5TRBA

Crystal structure of the rnf20 ring domain
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
69
structure length
69
Chain Sequence
EILMEEIKDYKARLTCPCCNMRKKDAVLTKCFHVFCFECVKTRYDTRQRKCPKCNAAFGANDFHRIYIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and Function of the RING Domains of RNF20 and RNF40, Dimeric E3 Ligases that Monoubiquitylate Histone H2B.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase BRE1A
total genus 20
structure length 69
sequence length 69
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2016-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5trbA00
4R8PK 3N9QA 2YSMA 2HDPA 4V3LC 4A0CD 3LQJA 2EGPA 1JM7B 1Z2QA 4LLBA 1FBVA 4V3KC 2MA5A 3U5PA 2Y1MA 3MHHA 2JMJA 5LKTA 4AUQB 4FJCA 5TBNA 3HTKC 2VP7A 4MVTA 3VK6A 1MM2A 4YABA 5D1KB 3T6RA 5TDWA 1K2FA 3O70A 1WENA 4XI1A 1HYIA 1WIMA 1CHCA 3ZPV1 5LCWB 2M3HA 2LXPC 2M6MA 4I7BA 4L58A 4N3WA 2JMIA 4TKPB 2CSYA 2LN0A 3QZVA 3L11A 1V87A 1IYMA 2DX8A 3M63A 4ZDTA 5JG6A 3KV5A 4GNDA 2YW8A 4BBQA 1HYJA 3KQIA 2VPEA 5B78A 5EYAF 1F62A 2CSZA 4PPEA 1WEEA 3U5MA 3O37A 2L80A 2VJEB 2JRJA 3RPGC 4R7EA 2UZGA 1WE9A 4Q6FA 5G04B 5B8DA 2C2VS 4ZUXU 3RTRB 4I7DA 2H0DA 1DVPA 1VYXA 3LRQA 4B86C 4GNGA 1JM7A 5B79A 3N9NA 2ZETC 2VJFB 2YQLA 3PUQA 1E4UA 2VJEA 4R2YA 4YC9A 4CA1A 4ZQLA 3DQVR 3O34A 3N9OA 2LRIC 3U5OA 2YHNA 1T1HA 2KYUA 2VPDA 4N4FA 4LADB 1X4IA 3GL6A 3V43A 2FSAA 1U6GB 2KWKA 2G6QA 2L43A 4FK5A 4F52B 4AYCA 4C9ZA 4LKAA 3O36A 1ZBDB 2HYED 2L5UA 4UP0A 2MD8C 5B76A 2YREA 2K1JA 4A4BA 2YQMA 3T7LA 1WEUA 4AVXA 2KREA 4IC2A 5B77A 2MUMA 2ECTA 5TABA 2LQ6A 4S3OC 4AP4A 5KH3A 2NAAA 2LV9A 3ZNIA 4WZ3B 3N9MA 1LDJB 2F6JA 2EA6A 2M85A 4YATA 4FO9A 2KGGA 4P5OB 5G0FA 1LDKC 2VPGA 2MD7B 1JOCA 2YHOA 1Z6UA 2KWOA 2C2LA 2LXHC 3M62A 1WEMA 1G25A 2F42A 3O33A 1Z60A 4WZ0A 2Y43A 4FIPA 4YBMA 2M1RA 5B75A 2PNXA 2KWNA 2LDRA 2VJFA 4QF2A 2I50A 2JMDA 2OXQC 2RSDA 4YAXA 4WA6A 3GV4A 1BORA 5C11A 2G45A 5FB0A 5LKZA 2RI7A 3EB5A 4LJNA 2MNYA 3PURA 3SOUA 4CCGX 2ECJA 2YU4A 2XB1A 3O35A 1X4JA 5H1TA 3FL2A 5I3LA 5J3XA 5C13A 4LK9A 1VFYA 4WZ2A 3M99A 5FEYA 3SOXA 5H1UA 2YT5A 5DKAA 2KGIA 2QIZA 5H9MA 2LGVA 3C6WA 2MT5A 3DPLR 3L1XA 2MNZA 5LKUA 3RPGB 2CKLB 3ASLA 4YADA 1WEWA 2KWJA 5KH7A 1XWHA 4GNEA 3N9PA 2LGGA 4S3OB 5LKXA 3SHBA 2LGLA 2EODA 2KIZA 2YYRA 4A49A 1RMDA 3ZTGA 1WEPA 1WFKA 5AIUA 4YBTA 1WILA 2YUCA 3MHSA 3U5NA 2FUUA 3ZVYA 2L0BA 2YSJA 2K4DA 2L75A 5DINA 4BHWA 3L1ZB 4X3GA 4L7XA 2ECNA 3LQIA 3KNVA 4W4UA 2YURA 3IHPA 2F6NA 3LQHA 2CKLA 2ECIA 3ZYQA 4I7CA 2K17A 5D1MB 3C5KA 4O64A 4NN2A 2E6RA 1N87A 4PTBA 3O7AA 4GNFA 3ZVZB 4AYCB 2G43A 2QJ0A 2H0DB 2AN6A 1WEOA 5KH9A 1X4UA 3N9LA 1WEQA 2MIQA 1FP0A 2KR4A 2QICA 1MM3A 5FB1A 5D1LB 2FUIA 4QF3A 2KU3A 2K16A 2IDAA 5TDRA 2KFTA 3ZPVE 2VPBA 1WEVA 3HCTA 4IC3A 2E6SA 5G05B 1VD4A 4B7YC 5AITA 3HCUA 1WGMA 1WESA 4YBSA 2VNFA 5H1VA 2ECGA 2LGKA 3KV6A 2KE1A 4MSXA 4UP5A 3I2DA 5TRBA 2MA6A 3EB6A 4GB0A 2BAYA 3NG2A 2Y1NA 3SOWA 4UI9B 2PUYA 3HCSA 2ECWA 2CT2A 5FERA 2XEUA 2ECVA 4A4CA 2D8SA 3PHDA
chains in the Genus database with same CATH superfamily
4R8PK 3N9QA 2YSMA 2HDPA 3O47A 4V3LC 4A0CD 3LQJA 2EGPA 1JM7B 1Z2QA 3JUEA 4LLBA 1FBVA 4V3KC 2FFWA 3LVRE 2MA5A 3U5PA 2Y1MA 3MHHA 2JMJA 5LKTA 4AUQB 4FJCA 5TBNA 5SVIA 3T9KA 3HTKC 2VP7A 4MVTA 3VK6A 1MM2A 4YABA 3E2DA 5D1KB 3T6RA 5TDWA 1K2FA 3O70A 1WENA 4XI1A 1HYIA 3M7KA 1WIMA 1CHCA 3ZPV1 5LCWB 2KKYA 2M3HA 2LXPC 2M6MA 4I7BA 4L58A 4N3WA 2JMIA 4TKPB 2CSYA 2LN0A 3QZVA 4QQ4A 3L11A 1V87A 1IYMA 2DX8A 3M63A 4O62A 4ZDTA 5JG6A 3KV5A 4GNDA 2YW8A 4BBQA 2JM3A 1HYJA 3KQIA 2VPEA 5B78A 5EYAF 1F62A 5SVIB 2CSZA 4PPEA 1WEEA 2DSMA 3DDTA 3U5MA 3O37A 2L80A 2VJEB 2L7PA 3LDYA 2JRJA 3RPGC 4R7EA 2KKXA 2UZGA 1WE9A 4Q6FA 2P57A 5G04B 5B8DA 2C2VS 4ZUXU 3RTRB 4I7DA 2H0DA 1DVPA 1VYXA 3LRQA 4B86C 4GNGA 1JM7A 5B79A 3N9NA 2ZETC 2VJFB 2YQLA 3PUQA 1E4UA 2OWAA 2VJEA 5K3QA 4R2YA 4YC9A 4CA1A 4ZQLA 3DQVR 3O34A 3N9OA 2LRIC 3U5OA 2YHNA 1T1HA 2KYUA 2VPDA 4N4FA 4LADB 2XOZA 1X4IA 3GL6A 3V43A 2FSAA 1U6GB 2KWKA 2G6QA 2L43A 4FK5A 4F52B 4AYCA 4C9ZA 4LKAA 3O36A 1ZBDB 2HYED 2L5UA 4UP0A 2MD8C 5B76A 2YREA 2K1JA 4A4BA 2YQMA 3T7LA 1WEUA 4AVXA 2KREA 4IC2A 5B77A 2MUMA 2CONA 2ECTA 5TABA 2LQ6A 3FJUB 4S3OC 4AP4A 5KH3A 2NAAA 3FM8C 2LV9A 2XOCA 3ZNIA 4WZ3B 2LAUA 3N9MA 2E61A 1LDJB 2F6JA 2EA6A 3PLWA 2M85A 4YATA 4FO9A 2KGGA 4P5OB 5G0FA 1LDKC 2VPGA 2MD7B 2IQJA 1JOCA 2YHOA 1Z6UA 2KWOA 2C2LA 1MBMA 2LXHC 1WEMA 3M62A 1G25A 3LJUX 2F42A 3O33A 1Z60A 4WZ0A 2Y43A 4FIPA 4YBMA 3FAOA 2M1RA 5B75A 2PNXA 5SVXA 5SVYA 2KWNA 2LDRA 2VJFA 2D8UA 4QF2A 2I50A 2JMDA 2CRWA 2OXQC 2RSDA 4YAXA 4WA6A 3GV4A 1BORA 2EXUA 5C11A 2G45A 5FB0A 5LKZA 2RI7A 3EB5A 4LJNA 2CSVA 2MNYA 3PURA 3SOUA 4CCGX 4Z0OA 2ECJA 2YU4A 2XB1A 3O35A 1X4JA 5H1TA 3FL2A 5I3LA 5J3XA 5C13A 4LK9A 4WZ2A 1VFYA 3FEHA 3M99A 5FEYA 3SOXA 5H1UA 2XOYA 2YT5A 5DKAA 2KGIA 2QIZA 5H9MA 2LGVA 3C6WA 2MT5A 3DPLR 3L1XA 2MNZA 4OGEA 5LKUA 3KDEC 3RPGB 2CKLB 3ASLA 4OGCA 4YADA 1WEWA 4H9DA 2KWJA 5KH7A 1XWHA 4GNEA 3N9PA 2LGGA 2M13A 2YVRA 4S3OB 3SHBA 2LGLA 2EODA 5LKXA 2KIZA 2YYRA 4A49A 1RMDA 3ZTGA 1WEPA 3FANA 1WFKA 5AIUA 3MDBC 4YBTA 1WILA 2DJAA 2YUCA 3MHSA 3U5NA 2FUUA 3ZVYA 2L0BA 2JUNA 2EGMA 2YSJA 2K4DA 2L75A 5DINA 4BHWA 3DWDA 3L1ZB 4X3GA 4L7XA 4Z0RA 2ECNA 3LQIA 3KNVA 4W4UA 2YURA 3IHPA 2F6NA 3LQHA 2CKLA 2ECIA 3ZYQA 4I7CA 2K17A 5D1MB 3C5KA 4O64A 4NN2A 2E6RA 1N87A 4PTBA 3O7AA 4GNFA 3ZVZB 4AYCB 2CRRA 2G43A 2QJ0A 2H0DB 2AN6A 1WEOA 2B0OE 5KH9A 3H7HA 1X4UA 3N9LA 4F1PA 1WEQA 2MIQA 1FP0A 2KR4A 2QICA 1MM3A 5FB1A 5D1LB 2FUIA 4QF3A 2KU3A 2K16A 2IDAA 5TDRA 2KFTA 3ZPVE 3LVQE 2VPBA 1WEVA 3HCTA 4IC3A 2E6SA 5G05B 2FD4A 1VD4A 5AITA 4B7YC 3HCUA 1WGMA 1WESA 4YBSA 2VNFA 5H1VA 2ECGA 2LGKA 3KV6A 3SUBA 2KE1A 4MSXA 4UP5A 3Q1DA 3I2DA 5TRBA 2MA6A 3EB6A 4GB0A 2BAYA 3NG2A 2Y1NA 3SOWA 4UI9B 2PUYA 2MKEA 2XP0A 3HCSA 2ECWA 2CT2A 1DCQA 5FERA 2XEUA 2ECVA 2RR4A 4A4CA 2D8SA 3PHDA
chains in the Genus database with same CATH topology
4R8PK 3N9QA 2YSMA 2HDPA 4V3LC 4A0CD 3LQJA 2EGPA 1JM7B 1Z2QA 4LLBA 1FBVA 4V3KC 2MA5A 3U5PA 2Y1MA 3MHHA 2JMJA 5LKTA 4AUQB 4FJCA 5TBNA 3HTKC 2VP7A 4MVTA 3VK6A 1MM2A 4YABA 5D1KB 3T6RA 5TDWA 1K2FA 3O70A 1WENA 4XI1A 1HYIA 1WIMA 1CHCA 3ZPV1 5LCWB 2M3HA 2LXPC 2M6MA 4I7BA 4L58A 4N3WA 2JMIA 4TKPB 2CSYA 2LN0A 3QZVA 3L11A 1V87A 1IYMA 2DX8A 3M63A 4ZDTA 5JG6A 3KV5A 4GNDA 2YW8A 4BBQA 1HYJA 3KQIA 2VPEA 5B78A 5EYAF 1F62A 2CSZA 4PPEA 1WEEA 3U5MA 3O37A 2L80A 2VJEB 2JRJA 3RPGC 4R7EA 2UZGA 1WE9A 4Q6FA 5G04B 5B8DA 2C2VS 4ZUXU 3RTRB 4I7DA 2H0DA 1DVPA 1VYXA 3LRQA 4B86C 4GNGA 1JM7A 5B79A 3N9NA 2ZETC 2VJFB 2YQLA 3PUQA 1E4UA 2VJEA 4R2YA 4YC9A 4CA1A 4ZQLA 3DQVR 3O34A 3N9OA 2LRIC 3U5OA 2YHNA 1T1HA 2KYUA 2VPDA 4N4FA 4LADB 1X4IA 3GL6A 3V43A 2FSAA 1U6GB 2KWKA 2G6QA 2L43A 4FK5A 4F52B 4AYCA 4C9ZA 4LKAA 3O36A 1ZBDB 2HYED 2L5UA 4UP0A 2MD8C 5B76A 2YREA 2K1JA 4A4BA 2YQMA 3T7LA 1WEUA 4AVXA 2KREA 4IC2A 5B77A 2MUMA 2ECTA 5TABA 2LQ6A 4S3OC 4AP4A 5KH3A 2NAAA 2LV9A 3ZNIA 4WZ3B 3N9MA 1LDJB 2F6JA 2EA6A 2M85A 4YATA 4FO9A 2KGGA 4P5OB 5G0FA 1LDKC 2VPGA 2MD7B 1JOCA 2YHOA 1Z6UA 2KWOA 2C2LA 2LXHC 3M62A 1WEMA 1G25A 2F42A 3O33A 1Z60A 4WZ0A 2Y43A 4FIPA 4YBMA 2M1RA 5B75A 2PNXA 2KWNA 2LDRA 2VJFA 4QF2A 2I50A 2JMDA 2OXQC 2RSDA 4YAXA 4WA6A 3GV4A 1BORA 5C11A 2G45A 5FB0A 5LKZA 2RI7A 3EB5A 4LJNA 2MNYA 3PURA 3SOUA 4CCGX 2ECJA 2YU4A 2XB1A 3O35A 1X4JA 5H1TA 3FL2A 5I3LA 5J3XA 5C13A 4LK9A 1VFYA 4WZ2A 3M99A 5FEYA 3SOXA 5H1UA 2YT5A 5DKAA 2KGIA 2QIZA 5H9MA 2LGVA 3C6WA 2MT5A 3DPLR 3L1XA 2MNZA 5LKUA 3RPGB 2CKLB 3ASLA 4YADA 1WEWA 2KWJA 5KH7A 1XWHA 4GNEA 3N9PA 2LGGA 4S3OB 5LKXA 3SHBA 2LGLA 2EODA 2KIZA 2YYRA 4A49A 1RMDA 3ZTGA 1WEPA 1WFKA 5AIUA 4YBTA 1WILA 2YUCA 3MHSA 3U5NA 2FUUA 3ZVYA 2L0BA 2YSJA 2K4DA 2L75A 5DINA 4BHWA 3L1ZB 4X3GA 4L7XA 2ECNA 3LQIA 3KNVA 4W4UA 2YURA 3IHPA 2F6NA 3LQHA 2CKLA 2ECIA 3ZYQA 4I7CA 2K17A 5D1MB 3C5KA 4O64A 4NN2A 2E6RA 1N87A 4PTBA 3O7AA 4GNFA 3ZVZB 4AYCB 2G43A 2QJ0A 2H0DB 2AN6A 1WEOA 5KH9A 1X4UA 3N9LA 1WEQA 2MIQA 1FP0A 2KR4A 2QICA 1MM3A 5FB1A 5D1LB 2FUIA 4QF3A 2KU3A 2K16A 2IDAA 5TDRA 2KFTA 3ZPVE 2VPBA 1WEVA 3HCTA 4IC3A 2E6SA 5G05B 1VD4A 4B7YC 5AITA 3HCUA 1WGMA 1WESA 4YBSA 2VNFA 5H1VA 2ECGA 2LGKA 3KV6A 2KE1A 4MSXA 4UP5A 3I2DA 5TRBA 2MA6A 3EB6A 4GB0A 2BAYA 3NG2A 2Y1NA 3SOWA 4UI9B 2PUYA 3HCSA 2ECWA 2CT2A 5FERA 2XEUA 2ECVA 4A4CA 2D8SA 3PHDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R8P K;  3N9Q A;  2YSM A;  2HDP A;  4V3L C;  4A0C D;  3LQJ A;  2EGP A;  1JM7 B;  1Z2Q A;  4LLB A;  1FBV A;  4V3K C;  2MA5 A;  3U5P A;  2Y1M A;  3MHH A;  2JMJ A;  5LKT A;  4AUQ B;  4FJC A;  5TBN A;  3HTK C;  2VP7 A;  4MVT A;  3VK6 A;  1MM2 A;  4YAB A;  5D1K B;  3T6R A;  5TDW A;  1K2F A;  3O70 A;  1WEN A;  4XI1 A;  1HYI A;  1WIM A;  1CHC A;  3ZPV 1;  5LCW B;  2M3H A;  2LXP C;  2M6M A;  4I7B A;  4L58 A;  4N3W A;  2JMI A;  4TKP B;  2CSY A;  2LN0 A;  3QZV A;  3L11 A;  1V87 A;  1IYM A;  2DX8 A;  3M63 A;  4ZDT A;  5JG6 A;  3KV5 A;  4GND A;  2YW8 A;  4BBQ A;  1HYJ A;  3KQI A;  2VPE A;  5B78 A;  5EYA F;  1F62 A;  2CSZ A;  4PPE A;  1WEE A;  3U5M A;  3O37 A;  2L80 A;  2VJE B;  2JRJ A;  3RPG C;  4R7E A;  2UZG A;  1WE9 A;  4Q6F A;  5G04 B;  5B8D A;  2C2V S;  4ZUX U;  3RTR B;  4I7D A;  2H0D A;  1DVP A;  1VYX A;  3LRQ A;  4B86 C;  4GNG A;  1JM7 A;  5B79 A;  3N9N A;  2ZET C;  2VJF B;  2YQL A;  3PUQ A;  1E4U A;  2VJE A;  4R2Y A;  4YC9 A;  4CA1 A;  4ZQL A;  3DQV R;  3O34 A;  3N9O A;  2LRI C;  3U5O A;  2YHN A;  1T1H A;  2KYU A;  2VPD A;  4N4F A;  4LAD B;  1X4I A;  3GL6 A;  3V43 A;  2FSA A;  1U6G B;  2KWK A;  2G6Q A;  2L43 A;  4FK5 A;  4F52 B;  4AYC A;  4C9Z A;  4LKA A;  3O36 A;  1ZBD B;  2HYE D;  2L5U A;  4UP0 A;  2MD8 C;  5B76 A;  2YRE A;  2K1J A;  4A4B A;  2YQM A;  3T7L A;  1WEU A;  4AVX A;  2KRE A;  4IC2 A;  5B77 A;  2MUM A;  2ECT A;  5TAB A;  2LQ6 A;  4S3O C;  4AP4 A;  5KH3 A;  2NAA A;  2LV9 A;  3ZNI A;  4WZ3 B;  3N9M A;  1LDJ B;  2F6J A;  2EA6 A;  2M85 A;  4YAT A;  4FO9 A;  2KGG A;  4P5O B;  5G0F A;  1LDK C;  2VPG A;  2MD7 B;  1JOC A;  2YHO A;  1Z6U A;  2KWO A;  2C2L A;  2LXH C;  3M62 A;  1WEM A;  1G25 A;  2F42 A;  3O33 A;  1Z60 A;  4WZ0 A;  2Y43 A;  4FIP A;  4YBM A;  2M1R A;  5B75 A;  2PNX A;  2KWN A;  2LDR A;  2VJF A;  4QF2 A;  2I50 A;  2JMD A;  2OXQ C;  2RSD A;  4YAX A;  4WA6 A;  3GV4 A;  1BOR A;  5C11 A;  2G45 A;  5FB0 A;  5LKZ A;  2RI7 A;  3EB5 A;  4LJN A;  2MNY A;  3PUR A;  3SOU A;  4CCG X;  2ECJ A;  2YU4 A;  2XB1 A;  3O35 A;  1X4J A;  5H1T A;  3FL2 A;  5I3L A;  5J3X A;  5C13 A;  4LK9 A;  1VFY A;  4WZ2 A;  3M99 A;  5FEY A;  3SOX A;  5H1U A;  2YT5 A;  5DKA A;  2KGI A;  2QIZ A;  5H9M A;  2LGV A;  3C6W A;  2MT5 A;  3DPL R;  3L1X A;  2MNZ A;  5LKU A;  3RPG B;  2CKL B;  3ASL A;  4YAD A;  1WEW A;  2KWJ A;  5KH7 A;  1XWH A;  4GNE A;  3N9P A;  2LGG A;  4S3O B;  5LKX A;  3SHB A;  2LGL A;  2EOD A;  2KIZ A;  2YYR A;  4A49 A;  1RMD A;  3ZTG A;  1WEP A;  1WFK A;  5AIU A;  4YBT A;  1WIL A;  2YUC A;  3MHS A;  3U5N A;  2FUU A;  3ZVY A;  2L0B A;  2YSJ A;  2K4D A;  2L75 A;  5DIN A;  4BHW A;  3L1Z B;  4X3G A;  4L7X A;  2ECN A;  3LQI A;  3KNV A;  4W4U A;  2YUR A;  3IHP A;  2F6N A;  3LQH A;  2CKL A;  2ECI A;  3ZYQ A;  4I7C A;  2K17 A;  5D1M B;  3C5K A;  4O64 A;  4NN2 A;  2E6R A;  1N87 A;  4PTB A;  3O7A A;  4GNF A;  3ZVZ B;  4AYC B;  2G43 A;  2QJ0 A;  2H0D B;  2AN6 A;  1WEO A;  5KH9 A;  1X4U A;  3N9L A;  1WEQ A;  2MIQ A;  1FP0 A;  2KR4 A;  2QIC A;  1MM3 A;  5FB1 A;  5D1L B;  2FUI A;  4QF3 A;  2KU3 A;  2K16 A;  2IDA A;  5TDR A;  2KFT A;  3ZPV E;  2VPB A;  1WEV A;  3HCT A;  4IC3 A;  2E6S A;  5G05 B;  1VD4 A;  4B7Y C;  5AIT A;  3HCU A;  1WGM A;  1WES A;  4YBS A;  2VNF A;  5H1V A;  2ECG A;  2LGK A;  3KV6 A;  2KE1 A;  4MSX A;  4UP5 A;  3I2D A;  5TRB A;  2MA6 A;  3EB6 A;  4GB0 A;  2BAY A;  3NG2 A;  2Y1N A;  3SOW A;  4UI9 B;  2PUY A;  3HCS A;  2ECW A;  2CT2 A;  5FER A;  2XEU A;  2ECV A;  4A4C A;  2D8S A;  3PHD A; 
#chains in the Genus database with same CATH topology
 4R8P K;  3N9Q A;  2YSM A;  2HDP A;  3O47 A;  4V3L C;  4A0C D;  3LQJ A;  2EGP A;  1JM7 B;  1Z2Q A;  3JUE A;  4LLB A;  1FBV A;  4V3K C;  2FFW A;  3LVR E;  2MA5 A;  3U5P A;  2Y1M A;  3MHH A;  2JMJ A;  5LKT A;  4AUQ B;  4FJC A;  5TBN A;  5SVI A;  3T9K A;  3HTK C;  2VP7 A;  4MVT A;  3VK6 A;  1MM2 A;  4YAB A;  3E2D A;  5D1K B;  3T6R A;  5TDW A;  1K2F A;  3O70 A;  1WEN A;  4XI1 A;  1HYI A;  3M7K A;  1WIM A;  1CHC A;  3ZPV 1;  5LCW B;  2KKY A;  2M3H A;  2LXP C;  2M6M A;  4I7B A;  4L58 A;  4N3W A;  2JMI A;  4TKP B;  2CSY A;  2LN0 A;  3QZV A;  4QQ4 A;  3L11 A;  1V87 A;  1IYM A;  2DX8 A;  3M63 A;  4O62 A;  4ZDT A;  5JG6 A;  3KV5 A;  4GND A;  2YW8 A;  4BBQ A;  2JM3 A;  1HYJ A;  3KQI A;  2VPE A;  5B78 A;  5EYA F;  1F62 A;  5SVI B;  2CSZ A;  4PPE A;  1WEE A;  2DSM A;  3DDT A;  3U5M A;  3O37 A;  2L80 A;  2VJE B;  2L7P A;  3LDY A;  2JRJ A;  3RPG C;  4R7E A;  2KKX A;  2UZG A;  1WE9 A;  4Q6F A;  2P57 A;  5G04 B;  5B8D A;  2C2V S;  4ZUX U;  3RTR B;  4I7D A;  2H0D A;  1DVP A;  1VYX A;  3LRQ A;  4B86 C;  4GNG A;  1JM7 A;  5B79 A;  3N9N A;  2ZET C;  2VJF B;  2YQL A;  3PUQ A;  1E4U A;  2OWA A;  2VJE A;  5K3Q A;  4R2Y A;  4YC9 A;  4CA1 A;  4ZQL A;  3DQV R;  3O34 A;  3N9O A;  2LRI C;  3U5O A;  2YHN A;  1T1H A;  2KYU A;  2VPD A;  4N4F A;  4LAD B;  2XOZ A;  1X4I A;  3GL6 A;  3V43 A;  2FSA A;  1U6G B;  2KWK A;  2G6Q A;  2L43 A;  4FK5 A;  4F52 B;  4AYC A;  4C9Z A;  4LKA A;  3O36 A;  1ZBD B;  2HYE D;  2L5U A;  4UP0 A;  2MD8 C;  5B76 A;  2YRE A;  2K1J A;  4A4B A;  2YQM A;  3T7L A;  1WEU A;  4AVX A;  2KRE A;  4IC2 A;  5B77 A;  2MUM A;  2CON A;  2ECT A;  5TAB A;  2LQ6 A;  3FJU B;  4S3O C;  4AP4 A;  5KH3 A;  2NAA A;  3FM8 C;  2LV9 A;  2XOC A;  3ZNI A;  4WZ3 B;  2LAU A;  3N9M A;  2E61 A;  1LDJ B;  2F6J A;  2EA6 A;  3PLW A;  2M85 A;  4YAT A;  4FO9 A;  2KGG A;  4P5O B;  5G0F A;  1LDK C;  2VPG A;  2MD7 B;  2IQJ A;  1JOC A;  2YHO A;  1Z6U A;  2KWO A;  2C2L A;  1MBM A;  2LXH C;  1WEM A;  3M62 A;  1G25 A;  3LJU X;  2F42 A;  3O33 A;  1Z60 A;  4WZ0 A;  2Y43 A;  4FIP A;  4YBM A;  3FAO A;  2M1R A;  5B75 A;  2PNX A;  5SVX A;  5SVY A;  2KWN A;  2LDR A;  2VJF A;  2D8U A;  4QF2 A;  2I50 A;  2JMD A;  2CRW A;  2OXQ C;  2RSD A;  4YAX A;  4WA6 A;  3GV4 A;  1BOR A;  2EXU A;  5C11 A;  2G45 A;  5FB0 A;  5LKZ A;  2RI7 A;  3EB5 A;  4LJN A;  2CSV A;  2MNY A;  3PUR A;  3SOU A;  4CCG X;  4Z0O A;  2ECJ A;  2YU4 A;  2XB1 A;  3O35 A;  1X4J A;  5H1T A;  3FL2 A;  5I3L A;  5J3X A;  5C13 A;  4LK9 A;  4WZ2 A;  1VFY A;  3FEH A;  3M99 A;  5FEY A;  3SOX A;  5H1U A;  2XOY A;  2YT5 A;  5DKA A;  2KGI A;  2QIZ A;  5H9M A;  2LGV A;  3C6W A;  2MT5 A;  3DPL R;  3L1X A;  2MNZ A;  4OGE A;  5LKU A;  3KDE C;  3RPG B;  2CKL B;  3ASL A;  4OGC A;  4YAD A;  1WEW A;  4H9D A;  2KWJ A;  5KH7 A;  1XWH A;  4GNE A;  3N9P A;  2LGG A;  2M13 A;  2YVR A;  4S3O B;  3SHB A;  2LGL A;  2EOD A;  5LKX A;  2KIZ A;  2YYR A;  4A49 A;  1RMD A;  3ZTG A;  1WEP A;  3FAN A;  1WFK A;  5AIU A;  3MDB C;  4YBT A;  1WIL A;  2DJA A;  2YUC A;  3MHS A;  3U5N A;  2FUU A;  3ZVY A;  2L0B A;  2JUN A;  2EGM A;  2YSJ A;  2K4D A;  2L75 A;  5DIN A;  4BHW A;  3DWD A;  3L1Z B;  4X3G A;  4L7X A;  4Z0R A;  2ECN A;  3LQI A;  3KNV A;  4W4U A;  2YUR A;  3IHP A;  2F6N A;  3LQH A;  2CKL A;  2ECI A;  3ZYQ A;  4I7C A;  2K17 A;  5D1M B;  3C5K A;  4O64 A;  4NN2 A;  2E6R A;  1N87 A;  4PTB A;  3O7A A;  4GNF A;  3ZVZ B;  4AYC B;  2CRR A;  2G43 A;  2QJ0 A;  2H0D B;  2AN6 A;  1WEO A;  2B0O E;  5KH9 A;  3H7H A;  1X4U A;  3N9L A;  4F1P A;  1WEQ A;  2MIQ A;  1FP0 A;  2KR4 A;  2QIC A;  1MM3 A;  5FB1 A;  5D1L B;  2FUI A;  4QF3 A;  2KU3 A;  2K16 A;  2IDA A;  5TDR A;  2KFT A;  3ZPV E;  3LVQ E;  2VPB A;  1WEV A;  3HCT A;  4IC3 A;  2E6S A;  5G05 B;  2FD4 A;  1VD4 A;  5AIT A;  4B7Y C;  3HCU A;  1WGM A;  1WES A;  4YBS A;  2VNF A;  5H1V A;  2ECG A;  2LGK A;  3KV6 A;  3SUB A;  2KE1 A;  4MSX A;  4UP5 A;  3Q1D A;  3I2D A;  5TRB A;  2MA6 A;  3EB6 A;  4GB0 A;  2BAY A;  3NG2 A;  2Y1N A;  3SOW A;  4UI9 B;  2PUY A;  2MKE A;  2XP0 A;  3HCS A;  2ECW A;  2CT2 A;  1DCQ A;  5FER A;  2XEU A;  2ECV A;  2RR4 A;  4A4C A;  2D8S A;  3PHD A; 
#chains in the Genus database with same CATH homology
 4R8P K;  3N9Q A;  2YSM A;  2HDP A;  4V3L C;  4A0C D;  3LQJ A;  2EGP A;  1JM7 B;  1Z2Q A;  4LLB A;  1FBV A;  4V3K C;  2MA5 A;  3U5P A;  2Y1M A;  3MHH A;  2JMJ A;  5LKT A;  4AUQ B;  4FJC A;  5TBN A;  3HTK C;  2VP7 A;  4MVT A;  3VK6 A;  1MM2 A;  4YAB A;  5D1K B;  3T6R A;  5TDW A;  1K2F A;  3O70 A;  1WEN A;  4XI1 A;  1HYI A;  1WIM A;  1CHC A;  3ZPV 1;  5LCW B;  2M3H A;  2LXP C;  2M6M A;  4I7B A;  4L58 A;  4N3W A;  2JMI A;  4TKP B;  2CSY A;  2LN0 A;  3QZV A;  3L11 A;  1V87 A;  1IYM A;  2DX8 A;  3M63 A;  4ZDT A;  5JG6 A;  3KV5 A;  4GND A;  2YW8 A;  4BBQ A;  1HYJ A;  3KQI A;  2VPE A;  5B78 A;  5EYA F;  1F62 A;  2CSZ A;  4PPE A;  1WEE A;  3U5M A;  3O37 A;  2L80 A;  2VJE B;  2JRJ A;  3RPG C;  4R7E A;  2UZG A;  1WE9 A;  4Q6F A;  5G04 B;  5B8D A;  2C2V S;  4ZUX U;  3RTR B;  4I7D A;  2H0D A;  1DVP A;  1VYX A;  3LRQ A;  4B86 C;  4GNG A;  1JM7 A;  5B79 A;  3N9N A;  2ZET C;  2VJF B;  2YQL A;  3PUQ A;  1E4U A;  2VJE A;  4R2Y A;  4YC9 A;  4CA1 A;  4ZQL A;  3DQV R;  3O34 A;  3N9O A;  2LRI C;  3U5O A;  2YHN A;  1T1H A;  2KYU A;  2VPD A;  4N4F A;  4LAD B;  1X4I A;  3GL6 A;  3V43 A;  2FSA A;  1U6G B;  2KWK A;  2G6Q A;  2L43 A;  4FK5 A;  4F52 B;  4AYC A;  4C9Z A;  4LKA A;  3O36 A;  1ZBD B;  2HYE D;  2L5U A;  4UP0 A;  2MD8 C;  5B76 A;  2YRE A;  2K1J A;  4A4B A;  2YQM A;  3T7L A;  1WEU A;  4AVX A;  2KRE A;  4IC2 A;  5B77 A;  2MUM A;  2ECT A;  5TAB A;  2LQ6 A;  4S3O C;  4AP4 A;  5KH3 A;  2NAA A;  2LV9 A;  3ZNI A;  4WZ3 B;  3N9M A;  1LDJ B;  2F6J A;  2EA6 A;  2M85 A;  4YAT A;  4FO9 A;  2KGG A;  4P5O B;  5G0F A;  1LDK C;  2VPG A;  2MD7 B;  1JOC A;  2YHO A;  1Z6U A;  2KWO A;  2C2L A;  2LXH C;  3M62 A;  1WEM A;  1G25 A;  2F42 A;  3O33 A;  1Z60 A;  4WZ0 A;  2Y43 A;  4FIP A;  4YBM A;  2M1R A;  5B75 A;  2PNX A;  2KWN A;  2LDR A;  2VJF A;  4QF2 A;  2I50 A;  2JMD A;  2OXQ C;  2RSD A;  4YAX A;  4WA6 A;  3GV4 A;  1BOR A;  5C11 A;  2G45 A;  5FB0 A;  5LKZ A;  2RI7 A;  3EB5 A;  4LJN A;  2MNY A;  3PUR A;  3SOU A;  4CCG X;  2ECJ A;  2YU4 A;  2XB1 A;  3O35 A;  1X4J A;  5H1T A;  3FL2 A;  5I3L A;  5J3X A;  5C13 A;  4LK9 A;  1VFY A;  4WZ2 A;  3M99 A;  5FEY A;  3SOX A;  5H1U A;  2YT5 A;  5DKA A;  2KGI A;  2QIZ A;  5H9M A;  2LGV A;  3C6W A;  2MT5 A;  3DPL R;  3L1X A;  2MNZ A;  5LKU A;  3RPG B;  2CKL B;  3ASL A;  4YAD A;  1WEW A;  2KWJ A;  5KH7 A;  1XWH A;  4GNE A;  3N9P A;  2LGG A;  4S3O B;  5LKX A;  3SHB A;  2LGL A;  2EOD A;  2KIZ A;  2YYR A;  4A49 A;  1RMD A;  3ZTG A;  1WEP A;  1WFK A;  5AIU A;  4YBT A;  1WIL A;  2YUC A;  3MHS A;  3U5N A;  2FUU A;  3ZVY A;  2L0B A;  2YSJ A;  2K4D A;  2L75 A;  5DIN A;  4BHW A;  3L1Z B;  4X3G A;  4L7X A;  2ECN A;  3LQI A;  3KNV A;  4W4U A;  2YUR A;  3IHP A;  2F6N A;  3LQH A;  2CKL A;  2ECI A;  3ZYQ A;  4I7C A;  2K17 A;  5D1M B;  3C5K A;  4O64 A;  4NN2 A;  2E6R A;  1N87 A;  4PTB A;  3O7A A;  4GNF A;  3ZVZ B;  4AYC B;  2G43 A;  2QJ0 A;  2H0D B;  2AN6 A;  1WEO A;  5KH9 A;  1X4U A;  3N9L A;  1WEQ A;  2MIQ A;  1FP0 A;  2KR4 A;  2QIC A;  1MM3 A;  5FB1 A;  5D1L B;  2FUI A;  4QF3 A;  2KU3 A;  2K16 A;  2IDA A;  5TDR A;  2KFT A;  3ZPV E;  2VPB A;  1WEV A;  3HCT A;  4IC3 A;  2E6S A;  5G05 B;  1VD4 A;  4B7Y C;  5AIT A;  3HCU A;  1WGM A;  1WES A;  4YBS A;  2VNF A;  5H1V A;  2ECG A;  2LGK A;  3KV6 A;  2KE1 A;  4MSX A;  4UP5 A;  3I2D A;  5TRB A;  2MA6 A;  3EB6 A;  4GB0 A;  2BAY A;  3NG2 A;  2Y1N A;  3SOW A;  4UI9 B;  2PUY A;  3HCS A;  2ECW A;  2CT2 A;  5FER A;  2XEU A;  2ECV A;  4A4C A;  2D8S A;  3PHD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...