5TRBA

Crystal structure of the rnf20 ring domain
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
69
structure length
69
Chain Sequence
EILMEEIKDYKARLTCPCCNMRKKDAVLTKCFHVFCFECVKTRYDTRQRKCPKCNAAFGANDFHRIYIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and Function of the RING Domains of RNF20 and RNF40, Dimeric E3 Ligases that Monoubiquitylate Histone H2B.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase BRE1A
total genus 20
structure length 69
sequence length 69
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2016-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5trbA00
5TBNA 4L7XA 3HCUA 2VJFA 5B75A 2L75A 1LDKC 4FK5A 3U5NA 1VD4A 4AP4A 1WILA 3EB6A 1U6GB 3RTRB 4ZDTA 3MHSA 3M99A 5J3XA 5LKZA 2LXPC 3HCTA 2ECIA 5FB0A 2L43A 2LGLA 3N9MA 5G04B 2KYUA 4V3KC 2G43A 1BORA 3DPLR 2EODA 2VPEA 3IHPA 4P5OB 2MIQA 3O36A 2KGGA 1X4IA 4YBTA 5G05B 5FERA 2ECGA 4FO9A 5DKAA 3ZYQA 2KREA 4MVTA 1WEPA 3SOXA 4UP0A 3U5MA 4N3WA 3N9QA 4YABA 1WEQA 5B76A 5D1KB 2KWNA 1Z60A 5EYAF 1Z6UA 2CSZA 2K16A 4A4BA 2YSMA 3C5KA 3VK6A 4PPEA 1HYJA 2MUMA 4WZ2A 2UZGA 1WIMA 3NG2A 1WEEA 1WFKA 3T6RA 4GNEA 2KWJA 2ZETC 5AITA 2YHNA 4R2YA 2LXHC 5TDWA 4Q6FA 2CKLA 3RPGC 2H0DB 2YURA 3N9LA 2LDRA 2Y43A 1T1HA 3O70A 3L1ZB 4WA6A 5KH3A 4S3OB 4UI9B 1K2FA 2G6QA 3LQJA 4FJCA 2LGVA 3C6WA 5H1VA 3ZVYA 4FIPA 5KH9A 3FL2A 4ZUXU 5B79A 4B7YC 2C2VS 2VJFB 2M1RA 4B86C 3KV6A 1WEOA 4A49A 4LKAA 2AN6A 3M63A 1FBVA 2MNZA 2YYRA 4GNDA 4PTBA 2NAAA 2ECWA 1FP0A 1XWHA 1MM2A 3PHDA 3N9NA 2EA6A 1WEVA 2BAYA 2VPDA 2RSDA 2ECTA 1WGMA 2F42A 2E6SA 1VFYA 1WEWA 2VPBA 4YADA 2XB1A 1VYXA 2MD8C 2IDAA 4BBQA 3L1XA 5B8DA 2LGGA 2D8SA 4AYCA 2H0DA 4I7CA 1G25A 3ZTGA 4C9ZA 2YU4A 1E4UA 1WE9A 3LRQA 4I7DA 3ZVZB 2KU3A 3L11A 2Y1MA 4I7BA 2QICA 3N9OA 4GNGA 2DX8A 4YBMA 2EGPA 2KFTA 2JRJA 2CKLB 4LLBA 3KV5A 1JOCA 4QF3A 5FB1A 5FEYA 2ECJA 2YQLA 4R8PK 2XEUA 2F6JA 2FUUA 3SOUA 4CCGX 3V43A 2ECVA 5H1TA 4BHWA 2K17A 4CA1A 1WESA 4O64A 5H1UA 5LKXA 5JG6A 4YATA 1F62A 3PURA 4W4UA 5C11A 2JMJA 2C2LA 4AVXA 2HYED 2G45A 5LKUA 2FSAA 5TDRA 4R7EA 2YT5A 2YHOA 3LQIA 3N9PA 5D1MB 2KR4A 2L5UA 2L80A 1X4JA 1JM7B 2LQ6A 1V87A 4V3LC 3ZPV1 5AIUA 2KWKA 4YAXA 5C13A 4IC2A 1IYMA 3HCSA 2I50A 3PUQA 2M6MA 3O35A 2K4DA 3KNVA 1Z2QA 1ZBDB 4NN2A 4WZ0A 2HDPA 4A0CD 2YSJA 3GL6A 5LCWB 2OXQC 4F52B 3DQVR 2F6NA 2RI7A 3M62A 1WEMA 2VNFA 3QZVA 4LK9A 4TKPB 2ECNA 5B78A 5H9MA 2LRIC 2PNXA 5G0FA 1N87A 5KH7A 2QJ0A 4XI1A 2K1JA 1RMDA 4IC3A 2MA6A 2YQMA 4WZ3B 2KE1A 2Y1NA 4LADB 3RPGB 3U5PA 3ZNIA 3KQIA 5I3LA 4L58A 3U5OA 3O37A 2QIZA 2VPGA 2LN0A 5DINA 2MA5A 2FUIA 1X4UA 2YUCA 1WENA 2LV9A 4QF2A 2YREA 2KWOA 3LQHA 4MSXA 2MD7B 5TABA 2YW8A 1CHCA 3T7LA 2MT5A 2VJEA 3GV4A 4A4CA 4AYCB 3ZPVE 4X3GA 4S3OC 5B77A 5D1LB 3O34A 2JMIA 3EB5A 3MHHA 5LKTA 3ASLA 1WEUA 2KGIA 2MNYA 2CT2A 4ZQLA 3I2DA 2VJEB 2JMDA 4GNFA 4LJNA 2PUYA 1HYIA 1JM7A 1DVPA 2LGKA 3HTKC 5TRBA 4YC9A 2CSYA 2VP7A 2L0BA 2M85A 4AUQB 4UP5A 2M3HA 3O7AA 1MM3A 2KIZA 1LDJB 3SOWA 3SHBA 4N4FA 4YBSA 3O33A 4GB0A 2E6RA
chains in the Genus database with same CATH superfamily
5TBNA 4L7XA 3HCUA 2VJFA 5B75A 4O62A 2L75A 1LDKC 2B0OE 5SVIA 4FK5A 3U5NA 1VD4A 4AP4A 1WILA 3EB6A 1U6GB 3RTRB 4ZDTA 3MHSA 3M99A 5J3XA 5LKZA 2LXPC 3HCTA 2ECIA 5FB0A 2L43A 2LGLA 3N9MA 5G04B 2KYUA 4V3KC 2D8UA 1BORA 2G43A 3DPLR 2EODA 2VPEA 3IHPA 4P5OB 2MIQA 3FJUB 3O36A 2KGGA 1X4IA 4YBTA 5G05B 5FERA 2ECGA 4FO9A 5DKAA 3ZYQA 2P57A 5SVIB 2KREA 3SUBA 4MVTA 1WEPA 3SOXA 5SVYA 4UP0A 3U5MA 2CRRA 3JUEA 4N3WA 3N9QA 1WEQA 4YABA 5B76A 5D1KB 2KWNA 3DDTA 1Z60A 3LDYA 5EYAF 1Z6UA 2CSZA 2K16A 4A4BA 3PLWA 2YSMA 3C5KA 3VK6A 4PPEA 2EXUA 1HYJA 2MUMA 4WZ2A 2UZGA 1WIMA 3NG2A 1WEEA 1WFKA 3T6RA 4GNEA 2KWJA 2ZETC 5AITA 4H9DA 3H7HA 2CSVA 2YHNA 4R2YA 2LXHC 5TDWA 4Q6FA 2CKLA 3RPGC 3LJUX 2H0DB 2YURA 3N9LA 2LDRA 2Y43A 4F1PA 1T1HA 3O70A 3L1ZB 4WA6A 5KH3A 4S3OB 4UI9B 1K2FA 1MBMA 2G6QA 3LQJA 4FJCA 2LGVA 3LVQE 3C6WA 5H1VA 3ZVYA 4FIPA 5KH9A 3FL2A 2RR4A 4ZUXU 2LAUA 5B79A 2XOZA 4B7YC 2C2VS 2VJFB 4QQ4A 2M1RA 2XOCA 4B86C 3LVRE 3KV6A 1WEOA 4A49A 4LKAA 2AN6A 3M63A 1FBVA 2MNZA 2YYRA 4GNDA 4PTBA 2NAAA 2ECWA 1FP0A 4Z0OA 1XWHA 1MM2A 3PHDA 3N9NA 2EA6A 1WEVA 2BAYA 2VPDA 2EGMA 2RSDA 2ECTA 1WGMA 2F42A 3O47A 2E6SA 1VFYA 1WEWA 2VPBA 3FANA 2XOYA 4YADA 2XB1A 1VYXA 2MD8C 2IDAA 4BBQA 2E61A 3L1XA 5B8DA 2LGGA 2D8SA 4AYCA 2H0DA 4I7CA 1G25A 2JM3A 3ZTGA 4C9ZA 2YU4A 1E4UA 1WE9A 3LRQA 4I7DA 3ZVZB 2KU3A 3DWDA 2DSMA 3L11A 2Y1MA 4I7BA 2QICA 3N9OA 2FD4A 3T9KA 4GNGA 2DX8A 4YBMA 2L7PA 2EGPA 2KFTA 2JRJA 2CKLB 2OWAA 4LLBA 2YVRA 3KV5A 1JOCA 4QF3A 5FB1A 5FEYA 2ECJA 2YQLA 4R8PK 2XEUA 2F6JA 2FUUA 3SOUA 4CCGX 5SVXA 3V43A 2ECVA 5H1TA 4BHWA 2K17A 2KKYA 4CA1A 1WESA 4O64A 5H1UA 5LKXA 5JG6A 4YATA 3FEHA 1F62A 3PURA 5K3QA 4W4UA 5C11A 2C2LA 2JMJA 4AVXA 2HYED 2G45A 5LKUA 2FSAA 5TDRA 4R7EA 2YT5A 2YHOA 3LQIA 3M7KA 3N9PA 5D1MB 2KR4A 2L5UA 2L80A 1X4JA 2DJAA 2LQ6A 1JM7B 1V87A 4V3LC 2JUNA 3ZPV1 4OGEA 5AIUA 2KWKA 4YAXA 5C13A 4IC2A 1IYMA 3HCSA 2I50A 3PUQA 2M6MA 3O35A 2K4DA 3KNVA 1Z2QA 1ZBDB 2FFWA 4NN2A 4WZ0A 2HDPA 4A0CD 2YSJA 3GL6A 1DCQA 5LCWB 2OXQC 4F52B 3DQVR 2F6NA 2RI7A 3M62A 1WEMA 2VNFA 3QZVA 4LK9A 4TKPB 2ECNA 4OGCA 5B78A 5H9MA 2CONA 2LRIC 2PNXA 5G0FA 1N87A 5KH7A 2QJ0A 4XI1A 2K1JA 1RMDA 4IC3A 2MKEA 2MA6A 2YQMA 3E2DA 4WZ3B 2KE1A 2Y1NA 4LADB 3RPGB 3U5PA 3ZNIA 3FM8C 3KQIA 3Q1DA 3FAOA 5I3LA 4L58A 3U5OA 3O37A 2QIZA 2VPGA 2LN0A 5DINA 2CRWA 2MA5A 2FUIA 1X4UA 2YUCA 1WENA 2LV9A 4QF2A 2YREA 2KWOA 3LQHA 2IQJA 4MSXA 2MD7B 5TABA 2YW8A 1CHCA 3T7LA 2MT5A 2VJEA 3GV4A 3MDBC 4A4CA 4AYCB 3ZPVE 4X3GA 4S3OC 5B77A 2XP0A 5D1LB 3O34A 2M13A 2JMIA 3EB5A 3MHHA 5LKTA 3ASLA 1WEUA 2KGIA 2MNYA 2CT2A 4ZQLA 3I2DA 2VJEB 2KKXA 2JMDA 4GNFA 4LJNA 3KDEC 2PUYA 1HYIA 1JM7A 1DVPA 2LGKA 3HTKC 5TRBA 4YC9A 2CSYA 2VP7A 2L0BA 2M85A 4AUQB 4UP5A 2M3HA 3O7AA 1MM3A 2KIZA 1LDJB 3SOWA 3SHBA 4N4FA 4YBSA 3O33A 4GB0A 4Z0RA 2E6RA
chains in the Genus database with same CATH topology
5TBNA 4L7XA 3HCUA 2VJFA 5B75A 2L75A 1LDKC 4FK5A 3U5NA 1VD4A 4AP4A 1WILA 3EB6A 1U6GB 3RTRB 4ZDTA 3MHSA 3M99A 5J3XA 5LKZA 2LXPC 3HCTA 2ECIA 5FB0A 2L43A 2LGLA 3N9MA 5G04B 2KYUA 4V3KC 2G43A 1BORA 3DPLR 2EODA 2VPEA 3IHPA 4P5OB 2MIQA 3O36A 2KGGA 1X4IA 4YBTA 5G05B 5FERA 2ECGA 4FO9A 5DKAA 3ZYQA 2KREA 4MVTA 1WEPA 3SOXA 4UP0A 3U5MA 4N3WA 3N9QA 4YABA 1WEQA 5B76A 5D1KB 2KWNA 1Z60A 5EYAF 1Z6UA 2CSZA 2K16A 4A4BA 2YSMA 3C5KA 3VK6A 4PPEA 1HYJA 2MUMA 4WZ2A 2UZGA 1WIMA 3NG2A 1WEEA 1WFKA 3T6RA 4GNEA 2KWJA 2ZETC 5AITA 2YHNA 4R2YA 2LXHC 5TDWA 4Q6FA 2CKLA 3RPGC 2H0DB 2YURA 3N9LA 2LDRA 2Y43A 1T1HA 3O70A 3L1ZB 4WA6A 5KH3A 4S3OB 4UI9B 1K2FA 2G6QA 3LQJA 4FJCA 2LGVA 3C6WA 5H1VA 3ZVYA 4FIPA 5KH9A 3FL2A 4ZUXU 5B79A 4B7YC 2C2VS 2VJFB 2M1RA 4B86C 3KV6A 1WEOA 4A49A 4LKAA 2AN6A 3M63A 1FBVA 2MNZA 2YYRA 4GNDA 4PTBA 2NAAA 2ECWA 1FP0A 1XWHA 1MM2A 3PHDA 3N9NA 2EA6A 1WEVA 2BAYA 2VPDA 2RSDA 2ECTA 1WGMA 2F42A 2E6SA 1VFYA 1WEWA 2VPBA 4YADA 2XB1A 1VYXA 2MD8C 2IDAA 4BBQA 3L1XA 5B8DA 2LGGA 2D8SA 4AYCA 2H0DA 4I7CA 1G25A 3ZTGA 4C9ZA 2YU4A 1E4UA 1WE9A 3LRQA 4I7DA 3ZVZB 2KU3A 3L11A 2Y1MA 4I7BA 2QICA 3N9OA 4GNGA 2DX8A 4YBMA 2EGPA 2KFTA 2JRJA 2CKLB 4LLBA 3KV5A 1JOCA 4QF3A 5FB1A 5FEYA 2ECJA 2YQLA 4R8PK 2XEUA 2F6JA 2FUUA 3SOUA 4CCGX 3V43A 2ECVA 5H1TA 4BHWA 2K17A 4CA1A 1WESA 4O64A 5H1UA 5LKXA 5JG6A 4YATA 1F62A 3PURA 4W4UA 5C11A 2JMJA 2C2LA 4AVXA 2HYED 2G45A 5LKUA 2FSAA 5TDRA 4R7EA 2YT5A 2YHOA 3LQIA 3N9PA 5D1MB 2KR4A 2L5UA 2L80A 1X4JA 1JM7B 2LQ6A 1V87A 4V3LC 3ZPV1 5AIUA 2KWKA 4YAXA 5C13A 4IC2A 1IYMA 3HCSA 2I50A 3PUQA 2M6MA 3O35A 2K4DA 3KNVA 1Z2QA 1ZBDB 4NN2A 4WZ0A 2HDPA 4A0CD 2YSJA 3GL6A 5LCWB 2OXQC 4F52B 3DQVR 2F6NA 2RI7A 3M62A 1WEMA 2VNFA 3QZVA 4LK9A 4TKPB 2ECNA 5B78A 5H9MA 2LRIC 2PNXA 5G0FA 1N87A 5KH7A 2QJ0A 4XI1A 2K1JA 1RMDA 4IC3A 2MA6A 2YQMA 4WZ3B 2KE1A 2Y1NA 4LADB 3RPGB 3U5PA 3ZNIA 3KQIA 5I3LA 4L58A 3U5OA 3O37A 2QIZA 2VPGA 2LN0A 5DINA 2MA5A 2FUIA 1X4UA 2YUCA 1WENA 2LV9A 4QF2A 2YREA 2KWOA 3LQHA 4MSXA 2MD7B 5TABA 2YW8A 1CHCA 3T7LA 2MT5A 2VJEA 3GV4A 4A4CA 4AYCB 3ZPVE 4X3GA 4S3OC 5B77A 5D1LB 3O34A 2JMIA 3EB5A 3MHHA 5LKTA 3ASLA 1WEUA 2KGIA 2MNYA 2CT2A 4ZQLA 3I2DA 2VJEB 2JMDA 4GNFA 4LJNA 2PUYA 1HYIA 1JM7A 1DVPA 2LGKA 3HTKC 5TRBA 4YC9A 2CSYA 2VP7A 2L0BA 2M85A 4AUQB 4UP5A 2M3HA 3O7AA 1MM3A 2KIZA 1LDJB 3SOWA 3SHBA 4N4FA 4YBSA 3O33A 4GB0A 2E6RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TBN A;  4L7X A;  3HCU A;  2VJF A;  5B75 A;  2L75 A;  1LDK C;  4FK5 A;  3U5N A;  1VD4 A;  4AP4 A;  1WIL A;  3EB6 A;  1U6G B;  3RTR B;  4ZDT A;  3MHS A;  3M99 A;  5J3X A;  5LKZ A;  2LXP C;  3HCT A;  2ECI A;  5FB0 A;  2L43 A;  2LGL A;  3N9M A;  5G04 B;  2KYU A;  4V3K C;  2G43 A;  1BOR A;  3DPL R;  2EOD A;  2VPE A;  3IHP A;  4P5O B;  2MIQ A;  3O36 A;  2KGG A;  1X4I A;  4YBT A;  5G05 B;  5FER A;  2ECG A;  4FO9 A;  5DKA A;  3ZYQ A;  2KRE A;  4MVT A;  1WEP A;  3SOX A;  4UP0 A;  3U5M A;  4N3W A;  3N9Q A;  4YAB A;  1WEQ A;  5B76 A;  5D1K B;  2KWN A;  1Z60 A;  5EYA F;  1Z6U A;  2CSZ A;  2K16 A;  4A4B A;  2YSM A;  3C5K A;  3VK6 A;  4PPE A;  1HYJ A;  2MUM A;  4WZ2 A;  2UZG A;  1WIM A;  3NG2 A;  1WEE A;  1WFK A;  3T6R A;  4GNE A;  2KWJ A;  2ZET C;  5AIT A;  2YHN A;  4R2Y A;  2LXH C;  5TDW A;  4Q6F A;  2CKL A;  3RPG C;  2H0D B;  2YUR A;  3N9L A;  2LDR A;  2Y43 A;  1T1H A;  3O70 A;  3L1Z B;  4WA6 A;  5KH3 A;  4S3O B;  4UI9 B;  1K2F A;  2G6Q A;  3LQJ A;  4FJC A;  2LGV A;  3C6W A;  5H1V A;  3ZVY A;  4FIP A;  5KH9 A;  3FL2 A;  4ZUX U;  5B79 A;  4B7Y C;  2C2V S;  2VJF B;  2M1R A;  4B86 C;  3KV6 A;  1WEO A;  4A49 A;  4LKA A;  2AN6 A;  3M63 A;  1FBV A;  2MNZ A;  2YYR A;  4GND A;  4PTB A;  2NAA A;  2ECW A;  1FP0 A;  1XWH A;  1MM2 A;  3PHD A;  3N9N A;  2EA6 A;  1WEV A;  2BAY A;  2VPD A;  2RSD A;  2ECT A;  1WGM A;  2F42 A;  2E6S A;  1VFY A;  1WEW A;  2VPB A;  4YAD A;  2XB1 A;  1VYX A;  2MD8 C;  2IDA A;  4BBQ A;  3L1X A;  5B8D A;  2LGG A;  2D8S A;  4AYC A;  2H0D A;  4I7C A;  1G25 A;  3ZTG A;  4C9Z A;  2YU4 A;  1E4U A;  1WE9 A;  3LRQ A;  4I7D A;  3ZVZ B;  2KU3 A;  3L11 A;  2Y1M A;  4I7B A;  2QIC A;  3N9O A;  4GNG A;  2DX8 A;  4YBM A;  2EGP A;  2KFT A;  2JRJ A;  2CKL B;  4LLB A;  3KV5 A;  1JOC A;  4QF3 A;  5FB1 A;  5FEY A;  2ECJ A;  2YQL A;  4R8P K;  2XEU A;  2F6J A;  2FUU A;  3SOU A;  4CCG X;  3V43 A;  2ECV A;  5H1T A;  4BHW A;  2K17 A;  4CA1 A;  1WES A;  4O64 A;  5H1U A;  5LKX A;  5JG6 A;  4YAT A;  1F62 A;  3PUR A;  4W4U A;  5C11 A;  2JMJ A;  2C2L A;  4AVX A;  2HYE D;  2G45 A;  5LKU A;  2FSA A;  5TDR A;  4R7E A;  2YT5 A;  2YHO A;  3LQI A;  3N9P A;  5D1M B;  2KR4 A;  2L5U A;  2L80 A;  1X4J A;  1JM7 B;  2LQ6 A;  1V87 A;  4V3L C;  3ZPV 1;  5AIU A;  2KWK A;  4YAX A;  5C13 A;  4IC2 A;  1IYM A;  3HCS A;  2I50 A;  3PUQ A;  2M6M A;  3O35 A;  2K4D A;  3KNV A;  1Z2Q A;  1ZBD B;  4NN2 A;  4WZ0 A;  2HDP A;  4A0C D;  2YSJ A;  3GL6 A;  5LCW B;  2OXQ C;  4F52 B;  3DQV R;  2F6N A;  2RI7 A;  3M62 A;  1WEM A;  2VNF A;  3QZV A;  4LK9 A;  4TKP B;  2ECN A;  5B78 A;  5H9M A;  2LRI C;  2PNX A;  5G0F A;  1N87 A;  5KH7 A;  2QJ0 A;  4XI1 A;  2K1J A;  1RMD A;  4IC3 A;  2MA6 A;  2YQM A;  4WZ3 B;  2KE1 A;  2Y1N A;  4LAD B;  3RPG B;  3U5P A;  3ZNI A;  3KQI A;  5I3L A;  4L58 A;  3U5O A;  3O37 A;  2QIZ A;  2VPG A;  2LN0 A;  5DIN A;  2MA5 A;  2FUI A;  1X4U A;  2YUC A;  1WEN A;  2LV9 A;  4QF2 A;  2YRE A;  2KWO A;  3LQH A;  4MSX A;  2MD7 B;  5TAB A;  2YW8 A;  1CHC A;  3T7L A;  2MT5 A;  2VJE A;  3GV4 A;  4A4C A;  4AYC B;  3ZPV E;  4X3G A;  4S3O C;  5B77 A;  5D1L B;  3O34 A;  2JMI A;  3EB5 A;  3MHH A;  5LKT A;  3ASL A;  1WEU A;  2KGI A;  2MNY A;  2CT2 A;  4ZQL A;  3I2D A;  2VJE B;  2JMD A;  4GNF A;  4LJN A;  2PUY A;  1HYI A;  1JM7 A;  1DVP A;  2LGK A;  3HTK C;  5TRB A;  4YC9 A;  2CSY A;  2VP7 A;  2L0B A;  2M85 A;  4AUQ B;  4UP5 A;  2M3H A;  3O7A A;  1MM3 A;  2KIZ A;  1LDJ B;  3SOW A;  3SHB A;  4N4F A;  4YBS A;  3O33 A;  4GB0 A;  2E6R A; 
#chains in the Genus database with same CATH topology
 5TBN A;  4L7X A;  3HCU A;  2VJF A;  5B75 A;  4O62 A;  2L75 A;  1LDK C;  2B0O E;  5SVI A;  4FK5 A;  3U5N A;  1VD4 A;  4AP4 A;  1WIL A;  3EB6 A;  1U6G B;  3RTR B;  4ZDT A;  3MHS A;  3M99 A;  5J3X A;  5LKZ A;  2LXP C;  3HCT A;  2ECI A;  5FB0 A;  2L43 A;  2LGL A;  3N9M A;  5G04 B;  2KYU A;  4V3K C;  2D8U A;  1BOR A;  2G43 A;  3DPL R;  2EOD A;  2VPE A;  3IHP A;  4P5O B;  2MIQ A;  3FJU B;  3O36 A;  2KGG A;  1X4I A;  4YBT A;  5G05 B;  5FER A;  2ECG A;  4FO9 A;  5DKA A;  3ZYQ A;  2P57 A;  5SVI B;  2KRE A;  3SUB A;  4MVT A;  1WEP A;  3SOX A;  5SVY A;  4UP0 A;  3U5M A;  2CRR A;  3JUE A;  4N3W A;  3N9Q A;  1WEQ A;  4YAB A;  5B76 A;  5D1K B;  2KWN A;  3DDT A;  1Z60 A;  3LDY A;  5EYA F;  1Z6U A;  2CSZ A;  2K16 A;  4A4B A;  3PLW A;  2YSM A;  3C5K A;  3VK6 A;  4PPE A;  2EXU A;  1HYJ A;  2MUM A;  4WZ2 A;  2UZG A;  1WIM A;  3NG2 A;  1WEE A;  1WFK A;  3T6R A;  4GNE A;  2KWJ A;  2ZET C;  5AIT A;  4H9D A;  3H7H A;  2CSV A;  2YHN A;  4R2Y A;  2LXH C;  5TDW A;  4Q6F A;  2CKL A;  3RPG C;  3LJU X;  2H0D B;  2YUR A;  3N9L A;  2LDR A;  2Y43 A;  4F1P A;  1T1H A;  3O70 A;  3L1Z B;  4WA6 A;  5KH3 A;  4S3O B;  4UI9 B;  1K2F A;  1MBM A;  2G6Q A;  3LQJ A;  4FJC A;  2LGV A;  3LVQ E;  3C6W A;  5H1V A;  3ZVY A;  4FIP A;  5KH9 A;  3FL2 A;  2RR4 A;  4ZUX U;  2LAU A;  5B79 A;  2XOZ A;  4B7Y C;  2C2V S;  2VJF B;  4QQ4 A;  2M1R A;  2XOC A;  4B86 C;  3LVR E;  3KV6 A;  1WEO A;  4A49 A;  4LKA A;  2AN6 A;  3M63 A;  1FBV A;  2MNZ A;  2YYR A;  4GND A;  4PTB A;  2NAA A;  2ECW A;  1FP0 A;  4Z0O A;  1XWH A;  1MM2 A;  3PHD A;  3N9N A;  2EA6 A;  1WEV A;  2BAY A;  2VPD A;  2EGM A;  2RSD A;  2ECT A;  1WGM A;  2F42 A;  3O47 A;  2E6S A;  1VFY A;  1WEW A;  2VPB A;  3FAN A;  2XOY A;  4YAD A;  2XB1 A;  1VYX A;  2MD8 C;  2IDA A;  4BBQ A;  2E61 A;  3L1X A;  5B8D A;  2LGG A;  2D8S A;  4AYC A;  2H0D A;  4I7C A;  1G25 A;  2JM3 A;  3ZTG A;  4C9Z A;  2YU4 A;  1E4U A;  1WE9 A;  3LRQ A;  4I7D A;  3ZVZ B;  2KU3 A;  3DWD A;  2DSM A;  3L11 A;  2Y1M A;  4I7B A;  2QIC A;  3N9O A;  2FD4 A;  3T9K A;  4GNG A;  2DX8 A;  4YBM A;  2L7P A;  2EGP A;  2KFT A;  2JRJ A;  2CKL B;  2OWA A;  4LLB A;  2YVR A;  3KV5 A;  1JOC A;  4QF3 A;  5FB1 A;  5FEY A;  2ECJ A;  2YQL A;  4R8P K;  2XEU A;  2F6J A;  2FUU A;  3SOU A;  4CCG X;  5SVX A;  3V43 A;  2ECV A;  5H1T A;  4BHW A;  2K17 A;  2KKY A;  4CA1 A;  1WES A;  4O64 A;  5H1U A;  5LKX A;  5JG6 A;  4YAT A;  3FEH A;  1F62 A;  3PUR A;  5K3Q A;  4W4U A;  5C11 A;  2C2L A;  2JMJ A;  4AVX A;  2HYE D;  2G45 A;  5LKU A;  2FSA A;  5TDR A;  4R7E A;  2YT5 A;  2YHO A;  3LQI A;  3M7K A;  3N9P A;  5D1M B;  2KR4 A;  2L5U A;  2L80 A;  1X4J A;  2DJA A;  2LQ6 A;  1JM7 B;  1V87 A;  4V3L C;  2JUN A;  3ZPV 1;  4OGE A;  5AIU A;  2KWK A;  4YAX A;  5C13 A;  4IC2 A;  1IYM A;  3HCS A;  2I50 A;  3PUQ A;  2M6M A;  3O35 A;  2K4D A;  3KNV A;  1Z2Q A;  1ZBD B;  2FFW A;  4NN2 A;  4WZ0 A;  2HDP A;  4A0C D;  2YSJ A;  3GL6 A;  1DCQ A;  5LCW B;  2OXQ C;  4F52 B;  3DQV R;  2F6N A;  2RI7 A;  3M62 A;  1WEM A;  2VNF A;  3QZV A;  4LK9 A;  4TKP B;  2ECN A;  4OGC A;  5B78 A;  5H9M A;  2CON A;  2LRI C;  2PNX A;  5G0F A;  1N87 A;  5KH7 A;  2QJ0 A;  4XI1 A;  2K1J A;  1RMD A;  4IC3 A;  2MKE A;  2MA6 A;  2YQM A;  3E2D A;  4WZ3 B;  2KE1 A;  2Y1N A;  4LAD B;  3RPG B;  3U5P A;  3ZNI A;  3FM8 C;  3KQI A;  3Q1D A;  3FAO A;  5I3L A;  4L58 A;  3U5O A;  3O37 A;  2QIZ A;  2VPG A;  2LN0 A;  5DIN A;  2CRW A;  2MA5 A;  2FUI A;  1X4U A;  2YUC A;  1WEN A;  2LV9 A;  4QF2 A;  2YRE A;  2KWO A;  3LQH A;  2IQJ A;  4MSX A;  2MD7 B;  5TAB A;  2YW8 A;  1CHC A;  3T7L A;  2MT5 A;  2VJE A;  3GV4 A;  3MDB C;  4A4C A;  4AYC B;  3ZPV E;  4X3G A;  4S3O C;  5B77 A;  2XP0 A;  5D1L B;  3O34 A;  2M13 A;  2JMI A;  3EB5 A;  3MHH A;  5LKT A;  3ASL A;  1WEU A;  2KGI A;  2MNY A;  2CT2 A;  4ZQL A;  3I2D A;  2VJE B;  2KKX A;  2JMD A;  4GNF A;  4LJN A;  3KDE C;  2PUY A;  1HYI A;  1JM7 A;  1DVP A;  2LGK A;  3HTK C;  5TRB A;  4YC9 A;  2CSY A;  2VP7 A;  2L0B A;  2M85 A;  4AUQ B;  4UP5 A;  2M3H A;  3O7A A;  1MM3 A;  2KIZ A;  1LDJ B;  3SOW A;  3SHB A;  4N4F A;  4YBS A;  3O33 A;  4GB0 A;  4Z0R A;  2E6R A; 
#chains in the Genus database with same CATH homology
 5TBN A;  4L7X A;  3HCU A;  2VJF A;  5B75 A;  2L75 A;  1LDK C;  4FK5 A;  3U5N A;  1VD4 A;  4AP4 A;  1WIL A;  3EB6 A;  1U6G B;  3RTR B;  4ZDT A;  3MHS A;  3M99 A;  5J3X A;  5LKZ A;  2LXP C;  3HCT A;  2ECI A;  5FB0 A;  2L43 A;  2LGL A;  3N9M A;  5G04 B;  2KYU A;  4V3K C;  2G43 A;  1BOR A;  3DPL R;  2EOD A;  2VPE A;  3IHP A;  4P5O B;  2MIQ A;  3O36 A;  2KGG A;  1X4I A;  4YBT A;  5G05 B;  5FER A;  2ECG A;  4FO9 A;  5DKA A;  3ZYQ A;  2KRE A;  4MVT A;  1WEP A;  3SOX A;  4UP0 A;  3U5M A;  4N3W A;  3N9Q A;  4YAB A;  1WEQ A;  5B76 A;  5D1K B;  2KWN A;  1Z60 A;  5EYA F;  1Z6U A;  2CSZ A;  2K16 A;  4A4B A;  2YSM A;  3C5K A;  3VK6 A;  4PPE A;  1HYJ A;  2MUM A;  4WZ2 A;  2UZG A;  1WIM A;  3NG2 A;  1WEE A;  1WFK A;  3T6R A;  4GNE A;  2KWJ A;  2ZET C;  5AIT A;  2YHN A;  4R2Y A;  2LXH C;  5TDW A;  4Q6F A;  2CKL A;  3RPG C;  2H0D B;  2YUR A;  3N9L A;  2LDR A;  2Y43 A;  1T1H A;  3O70 A;  3L1Z B;  4WA6 A;  5KH3 A;  4S3O B;  4UI9 B;  1K2F A;  2G6Q A;  3LQJ A;  4FJC A;  2LGV A;  3C6W A;  5H1V A;  3ZVY A;  4FIP A;  5KH9 A;  3FL2 A;  4ZUX U;  5B79 A;  4B7Y C;  2C2V S;  2VJF B;  2M1R A;  4B86 C;  3KV6 A;  1WEO A;  4A49 A;  4LKA A;  2AN6 A;  3M63 A;  1FBV A;  2MNZ A;  2YYR A;  4GND A;  4PTB A;  2NAA A;  2ECW A;  1FP0 A;  1XWH A;  1MM2 A;  3PHD A;  3N9N A;  2EA6 A;  1WEV A;  2BAY A;  2VPD A;  2RSD A;  2ECT A;  1WGM A;  2F42 A;  2E6S A;  1VFY A;  1WEW A;  2VPB A;  4YAD A;  2XB1 A;  1VYX A;  2MD8 C;  2IDA A;  4BBQ A;  3L1X A;  5B8D A;  2LGG A;  2D8S A;  4AYC A;  2H0D A;  4I7C A;  1G25 A;  3ZTG A;  4C9Z A;  2YU4 A;  1E4U A;  1WE9 A;  3LRQ A;  4I7D A;  3ZVZ B;  2KU3 A;  3L11 A;  2Y1M A;  4I7B A;  2QIC A;  3N9O A;  4GNG A;  2DX8 A;  4YBM A;  2EGP A;  2KFT A;  2JRJ A;  2CKL B;  4LLB A;  3KV5 A;  1JOC A;  4QF3 A;  5FB1 A;  5FEY A;  2ECJ A;  2YQL A;  4R8P K;  2XEU A;  2F6J A;  2FUU A;  3SOU A;  4CCG X;  3V43 A;  2ECV A;  5H1T A;  4BHW A;  2K17 A;  4CA1 A;  1WES A;  4O64 A;  5H1U A;  5LKX A;  5JG6 A;  4YAT A;  1F62 A;  3PUR A;  4W4U A;  5C11 A;  2JMJ A;  2C2L A;  4AVX A;  2HYE D;  2G45 A;  5LKU A;  2FSA A;  5TDR A;  4R7E A;  2YT5 A;  2YHO A;  3LQI A;  3N9P A;  5D1M B;  2KR4 A;  2L5U A;  2L80 A;  1X4J A;  1JM7 B;  2LQ6 A;  1V87 A;  4V3L C;  3ZPV 1;  5AIU A;  2KWK A;  4YAX A;  5C13 A;  4IC2 A;  1IYM A;  3HCS A;  2I50 A;  3PUQ A;  2M6M A;  3O35 A;  2K4D A;  3KNV A;  1Z2Q A;  1ZBD B;  4NN2 A;  4WZ0 A;  2HDP A;  4A0C D;  2YSJ A;  3GL6 A;  5LCW B;  2OXQ C;  4F52 B;  3DQV R;  2F6N A;  2RI7 A;  3M62 A;  1WEM A;  2VNF A;  3QZV A;  4LK9 A;  4TKP B;  2ECN A;  5B78 A;  5H9M A;  2LRI C;  2PNX A;  5G0F A;  1N87 A;  5KH7 A;  2QJ0 A;  4XI1 A;  2K1J A;  1RMD A;  4IC3 A;  2MA6 A;  2YQM A;  4WZ3 B;  2KE1 A;  2Y1N A;  4LAD B;  3RPG B;  3U5P A;  3ZNI A;  3KQI A;  5I3L A;  4L58 A;  3U5O A;  3O37 A;  2QIZ A;  2VPG A;  2LN0 A;  5DIN A;  2MA5 A;  2FUI A;  1X4U A;  2YUC A;  1WEN A;  2LV9 A;  4QF2 A;  2YRE A;  2KWO A;  3LQH A;  4MSX A;  2MD7 B;  5TAB A;  2YW8 A;  1CHC A;  3T7L A;  2MT5 A;  2VJE A;  3GV4 A;  4A4C A;  4AYC B;  3ZPV E;  4X3G A;  4S3O C;  5B77 A;  5D1L B;  3O34 A;  2JMI A;  3EB5 A;  3MHH A;  5LKT A;  3ASL A;  1WEU A;  2KGI A;  2MNY A;  2CT2 A;  4ZQL A;  3I2D A;  2VJE B;  2JMD A;  4GNF A;  4LJN A;  2PUY A;  1HYI A;  1JM7 A;  1DVP A;  2LGK A;  3HTK C;  5TRB A;  4YC9 A;  2CSY A;  2VP7 A;  2L0B A;  2M85 A;  4AUQ B;  4UP5 A;  2M3H A;  3O7A A;  1MM3 A;  2KIZ A;  1LDJ B;  3SOW A;  3SHB A;  4N4F A;  4YBS A;  3O33 A;  4GB0 A;  2E6R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...