5TRBA

Crystal structure of the rnf20 ring domain
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
69
structure length
69
Chain Sequence
EILMEEIKDYKARLTCPCCNMRKKDAVLTKCFHVFCFECVKTRYDTRQRKCPKCNAAFGANDFHRIYIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase BRE1A
publication title Structure and Function of the RING Domains of RNF20 and RNF40, Dimeric E3 Ligases that Monoubiquitylate Histone H2B.
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 69
sequence length 69
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2016-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5trbA00
1MM2A 4FO9A 3N9OA 2MA6A 4QF2A 3M63A 3C6WA 4GNEA 5TABA 4AYCB 3LQIA 2KIZA 3N9LA 2MNZA 2KYUA 2VJEB 4ZUXU 4I7DA 4WZ3B 2JMIA 2RI7A 1WEWA 2MIQA 1MM3A 4IC3A 3ASLA 2KGGA 5LKUA 4WZ2A 1FP0A 2ECGA 3LRQA 4N4FA 2EGPA 3MHSA 5DKAA 3SOWA 1X4UA 2F6NA 1E4UA 2CSYA 2C2VS 2KREA 5EYAF 1LDKC 5KH9A 2VJFB 3O36A 5B8DA 2ECIA 3C5KA 4XI1A 3L11A 4YAXA 1Z2QA 3DQVR 4YBTA 5D1KB 5LCWB 4GNFA 4LADB 1XWHA 2JRJA 3DPLR 2KFTA 2MNYA 3KV6A 4BHWA 3N9NA 3HTKC 3V43A 2M3HA 2KWKA 5J3XA 2MA5A 4PPEA 2YSMA 1JM7A 2KU3A 4YADA 1VFYA 4Q6FA 3LQHA 1T1HA 2ECTA 5G0FA 3IHPA 2UZGA 2YU4A 4LK9A 4V3LC 2BAYA 1Z60A 2ECVA 3KNVA 2Y43A 4YBSA 2H0DA 2FSAA 1CHCA 5TDWA 5LKZA 2YHOA 4ZDTA 1G25A 5FB1A 3GL6A 4A49A 2IDAA 2CKLA 3U5OA 1F62A 2M6MA 2K16A 3O35A 2LN0A 5G05B 5C13A 4L58A 2MUMA 3O33A 1RMDA 3SHBA 2Y1NA 3HCSA 2K17A 1WEEA 3I2DA 1Z6UA 3MHHA 5C11A 4GNGA 5H9MA 5KH7A 2YUCA 1JM7B 2KWJA 3L1XA 3M62A 2K1JA 1LDJB 3PURA 2LGKA 4YBMA 2QIZA 1IYMA 4YATA 1WEMA 2RSDA 4WZ0A 1K2FA 3N9QA 3ZVYA 4AVXA 2L80A 4ZQLA 2L75A 2FUIA 1DVPA 2LRIC 2G6QA 3VK6A 2H0DB 1WEVA 3QZVA 4TKPB 2E6SA 2LQ6A 3RPGC 5B76A 5TBNA 3ZYQA 5H1UA 4UP0A 3N9PA 2YT5A 1WILA 2M1RA 4P5OB 4GNDA 3KQIA 5B79A 4MVTA 5AITA 1WEUA 2KGIA 3EB5A 2HYED 2LGLA 2NAAA 4CCGX 3HCUA 2MD8C 3ZNIA 4V3KC 4FJCA 1WGMA 1N87A 4X3GA 2G43A 2EA6A 5FB0A 1VYXA 2VPEA 4L7XA 3M99A 4N3WA 2VNFA 1VD4A 5TDRA 4CA1A 2YYRA 2VPDA 3O34A 5LKXA 2JMJA 4YABA 1WEOA 2ECJA 2CSZA 4F52B 4MSXA 1V87A 1BORA 4A4BA 2YREA 2CT2A 2L0BA 2KWOA 4C9ZA 3ZVZB 2LV9A 2JMDA 5H1VA 1WENA 3ZPV1 3RPGB 3EB6A 5B77A 2YQMA 2YW8A 5D1MB 3KV5A 2LGGA 2HDPA 1HYIA 5D1LB 1X4JA 2L5UA 2OXQC 4PTBA 5G04B 2K4DA 2FUUA 3GV4A 2XB1A 4I7CA 3O37A 2YHNA 3L1ZB 2L43A 3T7LA 2XEUA 1WE9A 2VP7A 5JG6A 2LDRA 2I50A 3T6RA 2LXHC 2MD7B 4UI9B 5FERA 2KR4A 1WESA 2F42A 4B86C 3LQJA 1WEQA 5KH3A 4I7BA 4BBQA 3ZTGA 1ZBDB 4O64A 5DINA 2DX8A 3HCTA 3U5NA 2C2LA 2E6RA 5B78A 3O70A 3O7AA 4QF3A 3PUQA 3N9MA 2KE1A 3FL2A 4R8PK 4YC9A 2M85A 4UP5A 2YURA 4LJNA 2LXPC 1HYJA 5FEYA 4A4CA 1JOCA 2EODA 4S3OB 4R2YA 1X4IA 1WFKA 2CKLB 2G45A 2Y1MA 3SOXA 1WEPA 2YSJA 2AN6A 3U5PA 2D8SA 4W4UA 3SOUA 4GB0A 1U6GB 5TRBA 2ZETC 4IC2A 2ECWA 2VPGA 4AYCA 4B7YC 2VJEA 4R7EA 5B75A 4AUQB 4LLBA 5LKTA 2MT5A 1WIMA 2VPBA 2KWNA 2QJ0A 3U5MA 4FIPA 2LGVA 2PUYA 2QICA 5AIUA 4A0CD 3NG2A 1FBVA 4S3OC 3PHDA 4WA6A 2F6JA 2PNXA 2VJFA 2ECNA 2YQLA 4NN2A 4LKAA 4AP4A 4FK5A 3ZPVE 5H1TA 5I3LA 3RTRB
chains in the Genus database with same CATH superfamily
1MM2A 3DWDA 2JUNA 4FO9A 3N9OA 2MA6A 4QF2A 3M63A 3C6WA 4GNEA 5TABA 4AYCB 3LQIA 2KIZA 3N9LA 2MNZA 2KYUA 2VJEB 4ZUXU 4I7DA 2XOZA 4WZ3B 3SUBA 2CSVA 2CRRA 2JMIA 2RI7A 1WEWA 2MIQA 1MM3A 4IC3A 3ASLA 2KGGA 5LKUA 4WZ2A 1FP0A 2ECGA 3LRQA 4N4FA 2EGPA 3MHSA 2L7PA 5DKAA 2OWAA 3SOWA 1X4UA 2F6NA 3MDBC 1E4UA 2CSYA 2C2VS 2KREA 5EYAF 1LDKC 5KH9A 2VJFB 3O36A 5B8DA 2ECIA 3C5KA 4XI1A 3L11A 4YAXA 1Z2QA 3DQVR 3O47A 4YBTA 5D1KB 5LCWB 4GNFA 4LADB 1XWHA 2JRJA 3DPLR 2KFTA 2MNYA 3KV6A 4BHWA 3N9NA 3HTKC 3V43A 3RTRB 2M3HA 2XOYA 2KWKA 5J3XA 2XP0A 2MA5A 4PPEA 2YSMA 1JM7A 2KU3A 2CRWA 4YADA 1VFYA 4Q6FA 3LQHA 1T1HA 2ECTA 5G0FA 2DJAA 3IHPA 2UZGA 2YU4A 4LK9A 4V3LC 2BAYA 1Z60A 2ECVA 3KNVA 2Y43A 4YBSA 2H0DA 2FSAA 1CHCA 5TDWA 5SVIA 5LKZA 2YHOA 4ZDTA 1G25A 5FB1A 3GL6A 4A49A 2IDAA 2CKLA 3U5OA 2D8UA 1F62A 3KDEC 2M6MA 2K16A 3O35A 2LAUA 2LN0A 5G05B 5C13A 4L58A 2MUMA 4O62A 3O33A 1RMDA 3SHBA 3LVRE 2E61A 3FANA 2Y1NA 3HCSA 2K17A 1WEEA 3I2DA 1Z6UA 3MHHA 5C11A 4GNGA 5H9MA 5SVXA 5KH7A 2YUCA 1JM7B 2EGMA 2KWJA 3L1XA 3M62A 2K1JA 1LDJB 3PURA 2LGKA 4YBMA 3Q1DA 2QIZA 2KKXA 1IYMA 4YATA 4OGCA 1DCQA 1WEMA 2RSDA 4WZ0A 2CONA 1K2FA 3N9QA 3ZVYA 4AVXA 2L80A 4ZQLA 2L75A 2FUIA 1DVPA 2LRIC 2G6QA 3VK6A 2H0DB 1WEVA 3QZVA 4TKPB 2E6SA 2LQ6A 3RPGC 5B76A 3DDTA 1MBMA 5TBNA 3ZYQA 5H1UA 2YVRA 2DSMA 3N9PA 4UP0A 2YT5A 1WILA 2M1RA 4P5OB 4GNDA 3JUEA 3KQIA 5B79A 4MVTA 5AITA 1WEUA 2KGIA 3EB5A 2HYED 2LGLA 2NAAA 4CCGX 3HCUA 2MD8C 2RR4A 3ZNIA 4V3KC 4FJCA 1WGMA 1N87A 4X3GA 2G43A 2EA6A 5FB0A 1VYXA 2VPEA 4L7XA 3M99A 4N3WA 2VNFA 1VD4A 5TDRA 4CA1A 2YYRA 2VPDA 3O34A 5LKXA 2JMJA 4YABA 1WEOA 2ECJA 2CSZA 4F52B 4MSXA 1V87A 1BORA 4A4BA 2JM3A 2YREA 2CT2A 2L0BA 2KWOA 4C9ZA 3ZVZB 2LV9A 2JMDA 5H1VA 1WENA 3ZPV1 2FFWA 3RPGB 3EB6A 5B77A 2YQMA 3LJUX 2YW8A 5D1MB 3KV5A 2LGGA 2HDPA 1HYIA 5D1LB 1X4JA 2L5UA 2OXQC 4PTBA 3FJUB 2M13A 5G04B 3LVQE 2XOCA 2K4DA 2FUUA 2B0OE 3GV4A 3PLWA 2XB1A 3H7HA 5K3QA 4I7CA 3O37A 2YHNA 3L1ZB 2L43A 4F1PA 3T7LA 2XEUA 1WE9A 4Z0RA 2VP7A 5JG6A 2LDRA 2I50A 3T6RA 4QQ4A 2LXHC 2MD7B 4UI9B 5FERA 2KR4A 1WESA 2F42A 4B86C 3LQJA 1WEQA 5KH3A 4I7BA 4BBQA 3ZTGA 1ZBDB 2IQJA 4O64A 5DINA 2DX8A 3HCTA 4OGEA 3U5NA 2C2LA 2E6RA 5B78A 3O70A 3O7AA 4QF3A 3PUQA 3N9MA 2P57A 4H9DA 5SVYA 2KE1A 3FEHA 3FL2A 4R8PK 4YC9A 5SVIB 2M85A 4UP5A 3FM8C 2YURA 4LJNA 2LXPC 1HYJA 3T9KA 5FEYA 4A4CA 1JOCA 2EODA 4S3OB 4R2YA 2EXUA 1X4IA 1WFKA 2CKLB 2G45A 2Y1MA 3E2DA 3SOXA 1WEPA 2YSJA 2AN6A 3U5PA 2D8SA 4W4UA 3SOUA 4GB0A 1U6GB 5TRBA 2ZETC 4IC2A 3M7KA 2ECWA 2VPGA 4AYCA 4B7YC 2VJEA 4R7EA 5B75A 2KKYA 4AUQB 4LLBA 5LKTA 2MT5A 1WIMA 2VPBA 2KWNA 2QJ0A 3FAOA 3U5MA 4FIPA 2LGVA 2PUYA 2QICA 4A0CD 3NG2A 1FBVA 4S3OC 3PHDA 4WA6A 4Z0OA 2F6JA 2FD4A 2PNXA 3LDYA 2VJFA 2MKEA 2ECNA 2YQLA 4NN2A 4LKAA 4AP4A 4FK5A 3ZPVE 5H1TA 5I3LA 5AIUA
chains in the Genus database with same CATH topology
1MM2A 4FO9A 3N9OA 2MA6A 4QF2A 3M63A 3C6WA 4GNEA 5TABA 4AYCB 3LQIA 2KIZA 3N9LA 2MNZA 2KYUA 2VJEB 4ZUXU 4I7DA 4WZ3B 2JMIA 2RI7A 1WEWA 2MIQA 1MM3A 4IC3A 3ASLA 2KGGA 5LKUA 4WZ2A 1FP0A 2ECGA 3LRQA 4N4FA 2EGPA 3MHSA 5DKAA 3SOWA 1X4UA 2F6NA 1E4UA 2CSYA 2C2VS 2KREA 5EYAF 1LDKC 5KH9A 2VJFB 3O36A 5B8DA 2ECIA 3C5KA 4XI1A 3L11A 4YAXA 1Z2QA 3DQVR 4YBTA 5D1KB 5LCWB 4GNFA 4LADB 1XWHA 2JRJA 3DPLR 2KFTA 2MNYA 3KV6A 4BHWA 3N9NA 3HTKC 3V43A 2M3HA 2KWKA 5J3XA 2MA5A 4PPEA 2YSMA 1JM7A 2KU3A 4YADA 1VFYA 4Q6FA 3LQHA 1T1HA 2ECTA 5G0FA 3IHPA 2UZGA 2YU4A 4LK9A 4V3LC 2BAYA 1Z60A 2ECVA 3KNVA 2Y43A 4YBSA 2H0DA 2FSAA 1CHCA 5TDWA 5LKZA 2YHOA 4ZDTA 1G25A 5FB1A 3GL6A 4A49A 2IDAA 2CKLA 3U5OA 1F62A 2M6MA 2K16A 3O35A 2LN0A 5G05B 5C13A 4L58A 2MUMA 3O33A 1RMDA 3SHBA 2Y1NA 3HCSA 2K17A 1WEEA 3I2DA 1Z6UA 3MHHA 5C11A 4GNGA 5H9MA 5KH7A 2YUCA 1JM7B 2KWJA 3L1XA 3M62A 2K1JA 1LDJB 3PURA 2LGKA 4YBMA 2QIZA 1IYMA 4YATA 1WEMA 2RSDA 4WZ0A 1K2FA 3N9QA 3ZVYA 4AVXA 2L80A 4ZQLA 2L75A 2FUIA 1DVPA 2LRIC 2G6QA 3VK6A 2H0DB 1WEVA 3QZVA 4TKPB 2E6SA 2LQ6A 3RPGC 5B76A 5TBNA 3ZYQA 5H1UA 4UP0A 3N9PA 2YT5A 1WILA 2M1RA 4P5OB 4GNDA 3KQIA 5B79A 4MVTA 5AITA 1WEUA 2KGIA 3EB5A 2HYED 2LGLA 2NAAA 4CCGX 3HCUA 2MD8C 3ZNIA 4V3KC 4FJCA 1WGMA 1N87A 4X3GA 2G43A 2EA6A 5FB0A 1VYXA 2VPEA 4L7XA 3M99A 4N3WA 2VNFA 1VD4A 5TDRA 4CA1A 2YYRA 2VPDA 3O34A 5LKXA 2JMJA 4YABA 1WEOA 2ECJA 2CSZA 4F52B 4MSXA 1V87A 1BORA 4A4BA 2YREA 2CT2A 2L0BA 2KWOA 4C9ZA 3ZVZB 2LV9A 2JMDA 5H1VA 1WENA 3ZPV1 3RPGB 3EB6A 5B77A 2YQMA 2YW8A 5D1MB 3KV5A 2LGGA 2HDPA 1HYIA 5D1LB 1X4JA 2L5UA 2OXQC 4PTBA 5G04B 2K4DA 2FUUA 3GV4A 2XB1A 4I7CA 3O37A 2YHNA 3L1ZB 2L43A 3T7LA 2XEUA 1WE9A 2VP7A 5JG6A 2LDRA 2I50A 3T6RA 2LXHC 2MD7B 4UI9B 5FERA 2KR4A 1WESA 2F42A 4B86C 3LQJA 1WEQA 5KH3A 4I7BA 4BBQA 3ZTGA 1ZBDB 4O64A 5DINA 2DX8A 3HCTA 3U5NA 2C2LA 2E6RA 5B78A 3O70A 3O7AA 4QF3A 3PUQA 3N9MA 2KE1A 3FL2A 4R8PK 4YC9A 2M85A 4UP5A 2YURA 4LJNA 2LXPC 1HYJA 5FEYA 4A4CA 1JOCA 2EODA 4S3OB 4R2YA 1X4IA 1WFKA 2CKLB 2G45A 2Y1MA 3SOXA 1WEPA 2YSJA 2AN6A 3U5PA 2D8SA 4W4UA 3SOUA 4GB0A 1U6GB 5TRBA 2ZETC 4IC2A 2ECWA 2VPGA 4AYCA 4B7YC 2VJEA 4R7EA 5B75A 4AUQB 4LLBA 5LKTA 2MT5A 1WIMA 2VPBA 2KWNA 2QJ0A 3U5MA 4FIPA 2LGVA 2PUYA 2QICA 5AIUA 4A0CD 3NG2A 1FBVA 4S3OC 3PHDA 4WA6A 2F6JA 2PNXA 2VJFA 2ECNA 2YQLA 4NN2A 4LKAA 4AP4A 4FK5A 3ZPVE 5H1TA 5I3LA 3RTRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MM2 A;  4FO9 A;  3N9O A;  2MA6 A;  4QF2 A;  3M63 A;  3C6W A;  4GNE A;  5TAB A;  4AYC B;  3LQI A;  2KIZ A;  3N9L A;  2MNZ A;  2KYU A;  2VJE B;  4ZUX U;  4I7D A;  4WZ3 B;  2JMI A;  2RI7 A;  1WEW A;  2MIQ A;  1MM3 A;  4IC3 A;  3ASL A;  2KGG A;  5LKU A;  4WZ2 A;  1FP0 A;  2ECG A;  3LRQ A;  4N4F A;  2EGP A;  3MHS A;  5DKA A;  3SOW A;  1X4U A;  2F6N A;  1E4U A;  2CSY A;  2C2V S;  2KRE A;  5EYA F;  1LDK C;  5KH9 A;  2VJF B;  3O36 A;  5B8D A;  2ECI A;  3C5K A;  4XI1 A;  3L11 A;  4YAX A;  1Z2Q A;  3DQV R;  4YBT A;  5D1K B;  5LCW B;  4GNF A;  4LAD B;  1XWH A;  2JRJ A;  3DPL R;  2KFT A;  2MNY A;  3KV6 A;  4BHW A;  3N9N A;  3HTK C;  3V43 A;  2M3H A;  2KWK A;  5J3X A;  2MA5 A;  4PPE A;  2YSM A;  1JM7 A;  2KU3 A;  4YAD A;  1VFY A;  4Q6F A;  3LQH A;  1T1H A;  2ECT A;  5G0F A;  3IHP A;  2UZG A;  2YU4 A;  4LK9 A;  4V3L C;  2BAY A;  1Z60 A;  2ECV A;  3KNV A;  2Y43 A;  4YBS A;  2H0D A;  2FSA A;  1CHC A;  5TDW A;  5LKZ A;  2YHO A;  4ZDT A;  1G25 A;  5FB1 A;  3GL6 A;  4A49 A;  2IDA A;  2CKL A;  3U5O A;  1F62 A;  2M6M A;  2K16 A;  3O35 A;  2LN0 A;  5G05 B;  5C13 A;  4L58 A;  2MUM A;  3O33 A;  1RMD A;  3SHB A;  2Y1N A;  3HCS A;  2K17 A;  1WEE A;  3I2D A;  1Z6U A;  3MHH A;  5C11 A;  4GNG A;  5H9M A;  5KH7 A;  2YUC A;  1JM7 B;  2KWJ A;  3L1X A;  3M62 A;  2K1J A;  1LDJ B;  3PUR A;  2LGK A;  4YBM A;  2QIZ A;  1IYM A;  4YAT A;  1WEM A;  2RSD A;  4WZ0 A;  1K2F A;  3N9Q A;  3ZVY A;  4AVX A;  2L80 A;  4ZQL A;  2L75 A;  2FUI A;  1DVP A;  2LRI C;  2G6Q A;  3VK6 A;  2H0D B;  1WEV A;  3QZV A;  4TKP B;  2E6S A;  2LQ6 A;  3RPG C;  5B76 A;  5TBN A;  3ZYQ A;  5H1U A;  4UP0 A;  3N9P A;  2YT5 A;  1WIL A;  2M1R A;  4P5O B;  4GND A;  3KQI A;  5B79 A;  4MVT A;  5AIT A;  1WEU A;  2KGI A;  3EB5 A;  2HYE D;  2LGL A;  2NAA A;  4CCG X;  3HCU A;  2MD8 C;  3ZNI A;  4V3K C;  4FJC A;  1WGM A;  1N87 A;  4X3G A;  2G43 A;  2EA6 A;  5FB0 A;  1VYX A;  2VPE A;  4L7X A;  3M99 A;  4N3W A;  2VNF A;  1VD4 A;  5TDR A;  4CA1 A;  2YYR A;  2VPD A;  3O34 A;  5LKX A;  2JMJ A;  4YAB A;  1WEO A;  2ECJ A;  2CSZ A;  4F52 B;  4MSX A;  1V87 A;  1BOR A;  4A4B A;  2YRE A;  2CT2 A;  2L0B A;  2KWO A;  4C9Z A;  3ZVZ B;  2LV9 A;  2JMD A;  5H1V A;  1WEN A;  3ZPV 1;  3RPG B;  3EB6 A;  5B77 A;  2YQM A;  2YW8 A;  5D1M B;  3KV5 A;  2LGG A;  2HDP A;  1HYI A;  5D1L B;  1X4J A;  2L5U A;  2OXQ C;  4PTB A;  5G04 B;  2K4D A;  2FUU A;  3GV4 A;  2XB1 A;  4I7C A;  3O37 A;  2YHN A;  3L1Z B;  2L43 A;  3T7L A;  2XEU A;  1WE9 A;  2VP7 A;  5JG6 A;  2LDR A;  2I50 A;  3T6R A;  2LXH C;  2MD7 B;  4UI9 B;  5FER A;  2KR4 A;  1WES A;  2F42 A;  4B86 C;  3LQJ A;  1WEQ A;  5KH3 A;  4I7B A;  4BBQ A;  3ZTG A;  1ZBD B;  4O64 A;  5DIN A;  2DX8 A;  3HCT A;  3U5N A;  2C2L A;  2E6R A;  5B78 A;  3O70 A;  3O7A A;  4QF3 A;  3PUQ A;  3N9M A;  2KE1 A;  3FL2 A;  4R8P K;  4YC9 A;  2M85 A;  4UP5 A;  2YUR A;  4LJN A;  2LXP C;  1HYJ A;  5FEY A;  4A4C A;  1JOC A;  2EOD A;  4S3O B;  4R2Y A;  1X4I A;  1WFK A;  2CKL B;  2G45 A;  2Y1M A;  3SOX A;  1WEP A;  2YSJ A;  2AN6 A;  3U5P A;  2D8S A;  4W4U A;  3SOU A;  4GB0 A;  1U6G B;  5TRB A;  2ZET C;  4IC2 A;  2ECW A;  2VPG A;  4AYC A;  4B7Y C;  2VJE A;  4R7E A;  5B75 A;  4AUQ B;  4LLB A;  5LKT A;  2MT5 A;  1WIM A;  2VPB A;  2KWN A;  2QJ0 A;  3U5M A;  4FIP A;  2LGV A;  2PUY A;  2QIC A;  5AIU A;  4A0C D;  3NG2 A;  1FBV A;  4S3O C;  3PHD A;  4WA6 A;  2F6J A;  2PNX A;  2VJF A;  2ECN A;  2YQL A;  4NN2 A;  4LKA A;  4AP4 A;  4FK5 A;  3ZPV E;  5H1T A;  5I3L A;  3RTR B; 
#chains in the Genus database with same CATH topology
 1MM2 A;  3DWD A;  2JUN A;  4FO9 A;  3N9O A;  2MA6 A;  4QF2 A;  3M63 A;  3C6W A;  4GNE A;  5TAB A;  4AYC B;  3LQI A;  2KIZ A;  3N9L A;  2MNZ A;  2KYU A;  2VJE B;  4ZUX U;  4I7D A;  2XOZ A;  4WZ3 B;  3SUB A;  2CSV A;  2CRR A;  2JMI A;  2RI7 A;  1WEW A;  2MIQ A;  1MM3 A;  4IC3 A;  3ASL A;  2KGG A;  5LKU A;  4WZ2 A;  1FP0 A;  2ECG A;  3LRQ A;  4N4F A;  2EGP A;  3MHS A;  2L7P A;  5DKA A;  2OWA A;  3SOW A;  1X4U A;  2F6N A;  3MDB C;  1E4U A;  2CSY A;  2C2V S;  2KRE A;  5EYA F;  1LDK C;  5KH9 A;  2VJF B;  3O36 A;  5B8D A;  2ECI A;  3C5K A;  4XI1 A;  3L11 A;  4YAX A;  1Z2Q A;  3DQV R;  3O47 A;  4YBT A;  5D1K B;  5LCW B;  4GNF A;  4LAD B;  1XWH A;  2JRJ A;  3DPL R;  2KFT A;  2MNY A;  3KV6 A;  4BHW A;  3N9N A;  3HTK C;  3V43 A;  3RTR B;  2M3H A;  2XOY A;  2KWK A;  5J3X A;  2XP0 A;  2MA5 A;  4PPE A;  2YSM A;  1JM7 A;  2KU3 A;  2CRW A;  4YAD A;  1VFY A;  4Q6F A;  3LQH A;  1T1H A;  2ECT A;  5G0F A;  2DJA A;  3IHP A;  2UZG A;  2YU4 A;  4LK9 A;  4V3L C;  2BAY A;  1Z60 A;  2ECV A;  3KNV A;  2Y43 A;  4YBS A;  2H0D A;  2FSA A;  1CHC A;  5TDW A;  5SVI A;  5LKZ A;  2YHO A;  4ZDT A;  1G25 A;  5FB1 A;  3GL6 A;  4A49 A;  2IDA A;  2CKL A;  3U5O A;  2D8U A;  1F62 A;  3KDE C;  2M6M A;  2K16 A;  3O35 A;  2LAU A;  2LN0 A;  5G05 B;  5C13 A;  4L58 A;  2MUM A;  4O62 A;  3O33 A;  1RMD A;  3SHB A;  3LVR E;  2E61 A;  3FAN A;  2Y1N A;  3HCS A;  2K17 A;  1WEE A;  3I2D A;  1Z6U A;  3MHH A;  5C11 A;  4GNG A;  5H9M A;  5SVX A;  5KH7 A;  2YUC A;  1JM7 B;  2EGM A;  2KWJ A;  3L1X A;  3M62 A;  2K1J A;  1LDJ B;  3PUR A;  2LGK A;  4YBM A;  3Q1D A;  2QIZ A;  2KKX A;  1IYM A;  4YAT A;  4OGC A;  1DCQ A;  1WEM A;  2RSD A;  4WZ0 A;  2CON A;  1K2F A;  3N9Q A;  3ZVY A;  4AVX A;  2L80 A;  4ZQL A;  2L75 A;  2FUI A;  1DVP A;  2LRI C;  2G6Q A;  3VK6 A;  2H0D B;  1WEV A;  3QZV A;  4TKP B;  2E6S A;  2LQ6 A;  3RPG C;  5B76 A;  3DDT A;  1MBM A;  5TBN A;  3ZYQ A;  5H1U A;  2YVR A;  2DSM A;  3N9P A;  4UP0 A;  2YT5 A;  1WIL A;  2M1R A;  4P5O B;  4GND A;  3JUE A;  3KQI A;  5B79 A;  4MVT A;  5AIT A;  1WEU A;  2KGI A;  3EB5 A;  2HYE D;  2LGL A;  2NAA A;  4CCG X;  3HCU A;  2MD8 C;  2RR4 A;  3ZNI A;  4V3K C;  4FJC A;  1WGM A;  1N87 A;  4X3G A;  2G43 A;  2EA6 A;  5FB0 A;  1VYX A;  2VPE A;  4L7X A;  3M99 A;  4N3W A;  2VNF A;  1VD4 A;  5TDR A;  4CA1 A;  2YYR A;  2VPD A;  3O34 A;  5LKX A;  2JMJ A;  4YAB A;  1WEO A;  2ECJ A;  2CSZ A;  4F52 B;  4MSX A;  1V87 A;  1BOR A;  4A4B A;  2JM3 A;  2YRE A;  2CT2 A;  2L0B A;  2KWO A;  4C9Z A;  3ZVZ B;  2LV9 A;  2JMD A;  5H1V A;  1WEN A;  3ZPV 1;  2FFW A;  3RPG B;  3EB6 A;  5B77 A;  2YQM A;  3LJU X;  2YW8 A;  5D1M B;  3KV5 A;  2LGG A;  2HDP A;  1HYI A;  5D1L B;  1X4J A;  2L5U A;  2OXQ C;  4PTB A;  3FJU B;  2M13 A;  5G04 B;  3LVQ E;  2XOC A;  2K4D A;  2FUU A;  2B0O E;  3GV4 A;  3PLW A;  2XB1 A;  3H7H A;  5K3Q A;  4I7C A;  3O37 A;  2YHN A;  3L1Z B;  2L43 A;  4F1P A;  3T7L A;  2XEU A;  1WE9 A;  4Z0R A;  2VP7 A;  5JG6 A;  2LDR A;  2I50 A;  3T6R A;  4QQ4 A;  2LXH C;  2MD7 B;  4UI9 B;  5FER A;  2KR4 A;  1WES A;  2F42 A;  4B86 C;  3LQJ A;  1WEQ A;  5KH3 A;  4I7B A;  4BBQ A;  3ZTG A;  1ZBD B;  2IQJ A;  4O64 A;  5DIN A;  2DX8 A;  3HCT A;  4OGE A;  3U5N A;  2C2L A;  2E6R A;  5B78 A;  3O70 A;  3O7A A;  4QF3 A;  3PUQ A;  3N9M A;  2P57 A;  4H9D A;  5SVY A;  2KE1 A;  3FEH A;  3FL2 A;  4R8P K;  4YC9 A;  5SVI B;  2M85 A;  4UP5 A;  3FM8 C;  2YUR A;  4LJN A;  2LXP C;  1HYJ A;  3T9K A;  5FEY A;  4A4C A;  1JOC A;  2EOD A;  4S3O B;  4R2Y A;  2EXU A;  1X4I A;  1WFK A;  2CKL B;  2G45 A;  2Y1M A;  3E2D A;  3SOX A;  1WEP A;  2YSJ A;  2AN6 A;  3U5P A;  2D8S A;  4W4U A;  3SOU A;  4GB0 A;  1U6G B;  5TRB A;  2ZET C;  4IC2 A;  3M7K A;  2ECW A;  2VPG A;  4AYC A;  4B7Y C;  2VJE A;  4R7E A;  5B75 A;  2KKY A;  4AUQ B;  4LLB A;  5LKT A;  2MT5 A;  1WIM A;  2VPB A;  2KWN A;  2QJ0 A;  3FAO A;  3U5M A;  4FIP A;  2LGV A;  2PUY A;  2QIC A;  4A0C D;  3NG2 A;  1FBV A;  4S3O C;  3PHD A;  4WA6 A;  4Z0O A;  2F6J A;  2FD4 A;  2PNX A;  3LDY A;  2VJF A;  2MKE A;  2ECN A;  2YQL A;  4NN2 A;  4LKA A;  4AP4 A;  4FK5 A;  3ZPV E;  5H1T A;  5I3L A;  5AIU A; 
#chains in the Genus database with same CATH homology
 1MM2 A;  4FO9 A;  3N9O A;  2MA6 A;  4QF2 A;  3M63 A;  3C6W A;  4GNE A;  5TAB A;  4AYC B;  3LQI A;  2KIZ A;  3N9L A;  2MNZ A;  2KYU A;  2VJE B;  4ZUX U;  4I7D A;  4WZ3 B;  2JMI A;  2RI7 A;  1WEW A;  2MIQ A;  1MM3 A;  4IC3 A;  3ASL A;  2KGG A;  5LKU A;  4WZ2 A;  1FP0 A;  2ECG A;  3LRQ A;  4N4F A;  2EGP A;  3MHS A;  5DKA A;  3SOW A;  1X4U A;  2F6N A;  1E4U A;  2CSY A;  2C2V S;  2KRE A;  5EYA F;  1LDK C;  5KH9 A;  2VJF B;  3O36 A;  5B8D A;  2ECI A;  3C5K A;  4XI1 A;  3L11 A;  4YAX A;  1Z2Q A;  3DQV R;  4YBT A;  5D1K B;  5LCW B;  4GNF A;  4LAD B;  1XWH A;  2JRJ A;  3DPL R;  2KFT A;  2MNY A;  3KV6 A;  4BHW A;  3N9N A;  3HTK C;  3V43 A;  2M3H A;  2KWK A;  5J3X A;  2MA5 A;  4PPE A;  2YSM A;  1JM7 A;  2KU3 A;  4YAD A;  1VFY A;  4Q6F A;  3LQH A;  1T1H A;  2ECT A;  5G0F A;  3IHP A;  2UZG A;  2YU4 A;  4LK9 A;  4V3L C;  2BAY A;  1Z60 A;  2ECV A;  3KNV A;  2Y43 A;  4YBS A;  2H0D A;  2FSA A;  1CHC A;  5TDW A;  5LKZ A;  2YHO A;  4ZDT A;  1G25 A;  5FB1 A;  3GL6 A;  4A49 A;  2IDA A;  2CKL A;  3U5O A;  1F62 A;  2M6M A;  2K16 A;  3O35 A;  2LN0 A;  5G05 B;  5C13 A;  4L58 A;  2MUM A;  3O33 A;  1RMD A;  3SHB A;  2Y1N A;  3HCS A;  2K17 A;  1WEE A;  3I2D A;  1Z6U A;  3MHH A;  5C11 A;  4GNG A;  5H9M A;  5KH7 A;  2YUC A;  1JM7 B;  2KWJ A;  3L1X A;  3M62 A;  2K1J A;  1LDJ B;  3PUR A;  2LGK A;  4YBM A;  2QIZ A;  1IYM A;  4YAT A;  1WEM A;  2RSD A;  4WZ0 A;  1K2F A;  3N9Q A;  3ZVY A;  4AVX A;  2L80 A;  4ZQL A;  2L75 A;  2FUI A;  1DVP A;  2LRI C;  2G6Q A;  3VK6 A;  2H0D B;  1WEV A;  3QZV A;  4TKP B;  2E6S A;  2LQ6 A;  3RPG C;  5B76 A;  5TBN A;  3ZYQ A;  5H1U A;  4UP0 A;  3N9P A;  2YT5 A;  1WIL A;  2M1R A;  4P5O B;  4GND A;  3KQI A;  5B79 A;  4MVT A;  5AIT A;  1WEU A;  2KGI A;  3EB5 A;  2HYE D;  2LGL A;  2NAA A;  4CCG X;  3HCU A;  2MD8 C;  3ZNI A;  4V3K C;  4FJC A;  1WGM A;  1N87 A;  4X3G A;  2G43 A;  2EA6 A;  5FB0 A;  1VYX A;  2VPE A;  4L7X A;  3M99 A;  4N3W A;  2VNF A;  1VD4 A;  5TDR A;  4CA1 A;  2YYR A;  2VPD A;  3O34 A;  5LKX A;  2JMJ A;  4YAB A;  1WEO A;  2ECJ A;  2CSZ A;  4F52 B;  4MSX A;  1V87 A;  1BOR A;  4A4B A;  2YRE A;  2CT2 A;  2L0B A;  2KWO A;  4C9Z A;  3ZVZ B;  2LV9 A;  2JMD A;  5H1V A;  1WEN A;  3ZPV 1;  3RPG B;  3EB6 A;  5B77 A;  2YQM A;  2YW8 A;  5D1M B;  3KV5 A;  2LGG A;  2HDP A;  1HYI A;  5D1L B;  1X4J A;  2L5U A;  2OXQ C;  4PTB A;  5G04 B;  2K4D A;  2FUU A;  3GV4 A;  2XB1 A;  4I7C A;  3O37 A;  2YHN A;  3L1Z B;  2L43 A;  3T7L A;  2XEU A;  1WE9 A;  2VP7 A;  5JG6 A;  2LDR A;  2I50 A;  3T6R A;  2LXH C;  2MD7 B;  4UI9 B;  5FER A;  2KR4 A;  1WES A;  2F42 A;  4B86 C;  3LQJ A;  1WEQ A;  5KH3 A;  4I7B A;  4BBQ A;  3ZTG A;  1ZBD B;  4O64 A;  5DIN A;  2DX8 A;  3HCT A;  3U5N A;  2C2L A;  2E6R A;  5B78 A;  3O70 A;  3O7A A;  4QF3 A;  3PUQ A;  3N9M A;  2KE1 A;  3FL2 A;  4R8P K;  4YC9 A;  2M85 A;  4UP5 A;  2YUR A;  4LJN A;  2LXP C;  1HYJ A;  5FEY A;  4A4C A;  1JOC A;  2EOD A;  4S3O B;  4R2Y A;  1X4I A;  1WFK A;  2CKL B;  2G45 A;  2Y1M A;  3SOX A;  1WEP A;  2YSJ A;  2AN6 A;  3U5P A;  2D8S A;  4W4U A;  3SOU A;  4GB0 A;  1U6G B;  5TRB A;  2ZET C;  4IC2 A;  2ECW A;  2VPG A;  4AYC A;  4B7Y C;  2VJE A;  4R7E A;  5B75 A;  4AUQ B;  4LLB A;  5LKT A;  2MT5 A;  1WIM A;  2VPB A;  2KWN A;  2QJ0 A;  3U5M A;  4FIP A;  2LGV A;  2PUY A;  2QIC A;  5AIU A;  4A0C D;  3NG2 A;  1FBV A;  4S3O C;  3PHD A;  4WA6 A;  2F6J A;  2PNX A;  2VJF A;  2ECN A;  2YQL A;  4NN2 A;  4LKA A;  4AP4 A;  4FK5 A;  3ZPV E;  5H1T A;  5I3L A;  3RTR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...