7K A;  2DVR A;  5CPE A;  5L8T A;  1WEM A;  2LGL A;  5FE5 A;  5C8G A;  4QR4 A;  5C87 A;  5H1V A;  4A4B A;  4QYL A;  4YAT A;  2VJF A;  3PHD A;  3P1C A;  3ZPV 1;  3O35 A;  5EPR A;  5HQ5 A;  5ENF A;  5K29 A;  5D7X A;  2FUI A;  5HEM A;  4UP0 A;  4LDF A;  4YYM A;  2KGG A;  2VPB A;  3T7L A;  3MHS A;  4NUD A;  5A5S A;  4O74 A;  5DYU A;  3RPG C;  5HCL A;  5I86 A;  3RCW A;  5KH9 A;  2JMI A;  5DYX A;  5D25 A;  3M99 A;  5DFC A;  2KTB B;  4HBW A;  5F62 A;  2CSZ A;  2MJV B;  3DPL R;  4I7C A;  5H85 A;  4S3O B;  4CUQ A;  2YUC A;  3PUR A;  2CKL B;  4QST A;  4NQM A;  5IGL A;  2YDW A;  5AIT A;  4O78 A;  4HBV A;  4IOQ A;  2M6M A;  3ZVY A;  5TAB A;  4R8P K;  5DYC A;  4NR8 A;  5DBM A;  3IU5 A;  4YH4 A;  4NQN A;  5ENC A;  4Z1Q A;  5I88 A;  2ECW A;  3UV4 A;  2VPD A;  4QC3 A;  3QZV A;  4KV4 A;  1T1H A;  2K16 A;  4N4G A;  5HFR A;  3N9L A;  1WEN A;  4BJX A;  5ENB A;  4Q0N A;  5KHM A;  4C9Z A;  1WUM A;  3AQA A;  4HBY A;  4QR5 A;  5E9M A;  5EU1 A;  5D24 A;  4CFL A;  4QY4 A;  4QB3 A;  2MNZ A;  4UP5 A;  3P1E A;  1XWH A;  3SVG A;  4UIW A;  5EIC A;  4A9M A;  4N4F A;  4TZ8 A;  5CQT A;  5EP7 A;  5EWV A;  4A9K A;  2QJ0 A;  3SOX A;  3ZYQ A;  2DVV A;  4AYC A;  5B79 A;  5FE8 A;  5ENJ A;  4C66 A;  2LDR A;  3LXJ A;  4UYE A;  4AUQ B;  3HMF A;  4TKP B;  5L99 A;  3O7A A;  5HQ6 A;  4BBQ A;  5FE0 A;  2RS9 B;  5DLX A;  5KTU A;  4YAD A;  4YBT A;  2Y1M A;  1ZS5 A;  3EB6 A;  5LJ2 A;  5EWD A;  4QSQ A;  4BHW A;  1VD4 A;  4YC9 A;  2L84 A;  5F25 A;  5TDR A;  2LSP B;  5LCW B;  2DVS A;  2YRE A;  4FK5 A;  5II1 A;  4Z6H A;  4YH3 A;  2JRJ A;  4UI9 B;  3DWY A;  4O76 A;  5CQ5 A;  5KTX A;  5DFD A;  4LK9 A;  2LN0 A;  4N4I A;  4I7B A;  4XUA A;  3HME A;  5DKA A;  4LYI A;  3KNV A;  3JVL A;  2ECG A;  3HCS A;  4Y03 A;  5FH6 A;  5FH8 A;  3MUL A;  4NUE A;  4DON A;  4IOO A;  5C7N A;  5I7Y A;  2MA6 A;  5D1M B;  2MD7 B;  5E0R A;  5A5N A;  4GNE A;  2R0S A;  4QSP A;  3MXF A;  3ASL A;  4NR6 A;  3HCU A;  1WEE A;  4TYL A;  5TCM A;  5CP5 A;  1F68 A;  1Z2Q A;  4R2Y A;  4UIV A;  4YYH A;  1K2F A;  2E7O A;  5I3L A;  2H0D B;  4Q6F A;  3S91 A;  3N9O A;  4TS8 A;  5F2P A;  5CZG A;  2IDA A;  4CLB A;  5HRX A;  2F6N A;  4CUT A;  3FKM X;  4IOR A;  4TU4 A;  4X2I A;  1V87 A;  4I7D A;  2L75 A;  5EM3 A;  2N9G A;  4PKL A;  3ONI A;  2LGK A;  5HEN A;  2KWN A;  4CUR A;  2DX8 A;  4Z1S A;  3HMH A;  4BW3 A;  2LRI C;  5BT3 A;  4YYN A;  4A9H A;  4AVX A;  4CL9 A;  5AME A;  4MEQ A;  1JM7 A;  4C67 A;  3G0J A;  5I89 A;  5LJ0 A;  3C6W A;  3K2J A;  5E9Y A;  4LC2 A;  4NRA A;  3FL2 A;  3P5O A;  5DY7 A;  1WIL A;  3SHB A;  5FE1 A;  3SVH A;  2MNY A;  4CUS A;  4FJC A;  4XYA A;  5CQA A;  4XY9 A;  3S92 A;  3DQV R;  2G45 A;  4QF2 A;  1WGM A;  5TBN A;  4UYF B;  5FEY A;  3UVW A;  3KQI A;  5HRW A;  1MM2 A;  2PUY A;  5DX4 A;  2L5E A;  5ENE A;  2G4A A;  3ZNI A;  5CQ7 A;  5L98 A;  2I8N A;  2C2L A;  2RNX A;  4UIY A;  2YU4 A;  4PS5 A;  3SOW A;  3P1D A;  5DKH A;  5FBX A;  4CA1 A;  2K17 A;  4QEV A;  4IR3 A;  4BW1 A;  1X4J A;  5LVQ A;  4QR3 A;  2JMJ A;  3U5L A;  5CQ3 A;  5EYA F;  1WUG A;  2YQD A;  5ETB A;  4ZUX U;  3JVJ A;  4PPE A;  5C11 A;  4WIV A;  5A5P A;  2H0D A;  4AP4 A;  2OUO A;  4QSU A;  5I80 A;  3N9Q A;  5JWM A;  1FP0 A;  5ENI A;  4O7A A;  2D82 A;  4LYS A;  4QYD A;  4YYI A;  4AKN A;  3KV6 A;  5FG5 A;  2L85 A;  4ALH A;  4WHU A;  5B77 A;  1N87 A;  2C2V S;  2YQL A;  3IHP A;  5EK9 A;  4QC1 A;  4QEW A;  4LLB A;  2RNW A;  5D26 A;  2EOD A;  4J0S A;  4WZ3 B;  5G05 B;  4QSS A;  4NR4 A;  1X4I A;  5L97 A;  5A83 A;  2ECI A;  4HXN A;  5A85 A;  5DLZ A;  1Z6U A;  2MT5 A;  2DKW A;  4PCI A;  2L80 A;  5G4S A;  5A5O A;  2F6J A;  3U5M A;  4W4U A;  4O7B A;  5I83 A;  4HBX A;  4J1P A;  1ZBD B;  3MB4 A;  4FO9 A;  5I1Q A;  4LJN A;  5CGP A;  4TZ2 A;  3L1X A;  5A81 A;  2YT5 A;  5HFQ A;  1VFY A;  1Z60 A;  2M1R A;  2K4D A;  4J3I A;  2YEL A;  3O34 A;  5JI8 A;  1WEV A;  4LAD B;  5HEL A;  4UYF A;  2LXH C;  2MUM A;  2EA6 A;  4B86 C;  2WP2 A;  1FBV A;  5D0C A;  3M62 A;  5KH7 A;  3N9P A;  2AN6 A;  5D3H A;  4HXL A;  2KWO A;  4QUT A;  5E7D A;  1HYJ A;  1JOC A;  5EWC A;  2YYN A;  1WEU A;  4IR4 A;  2YSM A;  2ECT A;  4V3L C;  4A9J A;  2DAT A;  3O70 A;  4TU6 A;  4NRC A;  2E3K A;  5IGN A;  3ZTG A;  5FFV A;  2E6R A;  3GV4 A;  4N3W A;  4NUC A;  1MM3 A;  5D1L B;  1E6I A;  2KIZ A;  2YHN A;  4XY8 A;  1N72 A;  4YYG A;  4NN2 A;  2YEM A;  2RSD A;  2M3H A;  2G6Q A;  4CFK A;  5FE7 A;  5CTL A;  5D1K B;  4YY6 A;  2VJE B;  2D9E A;  4NYX A;  5DIN A;  2CKL A;  5BT5 A;  1G25 A;  2OO1 A;  4A4C A;  3UVD A;  4HXK A;  5CFW A;  3TLP A;  1X4U A;  2ECV A;  4BW2 A;  3LJW A;  5LVR A;  2LGG A;  5F1L A;  3I2D A;  3L11 A;  2QIZ A;  5KO4 A;  5D3S A;  5LKX A;  5KU3 A;  5TRB A;  5IG6 A;  2KYU A;  4YBM A;  3LRQ A;  5D3P A;  4WZ0 A;  1WEQ A;  4YK0 A;  5L8U A;  2M85 A;  4L58 A;  5F1H A;  5H1U A;  3M63 A;  4LZR A;  5CU8 A;  4TT4 A;  3N9M A;  4GPJ A;  4MEP A;  4QSV A;  4A49 A;  3UV2 A;  4YAB A;  2VNF A;  5D3L A;  2FUU A;  4TTE A;  2EGP A;  4UYH A;  4O77 A;  4NYV A;  5TB6 A;  5E9L A;  5AD2 A;  5CUA A;  1WIM A;  3V43 A;  3UW9 A;  1CHC A;  4KCX A;  5D3N A;  4MR5 A;  2L43 A;  2NAA A;  2R0Y A;  5E9V A;  4N4H A;  2Y43 A;  2MD8 C;  2ECJ A;  5C4Q A;  1VYX A;  4O70 A;  5CUC A;  4QNS A;  4YYD A;  3KV5 A;  5G4R A;  4IC3 A;  5IGM A;  5FE4 A;  3U5P A;  5CUG A;  2KWK A;  5AIU A;  1WEW A;  4YBS A; 
#chains in the Genus database with same CATH topology
 5FG4 A;  4MR4 A;  5CUD A;  5I7X A;  5D3T A;  4QEU A;  5FFW A;  5BT4 A;  2KKX A;  2CRW A;  2HDP A;  3ZPV E;  2P57 A;  5LKU A;  3PUQ A;  2JUN A;  3UVX A;  5JG6 A;  2YHO A;  3UV5 A;  4F52 B;  5EWH A;  4BW4 A;  4UIU A;  5CS8 A;  4HXS A;  5HQ7 A;  4OUF A;  2YSJ A;  5C85 A;  4HXR A;  2L0B A;  4O7C A;  2WP1 A;  5EA1 A;  4CCG X;  4XI1 A;  5H9M A;  2LV9 A;  5EVA A;  2Y1N A;  2RNY A;  5E73 A;  5II2 A;  2KFT A;  4A9L A;  2PNX A;  5KTW A;  5EQ1 A;  2R10 A;  2MIQ A;  4FIP A;  4KV1 A;  5A7C A;  5LUU A;  3ZVZ B;  3SVF A;  4YY4 A;  1LDJ B;  1HYI A;  5AD3 A;  4HXM A;  2XOZ A;  2LQ6 A;  3Q2E A;  1WES A;  4QBM A;  2KKY A;  2RI7 A;  4NXJ A;  4Q0O A;  4QF3 A;  5SVY A;  5I40 A;  4R7E A;  4MEO A;  4O64 A;  4UIX A;  2R0V A;  4LYW A;  4MR6 A;  3MHH A;  2XOC A;  4NRB A;  4QSX A;  4NR9 A;  3U5J A;  1JSP B;  5B76 A;  5J3X A;  2DSM A;  2YUR A;  4UYD A;  4ZQL A;  5IID A;  3MB3 A;  2VP7 A;  3O37 A;  4A9I A;  5B8D A;  2YVR A;  2ZET C;  4GB0 A;  2KGI A;  3FM8 C;  4MVT A;  5CUE A;  5LKZ A;  3SOU A;  4YYJ A;  4O72 A;  3DWD A;  2K1J A;  5D3J A;  5ENG A;  2YQM A;  5E3D A;  4ALG A;  4L7X A;  5A5R A;  3M7K A;  5CRZ A;  5TDW A;  4TQN A;  5E3G A;  2L7P A;  3EB5 A;  3MQM A;  3G0L A;  5EPS A;  3LQH A;  5FE6 A;  4CUP A;  2EGM A;  4RVR A;  4GND A;  2OXQ C;  5KH3 A;  4A9E A;  5EPB A;  2LGV A;  4PCE A;  4NR7 A;  2L5U A;  5H1T A;  5I29 A;  3O33 A;  2LXP C;  2VPE A;  3U5K A;  4WZ2 A;  4LZ2 A;  3LQI A;  4QUU A;  4Z93 A;  1JM4 B;  2QIC A;  2YW8 A;  2VPG A;  5A82 A;  5G04 B;  3U5N A;  5EI4 A;  4LR6 A;  5CQ4 A;  4PTB A;  5FE3 A;  3U5O A;  2YYR A;  2IQJ A;  3N9N A;  3LDY A;  5FDZ A;  4LKA A;  2OSS A;  2UZG A;  4TT6 A;  2KWJ A;  3JVK A;  1IYM A;  2FSA A;  4UYG A;  5COI A;  4AKI A;  1WFK A;  5ENH A;  4GNG A;  5E74 A;  4A9N A;  2LAU A;  5CUB A;  4YYK A;  5F36 A;  5C13 A;  5CQ8 A;  5B78 A;  4OGJ A;  2DWW A;  5LKT A;  3FJU B;  2YEK A;  2KE1 A;  1DVP A;  3NG2 A;  5FH7 A;  4TT2 A;  4S3O C;  1JM7 B;  4V3K C;  3JVM A;  5ETD A;  4LRG A;  3DAI A;  5FE2 A;  5L96 A;  4QZS A;  4UIZ A;  2RFJ A;  3HTK C;  4LZS A;  4MR3 A;  5C89 A;  1EQF A;  4P5O B;  5FG6 A;  2M13 A;  5DW2 A;  4Z0R A;  4O7F A;  3L1Z B;  2RR4 A;  4NYW A;  2KU3 A;  3O36 A;  2GRC A;  3O47 A;  4F3I A;  5D3R A;  3I3J A;  2H60 A;  2RO1 A;  4O62 A;  5F5Z A;  5FFY A;  5DKC A;  5IGK A;  1LDK C;  4ZDT A;  4O75 A;  4NS5 A;  4WHW A;  5HRV A;  4A9F A;  3GL6 A;  4ZW1 A;  5HLS A;  3C5K A;  2F42 A;  5E9K A;  3FAO A;  5SVI B;  2VJF B;  4O71 A;  5HM0 A;  1F62 A;  4IC2 A;  4GNF A;  1BOR A;  4X3G A;  5EV9 A;  4HXO A;  4A9O A;  4A0C D;  4OGI A;  1U6G B;  2JMD A;  3GG3 A;  4CUU A;  2D8U A;  2HYE D;  4ZC9 A;  2CT2 A;  2OWA A;  3DDT A;  3HCT A;  4WA6 A;  4PY6 A;  3NXB A;  2YW5 A;  4UIT A;  3T6R A;  2NXB A;  4B7Y C;  3ZYU A;  5FB0 A;  5DW1 A;  5HJC A;  4IR5 A;  2VJE A;  2G43 A;  3P1F A;  5F61 A;  4IR6 A;  1MBM A;  2ECN A;  5FER A;  3RTR B;  5E9I A;  5IBN A;  2DVQ A;  5AMF A;  1WEP A;  4YAX A;  3VK6 A;  4QSR A;  5CQ6 A;  5J0D A;  5FB1 A;  4XUB A;  1RMD A;  2MA5 A;  3RPG B;  5DKD A;  4QSW A;  2D8S A;  5DFB A;  5F63 A;  1E4U A;  2E7N A;  4MSX A;  2BAY A;  5ACY A;  5FE9 A;  2XEU A;  1WE9 A;  5A5Q A;  1WEO A;  4NR5 A;  2I50 A;  4MEN A;  4O7E A;  5F3A A;  3UVY A;  2XB1 A;  3MUK A;  3D7C A;  5CY9 A;  2KRE A;  5LJ1 A;  5B75 A;  3AAD A;  3IU6 A;  4HXP A;  3QZT A;  5EIS A;  1X0J A;  3Q2F A;  5DYA A;  5G0F A;  5F60 A;  4J0R A;  4WZ3 B;  4E96 A;  4Z6I A;  5EGU A;  2E6S A;  4FLP A;  4Z0O A;  3LVR E;  2CSY A;  4AYC B;  3QZS A;  5CRM A;  5EWW A;  3LQJ A;  2I7K A;  2DVR A;  5CPE A;  5L8T A;  1WEM A;  2LGL A;  5FE5 A;  5C8G A;  4QR4 A;  5C87 A;  5H1V A;  4A4B A;  4QYL A;  4YAT A;  5SVI A;  2VJF A;  3PHD A;  3P1C A;  3ZPV 1;  3O35 A;  5EPR A;  5HQ5 A;  5ENF A;  5K29 A;  3VKH A;  5D7X A;  2FUI A;  5HEM A;  3SUB A;  4UP0 A;  4LDF A;  4YYM A;  2KGG A;  2VPB A;  3T7L A;  3D1B A;  3MHS A;  4NUD A;  5A5S A;  4O74 A;  5DYU A;  3RPG C;  5HCL A;  5I86 A;  3RCW A;  5KH9 A;  2JMI A;  5DYX A;  5D25 A;  3M99 A;  5DFC A;  2KTB B;  4HBW A;  5F62 A;  2CSZ A;  2MJV B;  3DPL R;  4I7C A;  4QQ4 A;  5H85 A;  4S3O B;  4CUQ A;  2YUC A;  3PUR A;  2CKL B;  4QST A;  4NQM A;  5IGL A;  2YDW A;  3ERR A;  4O78 A;  4HBV A;  4IOQ A;  5AIT A;  2M6M A;  3ZVY A;  5TAB A;  4R8P K;  5DYC A;  4NR8 A;  5DBM A;  3IU5 A;  4YH4 A;  4NQN A;  5ENC A;  4Z1Q A;  5I88 A;  1ZKR A;  2ECW A;  3UV4 A;  4AKH A;  2VPD A;  4QC3 A;  2CRR A;  3QZV A;  4KV4 A;  1T1H A;  2K16 A;  4N4G A;  5HFR A;  3N9L A;  1WEN A;  4BJX A;  5ENB A;  4Q0N A;  2KR4 A;  5KHM A;  4C9Z A;  1WUM A;  3AQA A;  4HBY A;  4QR5 A;  5E9M A;  5EU1 A;  5D24 A;  4CFL A;  4QY4 A;  4QB3 A;  2MNZ A;  4UP5 A;  3P1E A;  1XWH A;  3SVG A;  4UIW A;  5EIC A;  4A9M A;  4N4F A;  4TZ8 A;  5CQT A;  5EP7 A;  5EWV A;  4A9K A;  2QJ0 A;  3SOX A;  3ZYQ A;  2DVV A;  4AYC A;  5B79 A;  5FE8 A;  5ENJ A;  4C66 A;  2LDR A;  3LXJ A;  4UYE A;  2MKE A;  3HMF A;  4AUQ B;  4TKP B;  5L99 A;  4AKG A;  3FAN A;  5HQ6 A;  3O7A A;  4BBQ A;  5FE0 A;  2RS9 B;  5DLX A;  5KTU A;  2XOY A;  4YAD A;  4YBT A;  2Y1M A;  1ZS5 A;  3EB6 A;  5LJ2 A;  5EWD A;  4QSQ A;  4BHW A;  1VD4 A;  4YC9 A;  2L84 A;  5F25 A;  5TDR A;  2LSP B;  4OGC A;  2EJN A;  5LCW B;  2DVS A;  2YRE A;  4FK5 A;  5II1 A;  4Z6H A;  4YH3 A;  2JRJ A;  4UI9 B;  3DWY A;  4O76 A;  5CQ5 A;  5KTX A;  5DFD A;  4LK9 A;  2LN0 A;  4N4I A;  4I7B A;  4XUA A;  3HME A;  5DKA A;  4LYI A;  2EXU A;  3KNV A;  3JVL A;  2ECG A;  3HCS A;  4Y03 A;  3JUE A;  5FH6 A;  5FH8 A;  3MUL A;  2DJA A;  4NUE A;  4DON A;  4IOO A;  5C7N A;  5I7Y A;  2CON A;  2MA6 A;  3LJU X;  2MD7 B;  5D1M B;  5E0R A;  5A5N A;  4GNE A;  2R0S A;  4QSP A;  3MXF A;  3ASL A;  3D1D A;  4NR6 A;  1WEE A;  4TYL A;  5TCM A;  5CP5 A;  1F68 A;  1Z2Q A;  3HCU A;  4H9D A;  4UIV A;  4YYH A;  4R2Y A;  1K2F A;  2E7O A;  5I3L A;  2H0D B;  4Q6F A;  3S91 A;  3N9O A;  4TS8 A;  5F2P A;  5CZG A;  2IDA A;  4CLB A;  5HRX A;  2F6N A;  4CUT A;  3FKM X;  4IOR A;  4TU4 A;  4X2I A;  1V87 A;  4I7D A;  2L75 A;  5EM3 A;  2N9G A;  4PKL A;  3ONI A;  2LGK A;  5HEN A;  2KWN A;  4CUR A;  2DX8 A;  4Z1S A;  3HMH A;  4BW3 A;  2LRI C;  5BT3 A;  4YYN A;  4A9H A;  4AVX A;  4CL9 A;  5AME A;  4MEQ A;  1JM7 A;  4C67 A;  3G0J A;  5I89 A;  5LJ0 A;  3C6W A;  3K2J A;  5E9Y A;  4LC2 A;  4NRA A;  3FL2 A;  3P5O A;  5DY7 A;  1WIL A;  3SHB A;  5FE1 A;  3SVH A;  2MNY A;  5SVX A;  4CUS A;  4FJC A;  4XYA A;  5CQA A;  4XY9 A;  3S92 A;  3DQV R;  2G45 A;  4QF2 A;  1WGM A;  5TBN A;  4UYF B;  2FFW A;  5FEY A;  3H7H A;  3UVW A;  3KQI A;  5HRW A;  1MM2 A;  2PUY A;  5DX4 A;  2L5E A;  5ENE A;  3T9K A;  2G4A A;  3ZNI A;  5CQ7 A;  5L98 A;  2I8N A;  2C2L A;  2RNX A;  4UIY A;  2YU4 A;  4PS5 A;  3SOW A;  3P1D A;  5DKH A;  5FBX A;  4CA1 A;  2K17 A;  4QEV A;  4IR3 A;  4BW1 A;  1X4J A;  5LVQ A;  4QR3 A;  2JMJ A;  3U5L A;  5CQ3 A;  5EYA F;  1WUG A;  2YQD A;  5ETB A;  4ZUX U;  3JVJ A;  4PPE A;  5C11 A;  4WIV A;  5A5P A;  2H0D A;  4AP4 A;  2OUO A;  4QSU A;  5I80 A;  3N9Q A;  5JWM A;  1FP0 A;  5ENI A;  4O7A A;  2D82 A;  4LYS A;  4QYD A;  3FEH A;  4YYI A;  4AKN A;  3KV6 A;  3Q1D A;  5FG5 A;  2L85 A;  1PUO A;  4ALH A;  4WHU A;  5B77 A;  1N87 A;  2C2V S;  2YQL A;  3IHP A;  5EK9 A;  4QC1 A;  4QEW A;  4LLB A;  2RNW A;  5D26 A;  2EOD A;  4J0S A;  2FD4 A;  5G05 B;  4QSS A;  4NR4 A;  1X4I A;  5L97 A;  5A83 A;  2JM3 A;  2ECI A;  4HXN A;  5A85 A;  5DLZ A;  1Z6U A;  2MT5 A;  2DKW A;  4PCI A;  2L80 A;  5G4S A;  5A5O A;  2B0O E;  2F6J A;  3U5M A;  4W4U A;  4O7B A;  5I83 A;  4HBX A;  4J1P A;  1ZBD B;  3MB4 A;  4FO9 A;  5I1Q A;  4LJN A;  5CGP A;  4TZ2 A;  1DCQ A;  3L1X A;  5A81 A;  2YT5 A;  5HFQ A;  1VFY A;  1Z60 A;  5K3Q A;  2M1R A;  3LVQ E;  2K4D A;  4J3I A;  2YEL A;  3O34 A;  5JI8 A;  1WEV A;  4LAD B;  5HEL A;  4UYF A;  2LXH C;  2MUM A;  2EA6 A;  4B86 C;  2WP2 A;  1FBV A;  5D0C A;  3M62 A;  5KH7 A;  3N9P A;  2AN6 A;  5D3H A;  4HXL A;  2KWO A;  4QUT A;  5E7D A;  1HYJ A;  1JOC A;  4F1P A;  5EWC A;  2YYN A;  1WEU A;  4IR4 A;  2YSM A;  2ECT A;  4V3L C;  3MDB C;  4A9J A;  2DAT A;  3O70 A;  4TU6 A;  4NRC A;  2E3K A;  5IGN A;  3ZTG A;  5FFV A;  2E6R A;  3GV4 A;  4N3W A;  4NUC A;  3VKG A;  1MM3 A;  1E6I A;  2KIZ A;  5D1L B;  2CSV A;  4AI6 A;  2YHN A;  4XY8 A;  1N72 A;  4YYG A;  4NN2 A;  2YEM A;  2RSD A;  2M3H A;  2G6Q A;  4CFK A;  5FE7 A;  5CTL A;  5D1K B;  4YY6 A;  2VJE B;  2D9E A;  3KDE C;  4NYX A;  5DIN A;  2CKL A;  3PLW A;  5BT5 A;  1G25 A;  2OO1 A;  4A4C A;  3UVD A;  4HXK A;  5CFW A;  3TLP A;  1X4U A;  2ECV A;  4BW2 A;  3LJW A;  5LVR A;  2LGG A;  5F1L A;  3I2D A;  3L11 A;  2QIZ A;  5KO4 A;  5D3S A;  5LKX A;  5KU3 A;  5TRB A;  5IG6 A;  2KYU A;  2XP0 A;  4YBM A;  3LRQ A;  5D3P A;  4WZ0 A;  1WEQ A;  4YK0 A;  5L8U A;  2M85 A;  4L58 A;  5F1H A;  5H1U A;  3M63 A;  4LZR A;  5CU8 A;  4TT4 A;  3N9M A;  2E61 A;  4GPJ A;  4MEP A;  4QSV A;  4OGE A;  4A49 A;  3UV2 A;  4YAB A;  2VNF A;  5D3L A;  2FUU A;  4TTE A;  2EGP A;  4UYH A;  4O77 A;  4NYV A;  5TB6 A;  5E9L A;  5AD2 A;  5CUA A;  1WIM A;  3V43 A;  3UW9 A;  1CHC A;  4KCX A;  5D3N A;  4MR5 A;  2L43 A;  2NAA A;  2R0Y A;  5E9V A;  4N4H A;  2Y43 A;  2MD8 C;  2ECJ A;  5C4Q A;  1VYX A;  4O70 A;  5CUC A;  4QNS A;  4YYD A;  3KV5 A;  5G4R A;  4IC3 A;  5IGM A;  5FE4 A;  3U5P A;  5CUG A;  2KWK A;  5AIU A;  1WEW A;  3E2D A;  4YBS A; 
#chains in the Genus database with same CATH homology
 5FG4 A;  4MR4 A;  5CUD A;  5I7X A;  5D3T A;  4QEU A;  5FFW A;  5BT4 A;  2KR4 A;  2HDP A;  3ZPV E;  5LKU A;  3PUQ A;  3UVX A;  5JG6 A;  2YHO A;  3UV5 A;  4F52 B;  5EWH A;  4BW4 A;  4UIU A;  5CS8 A;  4HXS A;  5HQ7 A;  4OUF A;  2YSJ A;  5C85 A;  4HXR A;  2L0B A;  4O7C A;  2WP1 A;  5EA1 A;  4CCG X;  4XI1 A;  5H9M A;  2LV9 A;  5EVA A;  2Y1N A;  2RNY A;  5E73 A;  5II2 A;  2KFT A;  4A9L A;  2PNX A;  5KTW A;  5EQ1 A;  2R10 A;  2MIQ A;  4FIP A;  4KV1 A;  5A7C A;  5LUU A;  3ZVZ B;  3SVF A;  4YY4 A;  1LDJ B;  1HYI A;  5AD3 A;  4HXM A;  2LQ6 A;  3Q2E A;  1WES A;  4QBM A;  2RI7 A;  4NXJ A;  4Q0O A;  4QF3 A;  5I40 A;  4R7E A;  4MEO A;  4O64 A;  4UIX A;  2R0V A;  4LYW A;  4MR6 A;  3MHH A;  4NRB A;  4QSX A;  4NR9 A;  3U5J A;  1JSP B;  5B76 A;  5J3X A;  2YUR A;  4UYD A;  4ZQL A;  5IID A;  3MB3 A;  2VP7 A;  3O37 A;  4A9I A;  5B8D A;  2ZET C;  4GB0 A;  2KGI A;  4MVT A;  5CUE A;  5LKZ A;  3SOU A;  4YYJ A;  4O72 A;  2K1J A;  5D3J A;  5ENG A;  2YQM A;  5E3D A;  4ALG A;  4L7X A;  5A5R A;  5CRZ A;  5TDW A;  4TQN A;  5E3G A;  3EB5 A;  3MQM A;  3G0L A;  5EPS A;  3LQH A;  5FE6 A;  4CUP A;  4RVR A;  4GND A;  2OXQ C;  5KH3 A;  4A9E A;  5EPB A;  2LGV A;  4PCE A;  4NR7 A;  2L5U A;  5H1T A;  5I29 A;  3O33 A;  2LXP C;  2VPE A;  3U5K A;  4WZ2 A;  4LZ2 A;  3LQI A;  4QUU A;  4Z93 A;  1JM4 B;  2QIC A;  2YW8 A;  2VPG A;  5A82 A;  5G04 B;  3U5N A;  5EI4 A;  4LR6 A;  5CQ4 A;  4PTB A;  5FE3 A;  3U5O A;  2YYR A;  3N9N A;  5FDZ A;  4LKA A;  2OSS A;  2UZG A;  4TT6 A;  2KWJ A;  3JVK A;  1IYM A;  2FSA A;  4UYG A;  5COI A;  1WFK A;  5ENH A;  4GNG A;  5E74 A;  4A9N A;  5CUB A;  4YYK A;  5F36 A;  5C13 A;  5CQ8 A;  5B78 A;  4OGJ A;  2DWW A;  5LKT A;  2YEK A;  2KE1 A;  1DVP A;  3NG2 A;  5FH7 A;  4TT2 A;  4S3O C;  1JM7 B;  4V3K C;  3JVM A;  5ETD A;  4LRG A;  3DAI A;  5FE2 A;  5L96 A;  4QZS A;  4UIZ A;  2RFJ A;  3HTK C;  4LZS A;  4MR3 A;  5C89 A;  1EQF A;  4P5O B;  5FG6 A;  5DW2 A;  4O7F A;  3L1Z B;  4NYW A;  2KU3 A;  3O36 A;  2GRC A;  4F3I A;  5D3R A;  3I3J A;  2H60 A;  2RO1 A;  5F5Z A;  5FFY A;  5DKC A;  5IGK A;  1LDK C;  4ZDT A;  4O75 A;  4NS5 A;  4WHW A;  5HRV A;  4A9F A;  3GL6 A;  4ZW1 A;  5HLS A;  3C5K A;  2F42 A;  5E9K A;  2VJF B;  4O71 A;  5HM0 A;  1F62 A;  4IC2 A;  4GNF A;  1BOR A;  4X3G A;  5EV9 A;  4HXO A;  4A9O A;  4A0C D;  4OGI A;  1U6G B;  2JMD A;  3GG3 A;  4CUU A;  2HYE D;  4ZC9 A;  2CT2 A;  3HCT A;  4WA6 A;  4PY6 A;  3NXB A;  2YW5 A;  4UIT A;  3T6R A;  2NXB A;  4B7Y C;  3ZYU A;  5FB0 A;  5DW1 A;  5HJC A;  4IR5 A;  2VJE A;  2G43 A;  3P1F A;  5F61 A;  4IR6 A;  2ECN A;  5FER A;  3RTR B;  5E9I A;  5IBN A;  2DVQ A;  5AMF A;  1WEP A;  4YAX A;  3VK6 A;  4QSR A;  5CQ6 A;  5J0D A;  5FB1 A;  4XUB A;  1RMD A;  2MA5 A;  3RPG B;  5DKD A;  4QSW A;  2D8S A;  5DFB A;  5F63 A;  1E4U A;  2E7N A;  4MSX A;  2BAY A;  5ACY A;  5FE9 A;  2XEU A;  1WE9 A;  5A5Q A;  1WEO A;  4NR5 A;  2I50 A;  4MEN A;  4O7E A;  5F3A A;  3UVY A;  2XB1 A;  3MUK A;  3D7C A;  5CY9 A;  2KRE A;  5LJ1 A;  5B75 A;  3AAD A;  3IU6 A;  4HXP A;  3QZT A;  5EIS A;  1X0J A;  3Q2F A;  5DYA A;  5G0F A;  5F60 A;  4J0R A;  4E96 A;  4Z6I A;  5EGU A;  2E6S A;  4FLP A;  2CSY A;  4AYC B;  3QZS A;  5CRM A;  5EWW A;  3LQJ A;  2I7K A;  2DVR A;  5CPE A;  5L8T A;  1WEM A;  2LGL A;  5FE5 A;  5C8G A;  4QR4 A;  5C87 A;  5H1V A;  4A4B A;  4QYL A;  4YAT A;  2VJF A;  3PHD A;  3P1C A;  3ZPV 1;  3O35 A;  5EPR A;  5HQ5 A;  5ENF A;  5K29 A;  5D7X A;  2FUI A;  5HEM A;  4UP0 A;  4LDF A;  4YYM A;  2KGG A;  2VPB A;  3T7L A;  3MHS A;  4NUD A;  5A5S A;  4O74 A;  5DYU A;  3RPG C;  5HCL A;  5I86 A;  3RCW A;  5KH9 A;  2JMI A;  5DYX A;  5D25 A;  3M99 A;  5DFC A;  2KTB B;  4HBW A;  5F62 A;  2CSZ A;  2MJV B;  3DPL R;  4I7C A;  5H85 A;  4S3O B;  4CUQ A;  2YUC A;  3PUR A;  2CKL B;  4QST A;  4NQM A;  5IGL A;  2YDW A;  5AIT A;  4O78 A;  4HBV A;  4IOQ A;  2M6M A;  3ZVY A;  5TAB A;  4R8P K;  5DYC A;  4NR8 A;  5DBM A;  3IU5 A;  4YH4 A;  4NQN A;  5ENC A;  4Z1Q A;  5I88 A;  2ECW A;  3UV4 A;  2VPD A;  4QC3 A;  3QZV A;  4KV4 A;  1T1H A;  2K16 A;  4N4G A;  5HFR A;  3N9L A;  1WEN A;  4BJX A;  5ENB A;  4Q0N A;  5KHM A;  4C9Z A;  1WUM A;  3AQA A;  4HBY A;  4QR5 A;  5E9M A;  5EU1 A;  5D24 A;  4CFL A;  4QY4 A;  4QB3 A;  2MNZ A;  4UP5 A;  3P1E A;  1XWH A;  3SVG A;  4UIW A;  5EIC A;  4A9M A;  4N4F A;  4TZ8 A;  5CQT A;  5EP7 A;  5EWV A;  4A9K A;  2QJ0 A;  3SOX A;  3ZYQ A;  2DVV A;  4AYC A;  5B79 A;  5FE8 A;  5ENJ A;  4C66 A;  2LDR A;  3LXJ A;  4UYE A;  4AUQ B;  3HMF A;  4TKP B;  5L99 A;  3O7A A;  5HQ6 A;  4BBQ A;  5FE0 A;  2RS9 B;  5DLX A;  5KTU A;  4YAD A;  4YBT A;  2Y1M A;  1ZS5 A;  3EB6 A;  5LJ2 A;  5EWD A;  4QSQ A;  4BHW A;  1VD4 A;  4YC9 A;  2L84 A;  5F25 A;  5TDR A;  2LSP B;  5LCW B;  2DVS A;  2YRE A;  4FK5 A;  5II1 A;  4Z6H A;  4YH3 A;  2JRJ A;  4UI9 B;  3DWY A;  4O76 A;  5CQ5 A;  5KTX A;  5DFD A;  4LK9 A;  2LN0 A;  4N4I A;  4I7B A;  4XUA A;  3HME A;  5DKA A;  4LYI A;  3KNV A;  3JVL A;  2ECG A;  3HCS A;  4Y03 A;  5FH6 A;  5FH8 A;  3MUL A;  4NUE A;  4DON A;  4IOO A;  5C7N A;  5I7Y A;  2MA6 A;  5D1M B;  2MD7 B;  5E0R A;  5A5N A;  4GNE A;  2R0S A;  4QSP A;  3MXF A;  3ASL A;  4NR6 A;  3HCU A;  1WEE A;  4TYL A;  5TCM A;  5CP5 A;  1F68 A;  1Z2Q A;  4R2Y A;  4UIV A;  4YYH A;  1K2F A;  2E7O A;  5I3L A;  2H0D B;  4Q6F A;  3S91 A;  3N9O A;  4TS8 A;  5F2P A;  5CZG A;  2IDA A;  4CLB A;  5HRX A;  2F6N A;  4CUT A;  3FKM X;  4IOR A;  4TU4 A;  4X2I A;  1V87 A;  4I7D A;  2L75 A;  5EM3 A;  2N9G A;  4PKL A;  3ONI A;  2LGK A;  5HEN A;  2KWN A;  4CUR A;  2DX8 A;  4Z1S A;  3HMH A;  4BW3 A;  2LRI C;  5BT3 A;  4YYN A;  4A9H A;  4AVX A;  4CL9 A;  5AME A;  4MEQ A;  1JM7 A;  4C67 A;  3G0J A;  5I89 A;  5LJ0 A;  3C6W A;  3K2J A;  5E9Y A;  4LC2 A;  4NRA A;  3FL2 A;  3P5O A;  5DY7 A;  1WIL A;  3SHB A;  5FE1 A;  3SVH A;  2MNY A;  4CUS A;  4FJC A;  4XYA A;  5CQA A;  4XY9 A;  3S92 A;  3DQV R;  2G45 A;  4QF2 A;  1WGM A;  5TBN A;  4UYF B;  5FEY A;  3UVW A;  3KQI A;  5HRW A;  1MM2 A;  2PUY A;  5DX4 A;  2L5E A;  5ENE A;  2G4A A;  3ZNI A;  5CQ7 A;  5L98 A;  2I8N A;  2C2L A;  2RNX A;  4UIY A;  2YU4 A;  4PS5 A;  3SOW A;  3P1D A;  5DKH A;  5FBX A;  4CA1 A;  2K17 A;  4QEV A;  4IR3 A;  4BW1 A;  1X4J A;  5LVQ A;  4QR3 A;  2JMJ A;  3U5L A;  5CQ3 A;  5EYA F;  1WUG A;  2YQD A;  5ETB A;  4ZUX U;  3JVJ A;  4PPE A;  5C11 A;  4WIV A;  5A5P A;  2H0D A;  4AP4 A;  2OUO A;  4QSU A;  5I80 A;  3N9Q A;  5JWM A;  1FP0 A;  5ENI A;  4O7A A;  2D82 A;  4LYS A;  4QYD A;  4YYI A;  4AKN A;  3KV6 A;  5FG5 A;  2L85 A;  4ALH A;  4WHU A;  5B77 A;  1N87 A;  2C2V S;  2YQL A;  3IHP A;  5EK9 A;  4QC1 A;  4QEW A;  4LLB A;  2RNW A;  5D26 A;  2EOD A;  4J0S A;  4WZ3 B;  5G05 B;  4QSS A;  4NR4 A;  1X4I A;  5L97 A;  5A83 A;  2ECI A;  4HXN A;  5A85 A;  5DLZ A;  1Z6U A;  2MT5 A;  2DKW A;  4PCI A;  2L80 A;  5G4S A;  5A5O A;  2F6J A;  3U5M A;  4W4U A;  4O7B A;  5I83 A;  4HBX A;  4J1P A;  1ZBD B;  3MB4 A;  4FO9 A;  5I1Q A;  4LJN A;  5CGP A;  4TZ2 A;  3L1X A;  5A81 A;  2YT5 A;  5HFQ A;  1VFY A;  1Z60 A;  2M1R A;  2K4D A;  4J3I A;  2YEL A;  3O34 A;  5JI8 A;  1WEV A;  4LAD B;  5HEL A;  4UYF A;  2LXH C;  2MUM A;  2EA6 A;  4B86 C;  2WP2 A;  1FBV A;  5D0C A;  3M62 A;  5KH7 A;  3N9P A;  2AN6 A;  5D3H A;  4HXL A;  2KWO A;  4QUT A;  5E7D A;  1HYJ A;  1JOC A;  5EWC A;  2YYN A;  1WEU A;  4IR4 A;  2YSM A;  2ECT A;  4V3L C;  4A9J A;  2DAT A;  3O70 A;  4TU6 A;  4NRC A;  2E3K A;  5IGN A;  3ZTG A;  5FFV A;  2E6R A;  3GV4 A;  4N3W A;  4NUC A;  1MM3 A;  5D1L B;  1E6I A;  2KIZ A;  2YHN A;  4XY8 A;  1N72 A;  4YYG A;  4NN2 A;  2YEM A;  2RSD A;  2M3H A;  2G6Q A;  4CFK A;  5FE7 A;  5CTL A;  5D1K B;  4YY6 A;  2VJE B;  2D9E A;  4NYX A;  5DIN A;  2CKL A;  5BT5 A;  1G25 A;  2OO1 A;  4A4C A;  3UVD A;  4HXK A;  5CFW A;  3TLP A;  1X4U A;  2ECV A;  4BW2 A;  3LJW A;  5LVR A;  2LGG A;  5F1L A;  3I2D A;  3L11 A;  2QIZ A;  5KO4 A;  5D3S A;  5LKX A;  5KU3 A;  5TRB A;  5IG6 A;  2KYU A;  4YBM A;  3LRQ A;  5D3P A;  4WZ0 A;  1WEQ A;  4YK0 A;  5L8U A;  2M85 A;  4L58 A;  5F1H A;  5H1U A;  3M63 A;  4LZR A;  5CU8 A;  4TT4 A;  3N9M A;  4GPJ A;  4MEP A;  4QSV A;  4A49 A;  3UV2 A;  4YAB A;  2VNF A;  5D3L A;  2FUU A;  4TTE A;  2EGP A;  4UYH A;  4O77 A;  4NYV A;  5TB6 A;  5E9L A;  5AD2 A;  5CUA A;  1WIM A;  3V43 A;  3UW9 A;  1CHC A;  4KCX A;  5D3N A;  4MR5 A;  2L43 A;  2NAA A;  2R0Y A;  5E9V A;  4N4H A;  2Y43 A;  2MD8 C;  2ECJ A;  5C4Q A;  1VYX A;  4O70 A;  5CUC A;  4QNS A;  4YYD A;  3KV5 A;  5G4R A;  4IC3 A;  5IGM A;  5FE4 A;  3U5P A;  5CUG A;  2KWK A;  5AIU A;  1WEW A;  4YBS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...