4L58A

Crystal structure of the mll5 phd finger in complex with h3k4me3
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
65
structure length
65
Chain Sequence
DVTRCICGFTHDDGYMICCDKCSVWQHIDCMGIDRQHIPDTYLCERCQPRNLDKERAVLLQRRKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-lysine N-methyltransferase MLL5
publication title Molecular basis for chromatin binding and regulation of MLL5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 18
structure length 65
sequence length 65
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2013-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4l58A00
4S3OB 1F62A 4NN2A 2VJEA 2MNYA 2L43A 2K16A 2I50A 3SHBA 2C2LA 4CCGX 2L0BA 2FUIA 1MM2A 2ECIA 3HCSA 4I7CA 2FUUA 4V3LC 4YADA 3M62A 4B7YC 3LQIA 4GNEA 1WEPA 4IC3A 3N9MA 1U6GB 1WEQA 2BAYA 4I7DA 4FIPA 5D1KB 2MIQA 2G43A 2JRJA 4V3KC 3ASLA 4LKAA 2F6JA 2CKLB 3ZVZB 3RPGB 2JMIA 2LN0A 4YBMA 5AIUA 2KR4A 3U5PA 5FEYA 2YT5A 3SOUA 1BORA 2YYRA 3GV4A 4BHWA 2G45A 5H9MA 3LQJA 3V43A 3C5KA 4R8PK 3ZNIA 1X4UA 2L75A 1WEOA 2MT5A 2QICA 4LK9A 2KWKA 2H0DA 3PUQA 5B75A 2ECNA 2JMJA 1K2FA 3T6RA 2CT2A 5AITA 4ZUXU 5LCWB 1JOCA 2MA6A 3DQVR 2QJ0A 3N9NA 4QF2A 4YBTA 2K1JA 3KQIA 1VYXA 2MNZA 4C9ZA 2LXPC 1WILA 2Y43A 2K17A 3O36A 3ZYQA 4B86C 1HYJA 2L5UA 5H1TA 4AUQB 3RTRB 4XI1A 2HYED 1RMDA 5FB0A 2LGGA 4WA6A 3N9QA 2XB1A 4PTBA 2VJFA 4A4CA 2G6QA 3PHDA 5D1MB 1X4IA 1WEEA 2VJFB 1VD4A 1LDJB 5B77A 1IYMA 4AVXA 1WFKA 2ECJA 2ECVA 2YQMA 5H1VA 1WEWA 4YATA 2C2VS 5H1UA 5FERA 2EGPA 3O34A 2CKLA 1WIMA 5I3LA 1WEUA 1WESA 4P5OB 4AYCB 5B79A 1JM7B 5C11A 1LDKC 2EA6A 4LJNA 2L80A 3L1XA 2LGLA 1WEMA 5G04B 2LRIC 2UZGA 4R7EA 2YHNA 4MVTA 1V87A 2ECWA 2OXQC 5DKAA 5TRBA 2KIZA 1DVPA 4UP0A 4PPEA 1Z6UA 4LADB 2LXHC 3NG2A 4N4FA 4QF3A 5C13A 2F6NA 2M6MA 4I7BA 4F52B 3LRQA 4BBQA 5LKUA 4O64A 2FSAA 2ECGA 2Y1MA 5J3XA 1HYIA 2CSZA 4N3WA 4WZ0A 2KYUA 1N87A 4YBSA 3T7LA 1WE9A 2PNXA 5G05B 5TDRA 2KGGA 2RI7A 2YQLA 3I2DA 2ECTA 2MUMA 2LGVA 3MHHA 2YUCA 1XWHA 3SOWA 5KH7A 4W4UA 3O35A 2D8SA 4CA1A 1WGMA 3LQHA 3KV6A 3EB5A 2LQ6A 1Z60A 1ZBDB 4S3OC 4L58A 2ZETC 2HDPA 2MA5A 2AN6A 2YSMA 2VNFA 4GNFA 4WZ3B 4FO9A 5DINA 3KV5A 2LDRA 3U5MA 2M85A 1T1HA 3O33A 1WEVA 2KGIA 3ZTGA 4GNDA 1G25A 2PUYA 4WZ2A 4AYCA 1E4UA 4MSXA 3HCTA 3GL6A 1JM7A 2E6RA 3O7AA 4UP5A 2VJEB 3RPGC 4A0CD 2QIZA 5EYAF 3N9PA 1CHCA 1FBVA 3ZPV1 1Z2QA 4YAXA 2KWJA 2YREA 4A49A 2YU4A 1X4JA 2M3HA 2LV9A 2IDAA 3M63A 1FP0A 3O70A 2XEUA 2YURA 3DPLR 3U5NA 3KNVA 3ZVYA 5B76A 4L7XA 3N9OA 4FJCA 2NAAA 2F42A 4A4BA 4IC2A 3MHSA 3EB6A 3O37A 5B8DA 3IHPA 2RSDA 3L1ZB 3M99A 2KU3A 2Y1NA 2M1RA 4X3GA 4ZQLA 2VP7A 3FL2A 5LKTA 3N9LA 2YHOA 4ZDTA 3QZVA 5B78A 5LKXA 2VPBA 5TDWA 1WENA 2KWNA 3VK6A 3L11A 5KH9A 2CSYA 2LGKA 2VPEA 4Q6FA 5TABA 5KH3A 2EODA 2DX8A 2H0DB 2MD7B 1VFYA 3C6WA 5G0FA 3U5OA 5D1LB 5FB1A 5TBNA 4AP4A 2JMDA 2KFTA 3HCUA 2MD8C 2VPDA 5JG6A 4YABA 2E6SA 5LKZA 4GNGA 4YC9A 4GB0A 4LLBA 2KWOA 2YW8A 3PURA 2KE1A 4R2YA 3ZPVE 3HTKC 4FK5A 3SOXA 2K4DA 2KREA 1MM3A 4UI9B 4TKPB 2YSJA 2VPGA
chains in the Genus database with same CATH superfamily
4OGEA 4S3OB 1F62A 2XP0A 4NN2A 2VJEA 2MNYA 2L43A 2K16A 2I50A 3SHBA 2C2LA 4CCGX 2L0BA 4O62A 2FUIA 2FFWA 2JUNA 1MM2A 2ECIA 3HCSA 4I7CA 2FUUA 4V3LC 4YADA 3M62A 4B7YC 3LVRE 3LQIA 4GNEA 1WEPA 4IC3A 3N9MA 1U6GB 1WEQA 2BAYA 4I7DA 4FIPA 5D1KB 2RR4A 2MIQA 2G43A 2JRJA 4V3KC 3ASLA 4LKAA 2F6JA 2CKLB 3ZVZB 3RPGB 2JMIA 2LN0A 4YBMA 5AIUA 2KR4A 3U5PA 5FEYA 2YT5A 3SOUA 1BORA 2YYRA 3GV4A 4BHWA 2G45A 5H9MA 3LQJA 4Z0RA 2XOCA 3V43A 3JUEA 5SVYA 4Z0OA 3C5KA 2OWAA 4R8PK 3ZNIA 1X4UA 2L75A 2LAUA 1WEOA 2MT5A 2QICA 4LK9A 2KWKA 2H0DA 3PUQA 5B75A 2ECNA 2JMJA 1K2FA 3MDBC 3T6RA 2CT2A 5AITA 4ZUXU 5LCWB 1DCQA 2CRRA 1JOCA 2MA6A 3DQVR 2M13A 2QJ0A 4OGCA 3N9NA 2FD4A 4QF2A 3DWDA 3O47A 4YBTA 2K1JA 3KQIA 1VYXA 2MNZA 4C9ZA 2LXPC 1WILA 2Y43A 2K17A 3O36A 3ZYQA 2EXUA 4B86C 1HYJA 2L5UA 5H1TA 4AUQB 3RTRB 1MBMA 4XI1A 2HYED 3LDYA 2IQJA 1RMDA 2CONA 2DJAA 5FB0A 2LGGA 4WA6A 3N9QA 2XB1A 4PTBA 2VJFA 4A4CA 2G6QA 2P57A 3PHDA 5D1MB 1X4IA 1WEEA 2VJFB 1VD4A 1LDJB 3T9KA 5B77A 1IYMA 4AVXA 1WFKA 2ECJA 2ECVA 2YQMA 5H1VA 2EGMA 1WEWA 4YATA 2C2VS 5H1UA 5FERA 2EGPA 3O34A 3FAOA 2CKLA 1WIMA 5I3LA 1WEUA 1WESA 4P5OB 4AYCB 5B79A 1JM7B 4QQ4A 5C11A 5K3QA 1LDKC 2EA6A 4LJNA 5SVIB 2E61A 2L80A 3L1XA 2LGLA 1WEMA 3FANA 5G04B 2LRIC 2UZGA 4R7EA 2YHNA 4MVTA 1V87A 2ECWA 2OXQC 3PLWA 5DKAA 5TRBA 2KIZA 1DVPA 4UP0A 4PPEA 1Z6UA 3FEHA 4LADB 2LXHC 3NG2A 4N4FA 4QF3A 5C13A 2F6NA 2M6MA 2CRWA 4I7BA 4F52B 3LRQA 2KKYA 4BBQA 5LKUA 4O64A 2FSAA 2KKXA 4F1PA 2ECGA 2Y1MA 5J3XA 1HYIA 2CSZA 4N3WA 4WZ0A 2KYUA 1N87A 4YBSA 3T7LA 1WE9A 2PNXA 5G05B 2JM3A 2YVRA 5TDRA 2KGGA 2RI7A 2YQLA 3I2DA 2ECTA 3Q1DA 2B0OE 4H9DA 2MUMA 3KDEC 2LGVA 3MHHA 2YUCA 1XWHA 3SOWA 5KH7A 4W4UA 3O35A 2D8SA 4CA1A 1WGMA 3LQHA 3KV6A 3EB5A 2LQ6A 1Z60A 1ZBDB 4S3OC 4L58A 2ZETC 3FJUB 2HDPA 2MA5A 2AN6A 2YSMA 2VNFA 4GNFA 4WZ3B 4FO9A 5DINA 2CSVA 3KV5A 2LDRA 3U5MA 2M85A 1T1HA 3O33A 1WEVA 2KGIA 3ZTGA 4GNDA 1G25A 2MKEA 2PUYA 4WZ2A 4AYCA 1E4UA 4MSXA 3HCTA 3GL6A 1JM7A 2E6RA 3O7AA 4UP5A 2VJEB 5SVIA 3RPGC 4A0CD 2DSMA 2QIZA 5EYAF 3N9PA 1CHCA 1FBVA 3ZPV1 1Z2QA 4YAXA 2KWJA 2YREA 4A49A 2YU4A 1X4JA 2M3HA 2LV9A 2IDAA 3M63A 1FP0A 3O70A 3E2DA 2XEUA 2YURA 3DPLR 3LVQE 3U5NA 3M7KA 2L7PA 3KNVA 3ZVYA 5B76A 4L7XA 3N9OA 4FJCA 2NAAA 2F42A 4A4BA 3H7HA 4IC2A 3MHSA 3EB6A 3O37A 5B8DA 3IHPA 2RSDA 3L1ZB 3M99A 2KU3A 2Y1NA 2M1RA 4X3GA 3SUBA 4ZQLA 2VP7A 3FL2A 5LKTA 3N9LA 2YHOA 4ZDTA 3QZVA 5B78A 5LKXA 2VPBA 5TDWA 1WENA 2KWNA 3VK6A 3L11A 5KH9A 2CSYA 2LGKA 2VPEA 4Q6FA 5TABA 5KH3A 2EODA 2DX8A 2H0DB 2D8UA 5SVXA 2MD7B 1VFYA 3C6WA 3LJUX 5G0FA 3U5OA 5D1LB 5FB1A 5TBNA 2XOZA 4AP4A 2JMDA 2KFTA 3HCUA 2MD8C 2VPDA 5JG6A 4YABA 2XOYA 2E6SA 3FM8C 4GNGA 5LKZA 4YC9A 4GB0A 4LLBA 2KWOA 2YW8A 3PURA 2KE1A 4R2YA 3ZPVE 3HTKC 4FK5A 3SOXA 2K4DA 2KREA 1MM3A 4UI9B 4TKPB 2YSJA 2VPGA 3DDTA
chains in the Genus database with same CATH topology
4S3OB 1F62A 4NN2A 2VJEA 2MNYA 2L43A 2K16A 2I50A 3SHBA 2C2LA 4CCGX 2L0BA 2FUIA 1MM2A 2ECIA 3HCSA 4I7CA 2FUUA 4V3LC 4YADA 3M62A 4B7YC 3LQIA 4GNEA 1WEPA 4IC3A 3N9MA 1U6GB 1WEQA 2BAYA 4I7DA 4FIPA 5D1KB 2MIQA 2G43A 2JRJA 4V3KC 3ASLA 4LKAA 2F6JA 2CKLB 3ZVZB 3RPGB 2JMIA 2LN0A 4YBMA 5AIUA 2KR4A 3U5PA 5FEYA 2YT5A 3SOUA 1BORA 2YYRA 3GV4A 4BHWA 2G45A 5H9MA 3LQJA 3V43A 3C5KA 4R8PK 3ZNIA 1X4UA 2L75A 1WEOA 2MT5A 2QICA 4LK9A 2KWKA 2H0DA 3PUQA 5B75A 2ECNA 2JMJA 1K2FA 3T6RA 2CT2A 5AITA 4ZUXU 5LCWB 1JOCA 2MA6A 3DQVR 2QJ0A 3N9NA 4QF2A 4YBTA 2K1JA 3KQIA 1VYXA 2MNZA 4C9ZA 2LXPC 1WILA 2Y43A 2K17A 3O36A 3ZYQA 4B86C 1HYJA 2L5UA 5H1TA 4AUQB 3RTRB 4XI1A 2HYED 1RMDA 5FB0A 2LGGA 4WA6A 3N9QA 2XB1A 4PTBA 2VJFA 4A4CA 2G6QA 3PHDA 5D1MB 1X4IA 1WEEA 2VJFB 1VD4A 1LDJB 5B77A 1IYMA 4AVXA 1WFKA 2ECJA 2ECVA 2YQMA 5H1VA 1WEWA 4YATA 2C2VS 5H1UA 5FERA 2EGPA 3O34A 2CKLA 1WIMA 5I3LA 1WEUA 1WESA 4P5OB 4AYCB 5B79A 1JM7B 5C11A 1LDKC 2EA6A 4LJNA 2L80A 3L1XA 2LGLA 1WEMA 5G04B 2LRIC 2UZGA 4R7EA 2YHNA 4MVTA 1V87A 2ECWA 2OXQC 5DKAA 5TRBA 2KIZA 1DVPA 4UP0A 4PPEA 1Z6UA 4LADB 2LXHC 3NG2A 4N4FA 4QF3A 5C13A 2F6NA 2M6MA 4I7BA 4F52B 3LRQA 4BBQA 5LKUA 4O64A 2FSAA 2ECGA 2Y1MA 5J3XA 1HYIA 2CSZA 4N3WA 4WZ0A 2KYUA 1N87A 4YBSA 3T7LA 1WE9A 2PNXA 5G05B 5TDRA 2KGGA 2RI7A 2YQLA 3I2DA 2ECTA 2MUMA 2LGVA 3MHHA 2YUCA 1XWHA 3SOWA 5KH7A 4W4UA 3O35A 2D8SA 4CA1A 1WGMA 3LQHA 3KV6A 3EB5A 2LQ6A 1Z60A 1ZBDB 4S3OC 4L58A 2ZETC 2HDPA 2MA5A 2AN6A 2YSMA 2VNFA 4GNFA 4WZ3B 4FO9A 5DINA 3KV5A 2LDRA 3U5MA 2M85A 1T1HA 3O33A 1WEVA 2KGIA 3ZTGA 4GNDA 1G25A 2PUYA 4WZ2A 4AYCA 1E4UA 4MSXA 3HCTA 3GL6A 1JM7A 2E6RA 3O7AA 4UP5A 2VJEB 3RPGC 4A0CD 2QIZA 5EYAF 3N9PA 1CHCA 1FBVA 3ZPV1 1Z2QA 4YAXA 2KWJA 2YREA 4A49A 2YU4A 1X4JA 2M3HA 2LV9A 2IDAA 3M63A 1FP0A 3O70A 2XEUA 2YURA 3DPLR 3U5NA 3KNVA 3ZVYA 5B76A 4L7XA 3N9OA 4FJCA 2NAAA 2F42A 4A4BA 4IC2A 3MHSA 3EB6A 3O37A 5B8DA 3IHPA 2RSDA 3L1ZB 3M99A 2KU3A 2Y1NA 2M1RA 4X3GA 4ZQLA 2VP7A 3FL2A 5LKTA 3N9LA 2YHOA 4ZDTA 3QZVA 5B78A 5LKXA 2VPBA 5TDWA 1WENA 2KWNA 3VK6A 3L11A 5KH9A 2CSYA 2LGKA 2VPEA 4Q6FA 5TABA 5KH3A 2EODA 2DX8A 2H0DB 2MD7B 1VFYA 3C6WA 5G0FA 3U5OA 5D1LB 5FB1A 5TBNA 4AP4A 2JMDA 2KFTA 3HCUA 2MD8C 2VPDA 5JG6A 4YABA 2E6SA 5LKZA 4GNGA 4YC9A 4GB0A 4LLBA 2KWOA 2YW8A 3PURA 2KE1A 4R2YA 3ZPVE 3HTKC 4FK5A 3SOXA 2K4DA 2KREA 1MM3A 4UI9B 4TKPB 2YSJA 2VPGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4S3O B;  1F62 A;  4NN2 A;  2VJE A;  2MNY A;  2L43 A;  2K16 A;  2I50 A;  3SHB A;  2C2L A;  4CCG X;  2L0B A;  2FUI A;  1MM2 A;  2ECI A;  3HCS A;  4I7C A;  2FUU A;  4V3L C;  4YAD A;  3M62 A;  4B7Y C;  3LQI A;  4GNE A;  1WEP A;  4IC3 A;  3N9M A;  1U6G B;  1WEQ A;  2BAY A;  4I7D A;  4FIP A;  5D1K B;  2MIQ A;  2G43 A;  2JRJ A;  4V3K C;  3ASL A;  4LKA A;  2F6J A;  2CKL B;  3ZVZ B;  3RPG B;  2JMI A;  2LN0 A;  4YBM A;  5AIU A;  2KR4 A;  3U5P A;  5FEY A;  2YT5 A;  3SOU A;  1BOR A;  2YYR A;  3GV4 A;  4BHW A;  2G45 A;  5H9M A;  3LQJ A;  3V43 A;  3C5K A;  4R8P K;  3ZNI A;  1X4U A;  2L75 A;  1WEO A;  2MT5 A;  2QIC A;  4LK9 A;  2KWK A;  2H0D A;  3PUQ A;  5B75 A;  2ECN A;  2JMJ A;  1K2F A;  3T6R A;  2CT2 A;  5AIT A;  4ZUX U;  5LCW B;  1JOC A;  2MA6 A;  3DQV R;  2QJ0 A;  3N9N A;  4QF2 A;  4YBT A;  2K1J A;  3KQI A;  1VYX A;  2MNZ A;  4C9Z A;  2LXP C;  1WIL A;  2Y43 A;  2K17 A;  3O36 A;  3ZYQ A;  4B86 C;  1HYJ A;  2L5U A;  5H1T A;  4AUQ B;  3RTR B;  4XI1 A;  2HYE D;  1RMD A;  5FB0 A;  2LGG A;  4WA6 A;  3N9Q A;  2XB1 A;  4PTB A;  2VJF A;  4A4C A;  2G6Q A;  3PHD A;  5D1M B;  1X4I A;  1WEE A;  2VJF B;  1VD4 A;  1LDJ B;  5B77 A;  1IYM A;  4AVX A;  1WFK A;  2ECJ A;  2ECV A;  2YQM A;  5H1V A;  1WEW A;  4YAT A;  2C2V S;  5H1U A;  5FER A;  2EGP A;  3O34 A;  2CKL A;  1WIM A;  5I3L A;  1WEU A;  1WES A;  4P5O B;  4AYC B;  5B79 A;  1JM7 B;  5C11 A;  1LDK C;  2EA6 A;  4LJN A;  2L80 A;  3L1X A;  2LGL A;  1WEM A;  5G04 B;  2LRI C;  2UZG A;  4R7E A;  2YHN A;  4MVT A;  1V87 A;  2ECW A;  2OXQ C;  5DKA A;  5TRB A;  2KIZ A;  1DVP A;  4UP0 A;  4PPE A;  1Z6U A;  4LAD B;  2LXH C;  3NG2 A;  4N4F A;  4QF3 A;  5C13 A;  2F6N A;  2M6M A;  4I7B A;  4F52 B;  3LRQ A;  4BBQ A;  5LKU A;  4O64 A;  2FSA A;  2ECG A;  2Y1M A;  5J3X A;  1HYI A;  2CSZ A;  4N3W A;  4WZ0 A;  2KYU A;  1N87 A;  4YBS A;  3T7L A;  1WE9 A;  2PNX A;  5G05 B;  5TDR A;  2KGG A;  2RI7 A;  2YQL A;  3I2D A;  2ECT A;  2MUM A;  2LGV A;  3MHH A;  2YUC A;  1XWH A;  3SOW A;  5KH7 A;  4W4U A;  3O35 A;  2D8S A;  4CA1 A;  1WGM A;  3LQH A;  3KV6 A;  3EB5 A;  2LQ6 A;  1Z60 A;  1ZBD B;  4S3O C;  4L58 A;  2ZET C;  2HDP A;  2MA5 A;  2AN6 A;  2YSM A;  2VNF A;  4GNF A;  4WZ3 B;  4FO9 A;  5DIN A;  3KV5 A;  2LDR A;  3U5M A;  2M85 A;  1T1H A;  3O33 A;  1WEV A;  2KGI A;  3ZTG A;  4GND A;  1G25 A;  2PUY A;  4WZ2 A;  4AYC A;  1E4U A;  4MSX A;  3HCT A;  3GL6 A;  1JM7 A;  2E6R A;  3O7A A;  4UP5 A;  2VJE B;  3RPG C;  4A0C D;  2QIZ A;  5EYA F;  3N9P A;  1CHC A;  1FBV A;  3ZPV 1;  1Z2Q A;  4YAX A;  2KWJ A;  2YRE A;  4A49 A;  2YU4 A;  1X4J A;  2M3H A;  2LV9 A;  2IDA A;  3M63 A;  1FP0 A;  3O70 A;  2XEU A;  2YUR A;  3DPL R;  3U5N A;  3KNV A;  3ZVY A;  5B76 A;  4L7X A;  3N9O A;  4FJC A;  2NAA A;  2F42 A;  4A4B A;  4IC2 A;  3MHS A;  3EB6 A;  3O37 A;  5B8D A;  3IHP A;  2RSD A;  3L1Z B;  3M99 A;  2KU3 A;  2Y1N A;  2M1R A;  4X3G A;  4ZQL A;  2VP7 A;  3FL2 A;  5LKT A;  3N9L A;  2YHO A;  4ZDT A;  3QZV A;  5B78 A;  5LKX A;  2VPB A;  5TDW A;  1WEN A;  2KWN A;  3VK6 A;  3L11 A;  5KH9 A;  2CSY A;  2LGK A;  2VPE A;  4Q6F A;  5TAB A;  5KH3 A;  2EOD A;  2DX8 A;  2H0D B;  2MD7 B;  1VFY A;  3C6W A;  5G0F A;  3U5O A;  5D1L B;  5FB1 A;  5TBN A;  4AP4 A;  2JMD A;  2KFT A;  3HCU A;  2MD8 C;  2VPD A;  5JG6 A;  4YAB A;  2E6S A;  5LKZ A;  4GNG A;  4YC9 A;  4GB0 A;  4LLB A;  2KWO A;  2YW8 A;  3PUR A;  2KE1 A;  4R2Y A;  3ZPV E;  3HTK C;  4FK5 A;  3SOX A;  2K4D A;  2KRE A;  1MM3 A;  4UI9 B;  4TKP B;  2YSJ A;  2VPG A; 
#chains in the Genus database with same CATH topology
 4OGE A;  4S3O B;  1F62 A;  2XP0 A;  4NN2 A;  2VJE A;  2MNY A;  2L43 A;  2K16 A;  2I50 A;  3SHB A;  2C2L A;  4CCG X;  2L0B A;  4O62 A;  2FUI A;  2FFW A;  2JUN A;  1MM2 A;  2ECI A;  3HCS A;  4I7C A;  2FUU A;  4V3L C;  4YAD A;  3M62 A;  4B7Y C;  3LVR E;  3LQI A;  4GNE A;  1WEP A;  4IC3 A;  3N9M A;  1U6G B;  1WEQ A;  2BAY A;  4I7D A;  4FIP A;  5D1K B;  2RR4 A;  2MIQ A;  2G43 A;  2JRJ A;  4V3K C;  3ASL A;  4LKA A;  2F6J A;  2CKL B;  3ZVZ B;  3RPG B;  2JMI A;  2LN0 A;  4YBM A;  5AIU A;  2KR4 A;  3U5P A;  5FEY A;  2YT5 A;  3SOU A;  1BOR A;  2YYR A;  3GV4 A;  4BHW A;  2G45 A;  5H9M A;  3LQJ A;  4Z0R A;  2XOC A;  3V43 A;  3JUE A;  5SVY A;  4Z0O A;  3C5K A;  2OWA A;  4R8P K;  3ZNI A;  1X4U A;  2L75 A;  2LAU A;  1WEO A;  2MT5 A;  2QIC A;  4LK9 A;  2KWK A;  2H0D A;  3PUQ A;  5B75 A;  2ECN A;  2JMJ A;  1K2F A;  3MDB C;  3T6R A;  2CT2 A;  5AIT A;  4ZUX U;  5LCW B;  1DCQ A;  2CRR A;  1JOC A;  2MA6 A;  3DQV R;  2M13 A;  2QJ0 A;  4OGC A;  3N9N A;  2FD4 A;  4QF2 A;  3DWD A;  3O47 A;  4YBT A;  2K1J A;  3KQI A;  1VYX A;  2MNZ A;  4C9Z A;  2LXP C;  1WIL A;  2Y43 A;  2K17 A;  3O36 A;  3ZYQ A;  2EXU A;  4B86 C;  1HYJ A;  2L5U A;  5H1T A;  4AUQ B;  3RTR B;  1MBM A;  4XI1 A;  2HYE D;  3LDY A;  2IQJ A;  1RMD A;  2CON A;  2DJA A;  5FB0 A;  2LGG A;  4WA6 A;  3N9Q A;  2XB1 A;  4PTB A;  2VJF A;  4A4C A;  2G6Q A;  2P57 A;  3PHD A;  5D1M B;  1X4I A;  1WEE A;  2VJF B;  1VD4 A;  1LDJ B;  3T9K A;  5B77 A;  1IYM A;  4AVX A;  1WFK A;  2ECJ A;  2ECV A;  2YQM A;  5H1V A;  2EGM A;  1WEW A;  4YAT A;  2C2V S;  5H1U A;  5FER A;  2EGP A;  3O34 A;  3FAO A;  2CKL A;  1WIM A;  5I3L A;  1WEU A;  1WES A;  4P5O B;  4AYC B;  5B79 A;  1JM7 B;  4QQ4 A;  5C11 A;  5K3Q A;  1LDK C;  2EA6 A;  4LJN A;  5SVI B;  2E61 A;  2L80 A;  3L1X A;  2LGL A;  1WEM A;  3FAN A;  5G04 B;  2LRI C;  2UZG A;  4R7E A;  2YHN A;  4MVT A;  1V87 A;  2ECW A;  2OXQ C;  3PLW A;  5DKA A;  5TRB A;  2KIZ A;  1DVP A;  4UP0 A;  4PPE A;  1Z6U A;  3FEH A;  4LAD B;  2LXH C;  3NG2 A;  4N4F A;  4QF3 A;  5C13 A;  2F6N A;  2M6M A;  2CRW A;  4I7B A;  4F52 B;  3LRQ A;  2KKY A;  4BBQ A;  5LKU A;  4O64 A;  2FSA A;  2KKX A;  4F1P A;  2ECG A;  2Y1M A;  5J3X A;  1HYI A;  2CSZ A;  4N3W A;  4WZ0 A;  2KYU A;  1N87 A;  4YBS A;  3T7L A;  1WE9 A;  2PNX A;  5G05 B;  2JM3 A;  2YVR A;  5TDR A;  2KGG A;  2RI7 A;  2YQL A;  3I2D A;  2ECT A;  3Q1D A;  2B0O E;  4H9D A;  2MUM A;  3KDE C;  2LGV A;  3MHH A;  2YUC A;  1XWH A;  3SOW A;  5KH7 A;  4W4U A;  3O35 A;  2D8S A;  4CA1 A;  1WGM A;  3LQH A;  3KV6 A;  3EB5 A;  2LQ6 A;  1Z60 A;  1ZBD B;  4S3O C;  4L58 A;  2ZET C;  3FJU B;  2HDP A;  2MA5 A;  2AN6 A;  2YSM A;  2VNF A;  4GNF A;  4WZ3 B;  4FO9 A;  5DIN A;  2CSV A;  3KV5 A;  2LDR A;  3U5M A;  2M85 A;  1T1H A;  3O33 A;  1WEV A;  2KGI A;  3ZTG A;  4GND A;  1G25 A;  2MKE A;  2PUY A;  4WZ2 A;  4AYC A;  1E4U A;  4MSX A;  3HCT A;  3GL6 A;  1JM7 A;  2E6R A;  3O7A A;  4UP5 A;  2VJE B;  5SVI A;  3RPG C;  4A0C D;  2DSM A;  2QIZ A;  5EYA F;  3N9P A;  1CHC A;  1FBV A;  3ZPV 1;  1Z2Q A;  4YAX A;  2KWJ A;  2YRE A;  4A49 A;  2YU4 A;  1X4J A;  2M3H A;  2LV9 A;  2IDA A;  3M63 A;  1FP0 A;  3O70 A;  3E2D A;  2XEU A;  2YUR A;  3DPL R;  3LVQ E;  3U5N A;  3M7K A;  2L7P A;  3KNV A;  3ZVY A;  5B76 A;  4L7X A;  3N9O A;  4FJC A;  2NAA A;  2F42 A;  4A4B A;  3H7H A;  4IC2 A;  3MHS A;  3EB6 A;  3O37 A;  5B8D A;  3IHP A;  2RSD A;  3L1Z B;  3M99 A;  2KU3 A;  2Y1N A;  2M1R A;  4X3G A;  3SUB A;  4ZQL A;  2VP7 A;  3FL2 A;  5LKT A;  3N9L A;  2YHO A;  4ZDT A;  3QZV A;  5B78 A;  5LKX A;  2VPB A;  5TDW A;  1WEN A;  2KWN A;  3VK6 A;  3L11 A;  5KH9 A;  2CSY A;  2LGK A;  2VPE A;  4Q6F A;  5TAB A;  5KH3 A;  2EOD A;  2DX8 A;  2H0D B;  2D8U A;  5SVX A;  2MD7 B;  1VFY A;  3C6W A;  3LJU X;  5G0F A;  3U5O A;  5D1L B;  5FB1 A;  5TBN A;  2XOZ A;  4AP4 A;  2JMD A;  2KFT A;  3HCU A;  2MD8 C;  2VPD A;  5JG6 A;  4YAB A;  2XOY A;  2E6S A;  3FM8 C;  4GNG A;  5LKZ A;  4YC9 A;  4GB0 A;  4LLB A;  2KWO A;  2YW8 A;  3PUR A;  2KE1 A;  4R2Y A;  3ZPV E;  3HTK C;  4FK5 A;  3SOX A;  2K4D A;  2KRE A;  1MM3 A;  4UI9 B;  4TKP B;  2YSJ A;  2VPG A;  3DDT A; 
#chains in the Genus database with same CATH homology
 4S3O B;  1F62 A;  4NN2 A;  2VJE A;  2MNY A;  2L43 A;  2K16 A;  2I50 A;  3SHB A;  2C2L A;  4CCG X;  2L0B A;  2FUI A;  1MM2 A;  2ECI A;  3HCS A;  4I7C A;  2FUU A;  4V3L C;  4YAD A;  3M62 A;  4B7Y C;  3LQI A;  4GNE A;  1WEP A;  4IC3 A;  3N9M A;  1U6G B;  1WEQ A;  2BAY A;  4I7D A;  4FIP A;  5D1K B;  2MIQ A;  2G43 A;  2JRJ A;  4V3K C;  3ASL A;  4LKA A;  2F6J A;  2CKL B;  3ZVZ B;  3RPG B;  2JMI A;  2LN0 A;  4YBM A;  5AIU A;  2KR4 A;  3U5P A;  5FEY A;  2YT5 A;  3SOU A;  1BOR A;  2YYR A;  3GV4 A;  4BHW A;  2G45 A;  5H9M A;  3LQJ A;  3V43 A;  3C5K A;  4R8P K;  3ZNI A;  1X4U A;  2L75 A;  1WEO A;  2MT5 A;  2QIC A;  4LK9 A;  2KWK A;  2H0D A;  3PUQ A;  5B75 A;  2ECN A;  2JMJ A;  1K2F A;  3T6R A;  2CT2 A;  5AIT A;  4ZUX U;  5LCW B;  1JOC A;  2MA6 A;  3DQV R;  2QJ0 A;  3N9N A;  4QF2 A;  4YBT A;  2K1J A;  3KQI A;  1VYX A;  2MNZ A;  4C9Z A;  2LXP C;  1WIL A;  2Y43 A;  2K17 A;  3O36 A;  3ZYQ A;  4B86 C;  1HYJ A;  2L5U A;  5H1T A;  4AUQ B;  3RTR B;  4XI1 A;  2HYE D;  1RMD A;  5FB0 A;  2LGG A;  4WA6 A;  3N9Q A;  2XB1 A;  4PTB A;  2VJF A;  4A4C A;  2G6Q A;  3PHD A;  5D1M B;  1X4I A;  1WEE A;  2VJF B;  1VD4 A;  1LDJ B;  5B77 A;  1IYM A;  4AVX A;  1WFK A;  2ECJ A;  2ECV A;  2YQM A;  5H1V A;  1WEW A;  4YAT A;  2C2V S;  5H1U A;  5FER A;  2EGP A;  3O34 A;  2CKL A;  1WIM A;  5I3L A;  1WEU A;  1WES A;  4P5O B;  4AYC B;  5B79 A;  1JM7 B;  5C11 A;  1LDK C;  2EA6 A;  4LJN A;  2L80 A;  3L1X A;  2LGL A;  1WEM A;  5G04 B;  2LRI C;  2UZG A;  4R7E A;  2YHN A;  4MVT A;  1V87 A;  2ECW A;  2OXQ C;  5DKA A;  5TRB A;  2KIZ A;  1DVP A;  4UP0 A;  4PPE A;  1Z6U A;  4LAD B;  2LXH C;  3NG2 A;  4N4F A;  4QF3 A;  5C13 A;  2F6N A;  2M6M A;  4I7B A;  4F52 B;  3LRQ A;  4BBQ A;  5LKU A;  4O64 A;  2FSA A;  2ECG A;  2Y1M A;  5J3X A;  1HYI A;  2CSZ A;  4N3W A;  4WZ0 A;  2KYU A;  1N87 A;  4YBS A;  3T7L A;  1WE9 A;  2PNX A;  5G05 B;  5TDR A;  2KGG A;  2RI7 A;  2YQL A;  3I2D A;  2ECT A;  2MUM A;  2LGV A;  3MHH A;  2YUC A;  1XWH A;  3SOW A;  5KH7 A;  4W4U A;  3O35 A;  2D8S A;  4CA1 A;  1WGM A;  3LQH A;  3KV6 A;  3EB5 A;  2LQ6 A;  1Z60 A;  1ZBD B;  4S3O C;  4L58 A;  2ZET C;  2HDP A;  2MA5 A;  2AN6 A;  2YSM A;  2VNF A;  4GNF A;  4WZ3 B;  4FO9 A;  5DIN A;  3KV5 A;  2LDR A;  3U5M A;  2M85 A;  1T1H A;  3O33 A;  1WEV A;  2KGI A;  3ZTG A;  4GND A;  1G25 A;  2PUY A;  4WZ2 A;  4AYC A;  1E4U A;  4MSX A;  3HCT A;  3GL6 A;  1JM7 A;  2E6R A;  3O7A A;  4UP5 A;  2VJE B;  3RPG C;  4A0C D;  2QIZ A;  5EYA F;  3N9P A;  1CHC A;  1FBV A;  3ZPV 1;  1Z2Q A;  4YAX A;  2KWJ A;  2YRE A;  4A49 A;  2YU4 A;  1X4J A;  2M3H A;  2LV9 A;  2IDA A;  3M63 A;  1FP0 A;  3O70 A;  2XEU A;  2YUR A;  3DPL R;  3U5N A;  3KNV A;  3ZVY A;  5B76 A;  4L7X A;  3N9O A;  4FJC A;  2NAA A;  2F42 A;  4A4B A;  4IC2 A;  3MHS A;  3EB6 A;  3O37 A;  5B8D A;  3IHP A;  2RSD A;  3L1Z B;  3M99 A;  2KU3 A;  2Y1N A;  2M1R A;  4X3G A;  4ZQL A;  2VP7 A;  3FL2 A;  5LKT A;  3N9L A;  2YHO A;  4ZDT A;  3QZV A;  5B78 A;  5LKX A;  2VPB A;  5TDW A;  1WEN A;  2KWN A;  3VK6 A;  3L11 A;  5KH9 A;  2CSY A;  2LGK A;  2VPE A;  4Q6F A;  5TAB A;  5KH3 A;  2EOD A;  2DX8 A;  2H0D B;  2MD7 B;  1VFY A;  3C6W A;  5G0F A;  3U5O A;  5D1L B;  5FB1 A;  5TBN A;  4AP4 A;  2JMD A;  2KFT A;  3HCU A;  2MD8 C;  2VPD A;  5JG6 A;  4YAB A;  2E6S A;  5LKZ A;  4GNG A;  4YC9 A;  4GB0 A;  4LLB A;  2KWO A;  2YW8 A;  3PUR A;  2KE1 A;  4R2Y A;  3ZPV E;  3HTK C;  4FK5 A;  3SOX A;  2K4D A;  2KRE A;  1MM3 A;  4UI9 B;  4TKP B;  2YSJ A;  2VPG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...