5TRBA

Crystal structure of the rnf20 ring domain
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
69
structure length
69
Chain Sequence
EILMEEIKDYKARLTCPCCNMRKKDAVLTKCFHVFCFECVKTRYDTRQRKCPKCNAAFGANDFHRIYIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase BRE1A
publication title Structure and Function of the RING Domains of RNF20 and RNF40, Dimeric E3 Ligases that Monoubiquitylate Histone H2B.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 20
structure length 69
sequence length 69
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2016-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5trbA00
2FSAA 4F52B 4Q6FA 3HCTA 4GNGA 3N9MA 1WILA 5H1UA 3KV6A 4UP5A 2CSZA 1Z2QA 5LCWB 3KQIA 2L80A 4YADA 1WIMA 5LKZA 2LV9A 4FO9A 1LDJB 4I7DA 2MNYA 3N9QA 2VJEB 1ZBDB 3ZVYA 1VYXA 3O33A 2H0DB 5C13A 3C6WA 3PURA 5I3LA 2BAYA 4GNFA 4AYCB 4C9ZA 5TBNA 2YQLA 1WEQA 1WESA 3GL6A 1VFYA 2E6SA 1WE9A 4A4CA 3U5PA 2LGVA 2CKLB 2KGIA 2ECIA 1WEPA 2JMDA 2KGGA 2K17A 2OXQC 2G43A 4YBTA 1DVPA 5J3XA 3T6RA 4R8PK 4I7BA 4A4BA 2LGLA 4AVXA 3N9NA 2L5UA 2YSJA 3SOWA 1JM7A 2MA6A 3ZPV1 1CHCA 4N3WA 2MUMA 4X3GA 2ZETC 4CCGX 5D1LB 2YREA 5DINA 2F42A 2FUIA 2JMJA 2YU4A 3C5KA 1IYMA 2PUYA 5H1TA 5H9MA 1F62A 4LK9A 1VD4A 3SOXA 1WEMA 4S3OC 2ECVA 4B86C 1X4IA 1HYJA 2EODA 3QZVA 2NAAA 2CKLA 4R7EA 5LKTA 2YQMA 5G04B 2KWNA 4BHWA 4B7YC 1RMDA 2AN6A 2LRIC 5TABA 2LQ6A 3N9PA 4QF2A 2K1JA 3SHBA 4LKAA 2F6NA 4AP4A 5DKAA 2KE1A 2D8SA 3N9OA 3M62A 2YSMA 4P5OB 5LKUA 1WFKA 4V3LC 5EYAF 1BORA 4ZDTA 4W4UA 3LRQA 4R2YA 2QIZA 5B75A 2QJ0A 1WEWA 3IHPA 4MVTA 3LQHA 4TKPB 3DQVR 5TRBA 3FL2A 1JM7B 2HDPA 4GB0A 2LN0A 2C2LA 2YHOA 3DPLR 2L75A 3O7AA 3EB5A 2Y1NA 2K4DA 4L7XA 5AITA 3ZNIA 2G6QA 2M3HA 2XB1A 2YURA 4WZ2A 2Y43A 1FP0A 3O35A 3O37A 5G05B 3HCSA 5KH3A 4S3OB 5B79A 4IC2A 4V3KC 2MIQA 4CA1A 3L11A 3L1XA 1WEOA 2DX8A 3ZVZB 3RTRB 2VJFB 3ZTGA 4I7CA 5D1MB 5B8DA 2M85A 2EA6A 1U6GB 4N4FA 5AIUA 4YATA 5B77A 4AUQB 5C11A 2VNFA 2KFTA 5LKXA 3M99A 3RPGB 1Z60A 2LXHC 2VP7A 1MM2A 4YABA 3VK6A 2F6JA 2KR4A 1T1HA 3O70A 5FB1A 2LGGA 2YYRA 4L58A 4ZQLA 4PPEA 2CSYA 3ASLA 2Y1MA 2M1RA 2VPGA 2MA5A 2VJFA 3V43A 2I50A 4O64A 4BBQA 3U5MA 4QF3A 1WEVA 4MSXA 4PTBA 5FEYA 2UZGA 2VPBA 2KU3A 5TDRA 2IDAA 4WZ0A 3M63A 2MD8C 2MNZA 3RPGC 4ZUXU 2CT2A 2ECNA 1WENA 1WGMA 5FERA 2EGPA 1WEUA 3SOUA 2KWOA 4LADB 3HTKC 4UI9B 2MT5A 1G25A 2L0BA 2YT5A 3PUQA 2YHNA 5B76A 1WEEA 3U5NA 3LQJA 2JMIA 3O36A 3LQIA 2PNXA 3ZPVE 3NG2A 3O34A 4LJNA 4WA6A 5D1KB 1XWHA 4GNEA 3MHHA 2LXPC 2K16A 2VPDA 2MD7B 2KREA 1MM3A 2KYUA 2ECJA 5JG6A 5KH9A 2L43A 1X4UA 1JOCA 1FBVA 4IC3A 4YAXA 2RI7A 2KWKA 4XI1A 3PHDA 2C2VS 1V87A 2KWJA 2FUUA 2KIZA 3MHSA 2RSDA 4WZ3B 1HYIA 2VJEA 4FJCA 2VPEA 4A0CD 1Z6UA 2ECWA 5KH7A 4FIPA 2LDRA 2ECGA 2H0DA 3GV4A 5G0FA 4FK5A 2JRJA 2XEUA 3KV5A 4YBMA 4AYCA 2M6MA 2E6RA 1E4UA 2ECTA 5TDWA 2HYED 4GNDA 3I2DA 3U5OA 4YBSA 4YC9A 2YW8A 1N87A 2QICA 2G45A 4A49A 1K2FA 3HCUA 3ZYQA 1X4JA 5FB0A 3EB6A 4NN2A 2LGKA 3L1ZB 5H1VA 4UP0A 3T7LA 3KNVA 4LLBA 1LDKC 5B78A 3N9LA 2YUCA
chains in the Genus database with same CATH superfamily
2FSAA 4F52B 4Q6FA 3HCTA 4GNGA 3N9MA 1WILA 5H1UA 3KV6A 3LVQE 3T9KA 4UP5A 2CSZA 1Z2QA 5K3QA 5LCWB 3KQIA 2L80A 2KKXA 4YADA 1WIMA 5LKZA 2LV9A 4FO9A 1LDJB 4I7DA 2MNYA 3N9QA 2VJEB 2L7PA 5SVIB 3KDEC 4O62A 1ZBDB 3ZVYA 1VYXA 3O33A 2H0DB 5C13A 3C6WA 4Z0OA 3PURA 5I3LA 2E61A 2BAYA 4GNFA 4AYCB 2D8UA 2FD4A 4C9ZA 5TBNA 2YQLA 1WEQA 1WESA 3GL6A 1VFYA 1DCQA 2YVRA 2E6SA 2EXUA 1WE9A 4A4CA 3U5PA 2LGVA 2CKLB 2KGIA 2ECIA 1WEPA 2JMDA 2KGGA 2K17A 2OXQC 2G43A 4YBTA 1DVPA 5J3XA 5SVYA 3T6RA 4I7BA 4A4BA 4R8PK 2LGLA 4AVXA 3N9NA 2L5UA 2YSJA 3SOWA 1JM7A 2LAUA 2MA6A 3ZPV1 1CHCA 4N3WA 2MUMA 4X3GA 2ZETC 4CCGX 3JUEA 5D1LB 3DWDA 2YREA 3E2DA 5DINA 2F42A 2FUIA 2JMJA 2YU4A 3C5KA 4OGCA 1IYMA 2PUYA 5H1TA 5H9MA 1F62A 4LK9A 1VD4A 3SOXA 1WEMA 4S3OC 2ECVA 4B86C 1X4IA 1HYJA 2EODA 3QZVA 2NAAA 2CKLA 4R7EA 5LKTA 2CSVA 2YQMA 5G04B 2KWNA 4BHWA 4B7YC 1RMDA 2AN6A 2LRIC 2FFWA 3Q1DA 5TABA 2LQ6A 3N9PA 3SUBA 2DSMA 4QF2A 2K1JA 4OGEA 3SHBA 4LKAA 2F6NA 4AP4A 5DKAA 2KE1A 2D8SA 3N9OA 3M62A 2YSMA 4P5OB 5LKUA 1WFKA 4V3LC 5EYAF 1BORA 4ZDTA 4W4UA 3LRQA 4R2YA 2QIZA 5B75A 2QJ0A 1WEWA 3IHPA 4MVTA 3LQHA 4TKPB 3DQVR 5TRBA 3FANA 3FL2A 4F1PA 1JM7B 2HDPA 4GB0A 2LN0A 2C2LA 2YHOA 3DPLR 2L75A 3O7AA 3EB5A 2Y1NA 2K4DA 4L7XA 5AITA 3ZNIA 2G6QA 2M3HA 2XB1A 2YURA 4WZ2A 2Y43A 1FP0A 2P57A 3O35A 3O37A 5G05B 3HCSA 4Z0RA 5KH3A 4S3OB 5B79A 4IC2A 4V3KC 2IQJA 3LDYA 3MDBC 3M7KA 2EGMA 4H9DA 2XOYA 2MIQA 3FJUB 4CA1A 3L11A 3L1XA 1WEOA 2DX8A 3ZVZB 3RTRB 2VJFB 3ZTGA 4I7CA 5D1MB 5B8DA 2M85A 2EA6A 1U6GB 4N4FA 5AIUA 4YATA 5B77A 4QQ4A 4AUQB 5C11A 2JM3A 2VNFA 2KFTA 5LKXA 3M99A 3RPGB 1Z60A 2LXHC 2VP7A 1MM2A 4YABA 3VK6A 2F6JA 2KR4A 1T1HA 3O70A 5FB1A 2LGGA 2YYRA 4L58A 4ZQLA 4PPEA 2CSYA 3FM8C 3ASLA 3DDTA 2Y1MA 2M1RA 2VPGA 2MA5A 2VJFA 3V43A 2KKYA 2I50A 4O64A 4BBQA 3U5MA 4QF3A 2XP0A 1WEVA 4MSXA 4PTBA 5FEYA 2UZGA 2VPBA 2KU3A 5TDRA 2IDAA 4WZ0A 3M63A 2MD8C 2MNZA 3RPGC 4ZUXU 2CT2A 2ECNA 3H7HA 3FAOA 1WENA 1WGMA 5FERA 3PLWA 2EGPA 1WEUA 3SOUA 2KWOA 4LADB 3HTKC 2CRRA 4UI9B 2MT5A 1G25A 2L0BA 2YT5A 3PUQA 2YHNA 5B76A 1WEEA 3U5NA 3LQJA 2JMIA 3O36A 3LQIA 2PNXA 3ZPVE 3NG2A 2OWAA 3O34A 4LJNA 4WA6A 5D1KB 1XWHA 2M13A 4GNEA 3MHHA 2LXPC 2K16A 2VPDA 3LVRE 1MBMA 2MD7B 2KREA 1MM3A 2KYUA 2ECJA 5JG6A 2XOCA 5KH9A 2L43A 1X4UA 1JOCA 3LJUX 1FBVA 4IC3A 4YAXA 2RI7A 2DJAA 2KWKA 3O47A 4XI1A 3PHDA 2C2VS 1V87A 5SVXA 2KWJA 2CRWA 2FUUA 2KIZA 3MHSA 2RSDA 2B0OE 4WZ3B 1HYIA 2VJEA 5SVIA 4FJCA 2VPEA 4A0CD 1Z6UA 2ECWA 5KH7A 4FIPA 2LDRA 2ECGA 2H0DA 2RR4A 3GV4A 5G0FA 4FK5A 2JRJA 2XEUA 3KV5A 2MKEA 4YBMA 4AYCA 2M6MA 2E6RA 1E4UA 2ECTA 5TDWA 2HYED 3FEHA 4GNDA 3I2DA 3U5OA 4YBSA 2JUNA 4YC9A 2YW8A 1N87A 2QICA 2G45A 4A49A 1K2FA 3HCUA 3ZYQA 1X4JA 5FB0A 3EB6A 4NN2A 2LGKA 3L1ZB 5H1VA 4UP0A 2CONA 3T7LA 3KNVA 4LLBA 1LDKC 5B78A 2XOZA 3N9LA 2YUCA
chains in the Genus database with same CATH topology
2FSAA 4F52B 4Q6FA 3HCTA 4GNGA 3N9MA 1WILA 5H1UA 3KV6A 4UP5A 2CSZA 1Z2QA 5LCWB 3KQIA 2L80A 4YADA 1WIMA 5LKZA 2LV9A 4FO9A 1LDJB 4I7DA 2MNYA 3N9QA 2VJEB 1ZBDB 3ZVYA 1VYXA 3O33A 2H0DB 5C13A 3C6WA 3PURA 5I3LA 2BAYA 4GNFA 4AYCB 4C9ZA 5TBNA 2YQLA 1WEQA 1WESA 3GL6A 1VFYA 2E6SA 1WE9A 4A4CA 3U5PA 2LGVA 2CKLB 2KGIA 2ECIA 1WEPA 2JMDA 2KGGA 2K17A 2OXQC 2G43A 4YBTA 1DVPA 5J3XA 3T6RA 4R8PK 4I7BA 4A4BA 2LGLA 4AVXA 3N9NA 2L5UA 2YSJA 3SOWA 1JM7A 2MA6A 3ZPV1 1CHCA 4N3WA 2MUMA 4X3GA 2ZETC 4CCGX 5D1LB 2YREA 5DINA 2F42A 2FUIA 2JMJA 2YU4A 3C5KA 1IYMA 2PUYA 5H1TA 5H9MA 1F62A 4LK9A 1VD4A 3SOXA 1WEMA 4S3OC 2ECVA 4B86C 1X4IA 1HYJA 2EODA 3QZVA 2NAAA 2CKLA 4R7EA 5LKTA 2YQMA 5G04B 2KWNA 4BHWA 4B7YC 1RMDA 2AN6A 2LRIC 5TABA 2LQ6A 3N9PA 4QF2A 2K1JA 3SHBA 4LKAA 2F6NA 4AP4A 5DKAA 2KE1A 2D8SA 3N9OA 3M62A 2YSMA 4P5OB 5LKUA 1WFKA 4V3LC 5EYAF 1BORA 4ZDTA 4W4UA 3LRQA 4R2YA 2QIZA 5B75A 2QJ0A 1WEWA 3IHPA 4MVTA 3LQHA 4TKPB 3DQVR 5TRBA 3FL2A 1JM7B 2HDPA 4GB0A 2LN0A 2C2LA 2YHOA 3DPLR 2L75A 3O7AA 3EB5A 2Y1NA 2K4DA 4L7XA 5AITA 3ZNIA 2G6QA 2M3HA 2XB1A 2YURA 4WZ2A 2Y43A 1FP0A 3O35A 3O37A 5G05B 3HCSA 5KH3A 4S3OB 5B79A 4IC2A 4V3KC 2MIQA 4CA1A 3L11A 3L1XA 1WEOA 2DX8A 3ZVZB 3RTRB 2VJFB 3ZTGA 4I7CA 5D1MB 5B8DA 2M85A 2EA6A 1U6GB 4N4FA 5AIUA 4YATA 5B77A 4AUQB 5C11A 2VNFA 2KFTA 5LKXA 3M99A 3RPGB 1Z60A 2LXHC 2VP7A 1MM2A 4YABA 3VK6A 2F6JA 2KR4A 1T1HA 3O70A 5FB1A 2LGGA 2YYRA 4L58A 4ZQLA 4PPEA 2CSYA 3ASLA 2Y1MA 2M1RA 2VPGA 2MA5A 2VJFA 3V43A 2I50A 4O64A 4BBQA 3U5MA 4QF3A 1WEVA 4MSXA 4PTBA 5FEYA 2UZGA 2VPBA 2KU3A 5TDRA 2IDAA 4WZ0A 3M63A 2MD8C 2MNZA 3RPGC 4ZUXU 2CT2A 2ECNA 1WENA 1WGMA 5FERA 2EGPA 1WEUA 3SOUA 2KWOA 4LADB 3HTKC 4UI9B 2MT5A 1G25A 2L0BA 2YT5A 3PUQA 2YHNA 5B76A 1WEEA 3U5NA 3LQJA 2JMIA 3O36A 3LQIA 2PNXA 3ZPVE 3NG2A 3O34A 4LJNA 4WA6A 5D1KB 1XWHA 4GNEA 3MHHA 2LXPC 2K16A 2VPDA 2MD7B 2KREA 1MM3A 2KYUA 2ECJA 5JG6A 5KH9A 2L43A 1X4UA 1JOCA 1FBVA 4IC3A 4YAXA 2RI7A 2KWKA 4XI1A 3PHDA 2C2VS 1V87A 2KWJA 2FUUA 2KIZA 3MHSA 2RSDA 4WZ3B 1HYIA 2VJEA 4FJCA 2VPEA 4A0CD 1Z6UA 2ECWA 5KH7A 4FIPA 2LDRA 2ECGA 2H0DA 3GV4A 5G0FA 4FK5A 2JRJA 2XEUA 3KV5A 4YBMA 4AYCA 2M6MA 2E6RA 1E4UA 2ECTA 5TDWA 2HYED 4GNDA 3I2DA 3U5OA 4YBSA 4YC9A 2YW8A 1N87A 2QICA 2G45A 4A49A 1K2FA 3HCUA 3ZYQA 1X4JA 5FB0A 3EB6A 4NN2A 2LGKA 3L1ZB 5H1VA 4UP0A 3T7LA 3KNVA 4LLBA 1LDKC 5B78A 3N9LA 2YUCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FSA A;  4F52 B;  4Q6F A;  3HCT A;  4GNG A;  3N9M A;  1WIL A;  5H1U A;  3KV6 A;  4UP5 A;  2CSZ A;  1Z2Q A;  5LCW B;  3KQI A;  2L80 A;  4YAD A;  1WIM A;  5LKZ A;  2LV9 A;  4FO9 A;  1LDJ B;  4I7D A;  2MNY A;  3N9Q A;  2VJE B;  1ZBD B;  3ZVY A;  1VYX A;  3O33 A;  2H0D B;  5C13 A;  3C6W A;  3PUR A;  5I3L A;  2BAY A;  4GNF A;  4AYC B;  4C9Z A;  5TBN A;  2YQL A;  1WEQ A;  1WES A;  3GL6 A;  1VFY A;  2E6S A;  1WE9 A;  4A4C A;  3U5P A;  2LGV A;  2CKL B;  2KGI A;  2ECI A;  1WEP A;  2JMD A;  2KGG A;  2K17 A;  2OXQ C;  2G43 A;  4YBT A;  1DVP A;  5J3X A;  3T6R A;  4R8P K;  4I7B A;  4A4B A;  2LGL A;  4AVX A;  3N9N A;  2L5U A;  2YSJ A;  3SOW A;  1JM7 A;  2MA6 A;  3ZPV 1;  1CHC A;  4N3W A;  2MUM A;  4X3G A;  2ZET C;  4CCG X;  5D1L B;  2YRE A;  5DIN A;  2F42 A;  2FUI A;  2JMJ A;  2YU4 A;  3C5K A;  1IYM A;  2PUY A;  5H1T A;  5H9M A;  1F62 A;  4LK9 A;  1VD4 A;  3SOX A;  1WEM A;  4S3O C;  2ECV A;  4B86 C;  1X4I A;  1HYJ A;  2EOD A;  3QZV A;  2NAA A;  2CKL A;  4R7E A;  5LKT A;  2YQM A;  5G04 B;  2KWN A;  4BHW A;  4B7Y C;  1RMD A;  2AN6 A;  2LRI C;  5TAB A;  2LQ6 A;  3N9P A;  4QF2 A;  2K1J A;  3SHB A;  4LKA A;  2F6N A;  4AP4 A;  5DKA A;  2KE1 A;  2D8S A;  3N9O A;  3M62 A;  2YSM A;  4P5O B;  5LKU A;  1WFK A;  4V3L C;  5EYA F;  1BOR A;  4ZDT A;  4W4U A;  3LRQ A;  4R2Y A;  2QIZ A;  5B75 A;  2QJ0 A;  1WEW A;  3IHP A;  4MVT A;  3LQH A;  4TKP B;  3DQV R;  5TRB A;  3FL2 A;  1JM7 B;  2HDP A;  4GB0 A;  2LN0 A;  2C2L A;  2YHO A;  3DPL R;  2L75 A;  3O7A A;  3EB5 A;  2Y1N A;  2K4D A;  4L7X A;  5AIT A;  3ZNI A;  2G6Q A;  2M3H A;  2XB1 A;  2YUR A;  4WZ2 A;  2Y43 A;  1FP0 A;  3O35 A;  3O37 A;  5G05 B;  3HCS A;  5KH3 A;  4S3O B;  5B79 A;  4IC2 A;  4V3K C;  2MIQ A;  4CA1 A;  3L11 A;  3L1X A;  1WEO A;  2DX8 A;  3ZVZ B;  3RTR B;  2VJF B;  3ZTG A;  4I7C A;  5D1M B;  5B8D A;  2M85 A;  2EA6 A;  1U6G B;  4N4F A;  5AIU A;  4YAT A;  5B77 A;  4AUQ B;  5C11 A;  2VNF A;  2KFT A;  5LKX A;  3M99 A;  3RPG B;  1Z60 A;  2LXH C;  2VP7 A;  1MM2 A;  4YAB A;  3VK6 A;  2F6J A;  2KR4 A;  1T1H A;  3O70 A;  5FB1 A;  2LGG A;  2YYR A;  4L58 A;  4ZQL A;  4PPE A;  2CSY A;  3ASL A;  2Y1M A;  2M1R A;  2VPG A;  2MA5 A;  2VJF A;  3V43 A;  2I50 A;  4O64 A;  4BBQ A;  3U5M A;  4QF3 A;  1WEV A;  4MSX A;  4PTB A;  5FEY A;  2UZG A;  2VPB A;  2KU3 A;  5TDR A;  2IDA A;  4WZ0 A;  3M63 A;  2MD8 C;  2MNZ A;  3RPG C;  4ZUX U;  2CT2 A;  2ECN A;  1WEN A;  1WGM A;  5FER A;  2EGP A;  1WEU A;  3SOU A;  2KWO A;  4LAD B;  3HTK C;  4UI9 B;  2MT5 A;  1G25 A;  2L0B A;  2YT5 A;  3PUQ A;  2YHN A;  5B76 A;  1WEE A;  3U5N A;  3LQJ A;  2JMI A;  3O36 A;  3LQI A;  2PNX A;  3ZPV E;  3NG2 A;  3O34 A;  4LJN A;  4WA6 A;  5D1K B;  1XWH A;  4GNE A;  3MHH A;  2LXP C;  2K16 A;  2VPD A;  2MD7 B;  2KRE A;  1MM3 A;  2KYU A;  2ECJ A;  5JG6 A;  5KH9 A;  2L43 A;  1X4U A;  1JOC A;  1FBV A;  4IC3 A;  4YAX A;  2RI7 A;  2KWK A;  4XI1 A;  3PHD A;  2C2V S;  1V87 A;  2KWJ A;  2FUU A;  2KIZ A;  3MHS A;  2RSD A;  4WZ3 B;  1HYI A;  2VJE A;  4FJC A;  2VPE A;  4A0C D;  1Z6U A;  2ECW A;  5KH7 A;  4FIP A;  2LDR A;  2ECG A;  2H0D A;  3GV4 A;  5G0F A;  4FK5 A;  2JRJ A;  2XEU A;  3KV5 A;  4YBM A;  4AYC A;  2M6M A;  2E6R A;  1E4U A;  2ECT A;  5TDW A;  2HYE D;  4GND A;  3I2D A;  3U5O A;  4YBS A;  4YC9 A;  2YW8 A;  1N87 A;  2QIC A;  2G45 A;  4A49 A;  1K2F A;  3HCU A;  3ZYQ A;  1X4J A;  5FB0 A;  3EB6 A;  4NN2 A;  2LGK A;  3L1Z B;  5H1V A;  4UP0 A;  3T7L A;  3KNV A;  4LLB A;  1LDK C;  5B78 A;  3N9L A;  2YUC A; 
#chains in the Genus database with same CATH topology
 2FSA A;  4F52 B;  4Q6F A;  3HCT A;  4GNG A;  3N9M A;  1WIL A;  5H1U A;  3KV6 A;  3LVQ E;  3T9K A;  4UP5 A;  2CSZ A;  1Z2Q A;  5K3Q A;  5LCW B;  3KQI A;  2L80 A;  2KKX A;  4YAD A;  1WIM A;  5LKZ A;  2LV9 A;  4FO9 A;  1LDJ B;  4I7D A;  2MNY A;  3N9Q A;  2VJE B;  2L7P A;  5SVI B;  3KDE C;  4O62 A;  1ZBD B;  3ZVY A;  1VYX A;  3O33 A;  2H0D B;  5C13 A;  3C6W A;  4Z0O A;  3PUR A;  5I3L A;  2E61 A;  2BAY A;  4GNF A;  4AYC B;  2D8U A;  2FD4 A;  4C9Z A;  5TBN A;  2YQL A;  1WEQ A;  1WES A;  3GL6 A;  1VFY A;  1DCQ A;  2YVR A;  2E6S A;  2EXU A;  1WE9 A;  4A4C A;  3U5P A;  2LGV A;  2CKL B;  2KGI A;  2ECI A;  1WEP A;  2JMD A;  2KGG A;  2K17 A;  2OXQ C;  2G43 A;  4YBT A;  1DVP A;  5J3X A;  5SVY A;  3T6R A;  4I7B A;  4A4B A;  4R8P K;  2LGL A;  4AVX A;  3N9N A;  2L5U A;  2YSJ A;  3SOW A;  1JM7 A;  2LAU A;  2MA6 A;  3ZPV 1;  1CHC A;  4N3W A;  2MUM A;  4X3G A;  2ZET C;  4CCG X;  3JUE A;  5D1L B;  3DWD A;  2YRE A;  3E2D A;  5DIN A;  2F42 A;  2FUI A;  2JMJ A;  2YU4 A;  3C5K A;  4OGC A;  1IYM A;  2PUY A;  5H1T A;  5H9M A;  1F62 A;  4LK9 A;  1VD4 A;  3SOX A;  1WEM A;  4S3O C;  2ECV A;  4B86 C;  1X4I A;  1HYJ A;  2EOD A;  3QZV A;  2NAA A;  2CKL A;  4R7E A;  5LKT A;  2CSV A;  2YQM A;  5G04 B;  2KWN A;  4BHW A;  4B7Y C;  1RMD A;  2AN6 A;  2LRI C;  2FFW A;  3Q1D A;  5TAB A;  2LQ6 A;  3N9P A;  3SUB A;  2DSM A;  4QF2 A;  2K1J A;  4OGE A;  3SHB A;  4LKA A;  2F6N A;  4AP4 A;  5DKA A;  2KE1 A;  2D8S A;  3N9O A;  3M62 A;  2YSM A;  4P5O B;  5LKU A;  1WFK A;  4V3L C;  5EYA F;  1BOR A;  4ZDT A;  4W4U A;  3LRQ A;  4R2Y A;  2QIZ A;  5B75 A;  2QJ0 A;  1WEW A;  3IHP A;  4MVT A;  3LQH A;  4TKP B;  3DQV R;  5TRB A;  3FAN A;  3FL2 A;  4F1P A;  1JM7 B;  2HDP A;  4GB0 A;  2LN0 A;  2C2L A;  2YHO A;  3DPL R;  2L75 A;  3O7A A;  3EB5 A;  2Y1N A;  2K4D A;  4L7X A;  5AIT A;  3ZNI A;  2G6Q A;  2M3H A;  2XB1 A;  2YUR A;  4WZ2 A;  2Y43 A;  1FP0 A;  2P57 A;  3O35 A;  3O37 A;  5G05 B;  3HCS A;  4Z0R A;  5KH3 A;  4S3O B;  5B79 A;  4IC2 A;  4V3K C;  2IQJ A;  3LDY A;  3MDB C;  3M7K A;  2EGM A;  4H9D A;  2XOY A;  2MIQ A;  3FJU B;  4CA1 A;  3L11 A;  3L1X A;  1WEO A;  2DX8 A;  3ZVZ B;  3RTR B;  2VJF B;  3ZTG A;  4I7C A;  5D1M B;  5B8D A;  2M85 A;  2EA6 A;  1U6G B;  4N4F A;  5AIU A;  4YAT A;  5B77 A;  4QQ4 A;  4AUQ B;  5C11 A;  2JM3 A;  2VNF A;  2KFT A;  5LKX A;  3M99 A;  3RPG B;  1Z60 A;  2LXH C;  2VP7 A;  1MM2 A;  4YAB A;  3VK6 A;  2F6J A;  2KR4 A;  1T1H A;  3O70 A;  5FB1 A;  2LGG A;  2YYR A;  4L58 A;  4ZQL A;  4PPE A;  2CSY A;  3FM8 C;  3ASL A;  3DDT A;  2Y1M A;  2M1R A;  2VPG A;  2MA5 A;  2VJF A;  3V43 A;  2KKY A;  2I50 A;  4O64 A;  4BBQ A;  3U5M A;  4QF3 A;  2XP0 A;  1WEV A;  4MSX A;  4PTB A;  5FEY A;  2UZG A;  2VPB A;  2KU3 A;  5TDR A;  2IDA A;  4WZ0 A;  3M63 A;  2MD8 C;  2MNZ A;  3RPG C;  4ZUX U;  2CT2 A;  2ECN A;  3H7H A;  3FAO A;  1WEN A;  1WGM A;  5FER A;  3PLW A;  2EGP A;  1WEU A;  3SOU A;  2KWO A;  4LAD B;  3HTK C;  2CRR A;  4UI9 B;  2MT5 A;  1G25 A;  2L0B A;  2YT5 A;  3PUQ A;  2YHN A;  5B76 A;  1WEE A;  3U5N A;  3LQJ A;  2JMI A;  3O36 A;  3LQI A;  2PNX A;  3ZPV E;  3NG2 A;  2OWA A;  3O34 A;  4LJN A;  4WA6 A;  5D1K B;  1XWH A;  2M13 A;  4GNE A;  3MHH A;  2LXP C;  2K16 A;  2VPD A;  3LVR E;  1MBM A;  2MD7 B;  2KRE A;  1MM3 A;  2KYU A;  2ECJ A;  5JG6 A;  2XOC A;  5KH9 A;  2L43 A;  1X4U A;  1JOC A;  3LJU X;  1FBV A;  4IC3 A;  4YAX A;  2RI7 A;  2DJA A;  2KWK A;  3O47 A;  4XI1 A;  3PHD A;  2C2V S;  1V87 A;  5SVX A;  2KWJ A;  2CRW A;  2FUU A;  2KIZ A;  3MHS A;  2RSD A;  2B0O E;  4WZ3 B;  1HYI A;  2VJE A;  5SVI A;  4FJC A;  2VPE A;  4A0C D;  1Z6U A;  2ECW A;  5KH7 A;  4FIP A;  2LDR A;  2ECG A;  2H0D A;  2RR4 A;  3GV4 A;  5G0F A;  4FK5 A;  2JRJ A;  2XEU A;  3KV5 A;  2MKE A;  4YBM A;  4AYC A;  2M6M A;  2E6R A;  1E4U A;  2ECT A;  5TDW A;  2HYE D;  3FEH A;  4GND A;  3I2D A;  3U5O A;  4YBS A;  2JUN A;  4YC9 A;  2YW8 A;  1N87 A;  2QIC A;  2G45 A;  4A49 A;  1K2F A;  3HCU A;  3ZYQ A;  1X4J A;  5FB0 A;  3EB6 A;  4NN2 A;  2LGK A;  3L1Z B;  5H1V A;  4UP0 A;  2CON A;  3T7L A;  3KNV A;  4LLB A;  1LDK C;  5B78 A;  2XOZ A;  3N9L A;  2YUC A; 
#chains in the Genus database with same CATH homology
 2FSA A;  4F52 B;  4Q6F A;  3HCT A;  4GNG A;  3N9M A;  1WIL A;  5H1U A;  3KV6 A;  4UP5 A;  2CSZ A;  1Z2Q A;  5LCW B;  3KQI A;  2L80 A;  4YAD A;  1WIM A;  5LKZ A;  2LV9 A;  4FO9 A;  1LDJ B;  4I7D A;  2MNY A;  3N9Q A;  2VJE B;  1ZBD B;  3ZVY A;  1VYX A;  3O33 A;  2H0D B;  5C13 A;  3C6W A;  3PUR A;  5I3L A;  2BAY A;  4GNF A;  4AYC B;  4C9Z A;  5TBN A;  2YQL A;  1WEQ A;  1WES A;  3GL6 A;  1VFY A;  2E6S A;  1WE9 A;  4A4C A;  3U5P A;  2LGV A;  2CKL B;  2KGI A;  2ECI A;  1WEP A;  2JMD A;  2KGG A;  2K17 A;  2OXQ C;  2G43 A;  4YBT A;  1DVP A;  5J3X A;  3T6R A;  4R8P K;  4I7B A;  4A4B A;  2LGL A;  4AVX A;  3N9N A;  2L5U A;  2YSJ A;  3SOW A;  1JM7 A;  2MA6 A;  3ZPV 1;  1CHC A;  4N3W A;  2MUM A;  4X3G A;  2ZET C;  4CCG X;  5D1L B;  2YRE A;  5DIN A;  2F42 A;  2FUI A;  2JMJ A;  2YU4 A;  3C5K A;  1IYM A;  2PUY A;  5H1T A;  5H9M A;  1F62 A;  4LK9 A;  1VD4 A;  3SOX A;  1WEM A;  4S3O C;  2ECV A;  4B86 C;  1X4I A;  1HYJ A;  2EOD A;  3QZV A;  2NAA A;  2CKL A;  4R7E A;  5LKT A;  2YQM A;  5G04 B;  2KWN A;  4BHW A;  4B7Y C;  1RMD A;  2AN6 A;  2LRI C;  5TAB A;  2LQ6 A;  3N9P A;  4QF2 A;  2K1J A;  3SHB A;  4LKA A;  2F6N A;  4AP4 A;  5DKA A;  2KE1 A;  2D8S A;  3N9O A;  3M62 A;  2YSM A;  4P5O B;  5LKU A;  1WFK A;  4V3L C;  5EYA F;  1BOR A;  4ZDT A;  4W4U A;  3LRQ A;  4R2Y A;  2QIZ A;  5B75 A;  2QJ0 A;  1WEW A;  3IHP A;  4MVT A;  3LQH A;  4TKP B;  3DQV R;  5TRB A;  3FL2 A;  1JM7 B;  2HDP A;  4GB0 A;  2LN0 A;  2C2L A;  2YHO A;  3DPL R;  2L75 A;  3O7A A;  3EB5 A;  2Y1N A;  2K4D A;  4L7X A;  5AIT A;  3ZNI A;  2G6Q A;  2M3H A;  2XB1 A;  2YUR A;  4WZ2 A;  2Y43 A;  1FP0 A;  3O35 A;  3O37 A;  5G05 B;  3HCS A;  5KH3 A;  4S3O B;  5B79 A;  4IC2 A;  4V3K C;  2MIQ A;  4CA1 A;  3L11 A;  3L1X A;  1WEO A;  2DX8 A;  3ZVZ B;  3RTR B;  2VJF B;  3ZTG A;  4I7C A;  5D1M B;  5B8D A;  2M85 A;  2EA6 A;  1U6G B;  4N4F A;  5AIU A;  4YAT A;  5B77 A;  4AUQ B;  5C11 A;  2VNF A;  2KFT A;  5LKX A;  3M99 A;  3RPG B;  1Z60 A;  2LXH C;  2VP7 A;  1MM2 A;  4YAB A;  3VK6 A;  2F6J A;  2KR4 A;  1T1H A;  3O70 A;  5FB1 A;  2LGG A;  2YYR A;  4L58 A;  4ZQL A;  4PPE A;  2CSY A;  3ASL A;  2Y1M A;  2M1R A;  2VPG A;  2MA5 A;  2VJF A;  3V43 A;  2I50 A;  4O64 A;  4BBQ A;  3U5M A;  4QF3 A;  1WEV A;  4MSX A;  4PTB A;  5FEY A;  2UZG A;  2VPB A;  2KU3 A;  5TDR A;  2IDA A;  4WZ0 A;  3M63 A;  2MD8 C;  2MNZ A;  3RPG C;  4ZUX U;  2CT2 A;  2ECN A;  1WEN A;  1WGM A;  5FER A;  2EGP A;  1WEU A;  3SOU A;  2KWO A;  4LAD B;  3HTK C;  4UI9 B;  2MT5 A;  1G25 A;  2L0B A;  2YT5 A;  3PUQ A;  2YHN A;  5B76 A;  1WEE A;  3U5N A;  3LQJ A;  2JMI A;  3O36 A;  3LQI A;  2PNX A;  3ZPV E;  3NG2 A;  3O34 A;  4LJN A;  4WA6 A;  5D1K B;  1XWH A;  4GNE A;  3MHH A;  2LXP C;  2K16 A;  2VPD A;  2MD7 B;  2KRE A;  1MM3 A;  2KYU A;  2ECJ A;  5JG6 A;  5KH9 A;  2L43 A;  1X4U A;  1JOC A;  1FBV A;  4IC3 A;  4YAX A;  2RI7 A;  2KWK A;  4XI1 A;  3PHD A;  2C2V S;  1V87 A;  2KWJ A;  2FUU A;  2KIZ A;  3MHS A;  2RSD A;  4WZ3 B;  1HYI A;  2VJE A;  4FJC A;  2VPE A;  4A0C D;  1Z6U A;  2ECW A;  5KH7 A;  4FIP A;  2LDR A;  2ECG A;  2H0D A;  3GV4 A;  5G0F A;  4FK5 A;  2JRJ A;  2XEU A;  3KV5 A;  4YBM A;  4AYC A;  2M6M A;  2E6R A;  1E4U A;  2ECT A;  5TDW A;  2HYE D;  4GND A;  3I2D A;  3U5O A;  4YBS A;  4YC9 A;  2YW8 A;  1N87 A;  2QIC A;  2G45 A;  4A49 A;  1K2F A;  3HCU A;  3ZYQ A;  1X4J A;  5FB0 A;  3EB6 A;  4NN2 A;  2LGK A;  3L1Z B;  5H1V A;  4UP0 A;  3T7L A;  3KNV A;  4LLB A;  1LDK C;  5B78 A;  3N9L A;  2YUC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...