4L58A

Crystal structure of the mll5 phd finger in complex with h3k4me3
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
65
structure length
65
Chain Sequence
b'DVTRCICGFTHDDGYMICCDKCSVWQHIDCMGIDRQHIPDTYLCERCQPRNLDKERAVLLQRRKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-lysine N-methyltransferase MLL5
publication title Molecular basis for chromatin binding and regulation of MLL5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 18
structure length 65
sequence length 65
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2013-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4l58A00
4LADB 5DINA 3ZVZB 5B77A 5JG6A 5H1VA 2KE1A 2VPEA 4V3LC 2ECVA 5J3XA 3KQIA 4FJCA 1HYIA 2HDPA 1WEOA 2LRIC 4GNDA 5LKUA 5KH7A 4N3WA 3M62A 2KR4A 2M1RA 2KGIA 1WENA 5H1TA 1HYJA 1WFKA 3LQJA 2VJFB 3PUQA 4A4BA 3QZVA 2VPBA 2KWKA 2L43A 1N87A 4A4CA 2M85A 5B75A 5B79A 3O37A 2RSDA 2ZETC 4UP5A 3KNVA 4L7XA 2YQMA 4WZ2A 3NG2A 2LXHC 2OXQC 3U5NA 1WEVA 1V87A 3SOUA 2E6RA 1X4JA 4IC3A 5G0FA 2ECJA 4S3OB 4LK9A 2FUIA 4L58A 2MIQA 3DPLR 4X3GA 3GV4A 4S3OC 4YC9A 3U5OA 5B8DA 2G43A 3O34A 4N4FA 3V43A 3T6RA 2YURA 2LV9A 4B7YC 4Q6FA 1X4IA 2CKLA 3HCSA 3N9OA 1WE9A 4CCGX 3N9LA 2BAYA 2I50A 2KYUA 2K17A 1WGMA 1IYMA 2QJ0A 4PPEA 1FBVA 2KU3A 3U5MA 1JM7A 4LLBA 3GL6A 2LQ6A 2EODA 1FP0A 5G05B 2AN6A 1CHCA 4R7EA 4WZ0A 3T7LA 3M99A 2F6NA 3ZNIA 5H1UA 2VJEA 5TABA 3N9NA 4ZUXU 1WEMA 2VP7A 4PTBA 4B86C 2Y1MA 5FEYA 4QF3A 2H0DA 4O64A 3KV5A 3I2DA 2E6SA 4R2YA 2KWJA 1VFYA 2YW8A 1Z6UA 4YATA 3SHBA 4V3KC 3ZPVE 1WESA 2CT2A 5B76A 2HYED 3MHSA 2VPDA 3C5KA 4ZQLA 1U6GB 4CA1A 4LKAA 2ECGA 4AYCA 3ZVYA 4GNGA 4NN2A 2RI7A 2JMDA 4I7BA 2VPGA 1MM3A 4AYCB 2L0BA 1LDKC 3LRQA 2MUMA 4GB0A 2YSJA 3MHHA 3L1XA 4I7DA 4FIPA 5D1MB 4LJNA 5B78A 4YBSA 2YT5A 2JRJA 3O35A 1XWHA 5C11A 3O33A 2Y43A 3U5PA 3N9MA 3HCUA 3SOWA 4WA6A 4BBQA 2VNFA 5FERA 4YBMA 2ECIA 2CKLB 2KGGA 3DQVR 1ZBDB 2LGVA 2QICA 2LDRA 4FO9A 4QF2A 3HCTA 4P5OB 2ECNA 1WEEA 5LCWB 2LGLA 1T1HA 2MD7B 1E4UA 2K4DA 4MVTA 5I3LA 2NAAA 1JM7B 1F62A 4AVXA 3O70A 2EA6A 2DX8A 2PUYA 2YSMA 2FUUA 4UP0A 4WZ3B 2XB1A 5TRBA 3EB6A 2L80A 4AP4A 3HTKC 2LXPC 4BHWA 2VJEB 5LKZA 2F6JA 5LKXA 5AIUA 2M6MA 1WEQA 2XEUA 2KREA 4MSXA 3RTRB 3SOXA 1WEUA 3PURA 3L11A 1G25A 2ECTA 2G6QA 2MNYA 2H0DB 1WILA 2C2VS 2YQLA 5D1LB 1Z60A 2JMJA 2IDAA 5LKTA 2MNZA 4XI1A 3KV6A 2KWOA 2VJFA 1BORA 3O36A 2KIZA 2C2LA 2MT5A 4W4UA 5FB0A 4YADA 3RPGB 2L5UA 2CSYA 4ZDTA 1K2FA 3ZYQA 4R8PK 2YHNA 1WEPA 3RPGC 4A0CD 5TDRA 3ZPV1 3PHDA 5AITA 3O7AA 2YU4A 4IC2A 2Y1NA 4C9ZA 2LN0A 2JMIA 2YYRA 2KWNA 2F42A 3LQHA 3IHPA 5D1KB 2CSZA 2UZGA 3ASLA 5KH3A 2K16A 5H9MA 3L1ZB 4I7CA 2K1JA 1DVPA 2ECWA 5C13A 2QIZA 4AUQB 5EYAF 2YUCA 4TKPB 2LGGA 2EGPA 3M63A 3LQIA 5TBNA 4UI9B 3N9QA 2FSAA 1VD4A 5KH9A 1VYXA 2G45A 2M3HA 2L75A 2MD8C 2MA6A 4GNFA 1MM2A 2LGKA 2YHOA 5DKAA 1Z2QA 4GNEA 3ZTGA 3FL2A 2D8SA 2KFTA 4FK5A 2MA5A 1RMDA 2PNXA 4YBTA 4A49A 5TDWA 3N9PA 2YREA 4F52B 3VK6A 1WIMA 4YABA 3EB5A 3C6WA 1X4UA 1JOCA 5FB1A 1WEWA 1LDJB 5G04B 4YAXA
chains in the Genus database with same CATH superfamily
4LADB 3T9KA 5DINA 3ZVZB 5B77A 5JG6A 5H1VA 2KE1A 2VPEA 4V3LC 2ECVA 5J3XA 3KQIA 4FJCA 1HYIA 2HDPA 1WEOA 2LRIC 3DDTA 4GNDA 4F1PA 5LKUA 5KH7A 4N3WA 3M62A 2KR4A 2M1RA 2KGIA 1WENA 5H1TA 1HYJA 3MDBC 1WFKA 2IQJA 3LQJA 2VJFB 3PUQA 4OGEA 4A4BA 3QZVA 2VPBA 2KWKA 2L43A 1N87A 2LAUA 4A4CA 2M85A 2P57A 5B75A 4O62A 2DSMA 5B79A 3O37A 2RSDA 2ZETC 4UP5A 3KNVA 4L7XA 2YQMA 3NG2A 2LXHC 4WZ2A 2OXQC 3U5NA 4H9DA 1WEVA 2L7PA 1V87A 3SOUA 2E6RA 1X4JA 4IC3A 5G0FA 2ECJA 4S3OB 1MBMA 4LK9A 2FUIA 2OWAA 4L58A 2MIQA 3DPLR 4X3GA 3GV4A 4S3OC 4YC9A 3U5OA 5B8DA 2G43A 3O34A 4N4FA 3V43A 3T6RA 2YURA 2LV9A 4B7YC 4Q6FA 1X4IA 2CKLA 3HCSA 3N9OA 2CSVA 1WE9A 4CCGX 3N9LA 2BAYA 2I50A 2KYUA 2K17A 1WGMA 1IYMA 3KDEC 2QJ0A 4PPEA 1FBVA 2KU3A 3U5MA 3FJUB 1JM7A 4LLBA 3GL6A 2LQ6A 2EODA 1FP0A 5G05B 2AN6A 1CHCA 3PLWA 4R7EA 4WZ0A 3FAOA 3T7LA 3M99A 2F6NA 3ZNIA 5H1UA 2VJEA 3FANA 5TABA 3N9NA 2D8UA 2FFWA 3JUEA 4ZUXU 1WEMA 2EGMA 2VP7A 4PTBA 4B86C 2Y1MA 2XOZA 5FEYA 4QF3A 2H0DA 4O64A 3KV5A 3I2DA 2E6SA 4R2YA 2KWJA 3H7HA 1VFYA 2YW8A 1Z6UA 4YATA 1DCQA 3SHBA 4V3KC 2YVRA 3ZPVE 1WESA 2CT2A 5B76A 2HYED 3MHSA 2XP0A 2VPDA 3C5KA 4ZQLA 1U6GB 2JM3A 4CA1A 4LKAA 2ECGA 5SVXA 4AYCA 3ZVYA 4GNGA 4NN2A 2RI7A 5SVYA 2JMDA 4I7BA 2VPGA 1MM3A 2EXUA 4AYCB 2L0BA 1LDKC 3LRQA 2MUMA 4GB0A 2YSJA 3MHHA 3L1XA 4I7DA 4FIPA 5D1MB 4LJNA 2KKXA 5B78A 2CRWA 4YBSA 2YT5A 3O47A 2JRJA 4Z0OA 3O35A 1XWHA 5C11A 3Q1DA 3O33A 2Y43A 3U5PA 3N9MA 3HCUA 3SOWA 3DWDA 4WA6A 4BBQA 2VNFA 5FERA 4YBMA 2ECIA 3LJUX 2FD4A 2DJAA 2CKLB 2KGGA 3DQVR 1ZBDB 2LGVA 4Z0RA 2QICA 2LDRA 4FO9A 4QF2A 3HCTA 4P5OB 2ECNA 2JUNA 1WEEA 5LCWB 2LGLA 1T1HA 2MD7B 3FEHA 1E4UA 2K4DA 4MVTA 2XOCA 5I3LA 2NAAA 1JM7B 1F62A 4AVXA 3O70A 2EA6A 2DX8A 2PUYA 2YSMA 2XOYA 2FUUA 4UP0A 4WZ3B 2XB1A 5TRBA 3EB6A 2L80A 4AP4A 3HTKC 2LXPC 4BHWA 2VJEB 5LKZA 2F6JA 3SUBA 5LKXA 3E2DA 2B0OE 5AIUA 2M6MA 1WEQA 2XEUA 2KREA 4MSXA 3RTRB 3SOXA 1WEUA 3PURA 3L11A 1G25A 2ECTA 2KKYA 2G6QA 2MNYA 2H0DB 1WILA 2C2VS 2YQLA 3LVRE 5D1LB 1Z60A 2JMJA 5SVIA 2IDAA 5LKTA 2MNZA 4XI1A 3KV6A 2KWOA 2CONA 2VJFA 1BORA 3O36A 3LVQE 2KIZA 2C2LA 2MT5A 4W4UA 5FB0A 5K3QA 4YADA 5SVIB 3RPGB 2L5UA 2CSYA 4ZDTA 1K2FA 3ZYQA 4R8PK 2YHNA 1WEPA 3RPGC 4A0CD 5TDRA 3ZPV1 3PHDA 5AITA 3O7AA 2YU4A 4IC2A 2Y1NA 4C9ZA 2LN0A 2JMIA 2YYRA 2KWNA 2F42A 3LQHA 3M7KA 3IHPA 5D1KB 2RR4A 2CSZA 2UZGA 3ASLA 5KH3A 2M13A 2K16A 5H9MA 2MKEA 3L1ZB 4I7CA 2K1JA 1DVPA 2ECWA 4OGCA 5C13A 2QIZA 4AUQB 5EYAF 2YUCA 2CRRA 4TKPB 2LGGA 4QQ4A 2EGPA 3M63A 3LQIA 5TBNA 4UI9B 3N9QA 2FSAA 1VD4A 5KH9A 1VYXA 2G45A 2M3HA 2L75A 2MD8C 2MA6A 4GNFA 1MM2A 2LGKA 2YHOA 5DKAA 1Z2QA 4GNEA 3ZTGA 3FL2A 2D8SA 2KFTA 2E61A 4FK5A 3LDYA 2MA5A 1RMDA 2PNXA 4YBTA 4A49A 5TDWA 3N9PA 2YREA 4F52B 3VK6A 1WIMA 3FM8C 4YABA 3EB5A 3C6WA 1X4UA 1JOCA 5FB1A 1WEWA 1LDJB 5G04B 4YAXA
chains in the Genus database with same CATH topology
4LADB 5DINA 3ZVZB 5B77A 5JG6A 5H1VA 2KE1A 2VPEA 4V3LC 2ECVA 5J3XA 3KQIA 4FJCA 1HYIA 2HDPA 1WEOA 2LRIC 4GNDA 5LKUA 5KH7A 4N3WA 3M62A 2KR4A 2M1RA 2KGIA 1WENA 5H1TA 1HYJA 1WFKA 3LQJA 2VJFB 3PUQA 4A4BA 3QZVA 2VPBA 2KWKA 2L43A 1N87A 4A4CA 2M85A 5B75A 5B79A 3O37A 2RSDA 2ZETC 4UP5A 3KNVA 4L7XA 2YQMA 4WZ2A 3NG2A 2LXHC 2OXQC 3U5NA 1WEVA 1V87A 3SOUA 2E6RA 1X4JA 4IC3A 5G0FA 2ECJA 4S3OB 4LK9A 2FUIA 4L58A 2MIQA 3DPLR 4X3GA 3GV4A 4S3OC 4YC9A 3U5OA 5B8DA 2G43A 3O34A 4N4FA 3V43A 3T6RA 2YURA 2LV9A 4B7YC 4Q6FA 1X4IA 2CKLA 3HCSA 3N9OA 1WE9A 4CCGX 3N9LA 2BAYA 2I50A 2KYUA 2K17A 1WGMA 1IYMA 2QJ0A 4PPEA 1FBVA 2KU3A 3U5MA 1JM7A 4LLBA 3GL6A 2LQ6A 2EODA 1FP0A 5G05B 2AN6A 1CHCA 4R7EA 4WZ0A 3T7LA 3M99A 2F6NA 3ZNIA 5H1UA 2VJEA 5TABA 3N9NA 4ZUXU 1WEMA 2VP7A 4PTBA 4B86C 2Y1MA 5FEYA 4QF3A 2H0DA 4O64A 3KV5A 3I2DA 2E6SA 4R2YA 2KWJA 1VFYA 2YW8A 1Z6UA 4YATA 3SHBA 4V3KC 3ZPVE 1WESA 2CT2A 5B76A 2HYED 3MHSA 2VPDA 3C5KA 4ZQLA 1U6GB 4CA1A 4LKAA 2ECGA 4AYCA 3ZVYA 4GNGA 4NN2A 2RI7A 2JMDA 4I7BA 2VPGA 1MM3A 4AYCB 2L0BA 1LDKC 3LRQA 2MUMA 4GB0A 2YSJA 3MHHA 3L1XA 4I7DA 4FIPA 5D1MB 4LJNA 5B78A 4YBSA 2YT5A 2JRJA 3O35A 1XWHA 5C11A 3O33A 2Y43A 3U5PA 3N9MA 3HCUA 3SOWA 4WA6A 4BBQA 2VNFA 5FERA 4YBMA 2ECIA 2CKLB 2KGGA 3DQVR 1ZBDB 2LGVA 2QICA 2LDRA 4FO9A 4QF2A 3HCTA 4P5OB 2ECNA 1WEEA 5LCWB 2LGLA 1T1HA 2MD7B 1E4UA 2K4DA 4MVTA 5I3LA 2NAAA 1JM7B 1F62A 4AVXA 3O70A 2EA6A 2DX8A 2PUYA 2YSMA 2FUUA 4UP0A 4WZ3B 2XB1A 5TRBA 3EB6A 2L80A 4AP4A 3HTKC 2LXPC 4BHWA 2VJEB 5LKZA 2F6JA 5LKXA 5AIUA 2M6MA 1WEQA 2XEUA 2KREA 4MSXA 3RTRB 3SOXA 1WEUA 3PURA 3L11A 1G25A 2ECTA 2G6QA 2MNYA 2H0DB 1WILA 2C2VS 2YQLA 5D1LB 1Z60A 2JMJA 2IDAA 5LKTA 2MNZA 4XI1A 3KV6A 2KWOA 2VJFA 1BORA 3O36A 2KIZA 2C2LA 2MT5A 4W4UA 5FB0A 4YADA 3RPGB 2L5UA 2CSYA 4ZDTA 1K2FA 3ZYQA 4R8PK 2YHNA 1WEPA 3RPGC 4A0CD 5TDRA 3ZPV1 3PHDA 5AITA 3O7AA 2YU4A 4IC2A 2Y1NA 4C9ZA 2LN0A 2JMIA 2YYRA 2KWNA 2F42A 3LQHA 3IHPA 5D1KB 2CSZA 2UZGA 3ASLA 5KH3A 2K16A 5H9MA 3L1ZB 4I7CA 2K1JA 1DVPA 2ECWA 5C13A 2QIZA 4AUQB 5EYAF 2YUCA 4TKPB 2LGGA 2EGPA 3M63A 3LQIA 5TBNA 4UI9B 3N9QA 2FSAA 1VD4A 5KH9A 1VYXA 2G45A 2M3HA 2L75A 2MD8C 2MA6A 4GNFA 1MM2A 2LGKA 2YHOA 5DKAA 1Z2QA 4GNEA 3ZTGA 3FL2A 2D8SA 2KFTA 4FK5A 2MA5A 1RMDA 2PNXA 4YBTA 4A49A 5TDWA 3N9PA 2YREA 4F52B 3VK6A 1WIMA 4YABA 3EB5A 3C6WA 1X4UA 1JOCA 5FB1A 1WEWA 1LDJB 5G04B 4YAXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LAD B;  5DIN A;  3ZVZ B;  5B77 A;  5JG6 A;  5H1V A;  2KE1 A;  2VPE A;  4V3L C;  2ECV A;  5J3X A;  3KQI A;  4FJC A;  1HYI A;  2HDP A;  1WEO A;  2LRI C;  4GND A;  5LKU A;  5KH7 A;  4N3W A;  3M62 A;  2KR4 A;  2M1R A;  2KGI A;  1WEN A;  5H1T A;  1HYJ A;  1WFK A;  3LQJ A;  2VJF B;  3PUQ A;  4A4B A;  3QZV A;  2VPB A;  2KWK A;  2L43 A;  1N87 A;  4A4C A;  2M85 A;  5B75 A;  5B79 A;  3O37 A;  2RSD A;  2ZET C;  4UP5 A;  3KNV A;  4L7X A;  2YQM A;  4WZ2 A;  3NG2 A;  2LXH C;  2OXQ C;  3U5N A;  1WEV A;  1V87 A;  3SOU A;  2E6R A;  1X4J A;  4IC3 A;  5G0F A;  2ECJ A;  4S3O B;  4LK9 A;  2FUI A;  4L58 A;  2MIQ A;  3DPL R;  4X3G A;  3GV4 A;  4S3O C;  4YC9 A;  3U5O A;  5B8D A;  2G43 A;  3O34 A;  4N4F A;  3V43 A;  3T6R A;  2YUR A;  2LV9 A;  4B7Y C;  4Q6F A;  1X4I A;  2CKL A;  3HCS A;  3N9O A;  1WE9 A;  4CCG X;  3N9L A;  2BAY A;  2I50 A;  2KYU A;  2K17 A;  1WGM A;  1IYM A;  2QJ0 A;  4PPE A;  1FBV A;  2KU3 A;  3U5M A;  1JM7 A;  4LLB A;  3GL6 A;  2LQ6 A;  2EOD A;  1FP0 A;  5G05 B;  2AN6 A;  1CHC A;  4R7E A;  4WZ0 A;  3T7L A;  3M99 A;  2F6N A;  3ZNI A;  5H1U A;  2VJE A;  5TAB A;  3N9N A;  4ZUX U;  1WEM A;  2VP7 A;  4PTB A;  4B86 C;  2Y1M A;  5FEY A;  4QF3 A;  2H0D A;  4O64 A;  3KV5 A;  3I2D A;  2E6S A;  4R2Y A;  2KWJ A;  1VFY A;  2YW8 A;  1Z6U A;  4YAT A;  3SHB A;  4V3K C;  3ZPV E;  1WES A;  2CT2 A;  5B76 A;  2HYE D;  3MHS A;  2VPD A;  3C5K A;  4ZQL A;  1U6G B;  4CA1 A;  4LKA A;  2ECG A;  4AYC A;  3ZVY A;  4GNG A;  4NN2 A;  2RI7 A;  2JMD A;  4I7B A;  2VPG A;  1MM3 A;  4AYC B;  2L0B A;  1LDK C;  3LRQ A;  2MUM A;  4GB0 A;  2YSJ A;  3MHH A;  3L1X A;  4I7D A;  4FIP A;  5D1M B;  4LJN A;  5B78 A;  4YBS A;  2YT5 A;  2JRJ A;  3O35 A;  1XWH A;  5C11 A;  3O33 A;  2Y43 A;  3U5P A;  3N9M A;  3HCU A;  3SOW A;  4WA6 A;  4BBQ A;  2VNF A;  5FER A;  4YBM A;  2ECI A;  2CKL B;  2KGG A;  3DQV R;  1ZBD B;  2LGV A;  2QIC A;  2LDR A;  4FO9 A;  4QF2 A;  3HCT A;  4P5O B;  2ECN A;  1WEE A;  5LCW B;  2LGL A;  1T1H A;  2MD7 B;  1E4U A;  2K4D A;  4MVT A;  5I3L A;  2NAA A;  1JM7 B;  1F62 A;  4AVX A;  3O70 A;  2EA6 A;  2DX8 A;  2PUY A;  2YSM A;  2FUU A;  4UP0 A;  4WZ3 B;  2XB1 A;  5TRB A;  3EB6 A;  2L80 A;  4AP4 A;  3HTK C;  2LXP C;  4BHW A;  2VJE B;  5LKZ A;  2F6J A;  5LKX A;  5AIU A;  2M6M A;  1WEQ A;  2XEU A;  2KRE A;  4MSX A;  3RTR B;  3SOX A;  1WEU A;  3PUR A;  3L11 A;  1G25 A;  2ECT A;  2G6Q A;  2MNY A;  2H0D B;  1WIL A;  2C2V S;  2YQL A;  5D1L B;  1Z60 A;  2JMJ A;  2IDA A;  5LKT A;  2MNZ A;  4XI1 A;  3KV6 A;  2KWO A;  2VJF A;  1BOR A;  3O36 A;  2KIZ A;  2C2L A;  2MT5 A;  4W4U A;  5FB0 A;  4YAD A;  3RPG B;  2L5U A;  2CSY A;  4ZDT A;  1K2F A;  3ZYQ A;  4R8P K;  2YHN A;  1WEP A;  3RPG C;  4A0C D;  5TDR A;  3ZPV 1;  3PHD A;  5AIT A;  3O7A A;  2YU4 A;  4IC2 A;  2Y1N A;  4C9Z A;  2LN0 A;  2JMI A;  2YYR A;  2KWN A;  2F42 A;  3LQH A;  3IHP A;  5D1K B;  2CSZ A;  2UZG A;  3ASL A;  5KH3 A;  2K16 A;  5H9M A;  3L1Z B;  4I7C A;  2K1J A;  1DVP A;  2ECW A;  5C13 A;  2QIZ A;  4AUQ B;  5EYA F;  2YUC A;  4TKP B;  2LGG A;  2EGP A;  3M63 A;  3LQI A;  5TBN A;  4UI9 B;  3N9Q A;  2FSA A;  1VD4 A;  5KH9 A;  1VYX A;  2G45 A;  2M3H A;  2L75 A;  2MD8 C;  2MA6 A;  4GNF A;  1MM2 A;  2LGK A;  2YHO A;  5DKA A;  1Z2Q A;  4GNE A;  3ZTG A;  3FL2 A;  2D8S A;  2KFT A;  4FK5 A;  2MA5 A;  1RMD A;  2PNX A;  4YBT A;  4A49 A;  5TDW A;  3N9P A;  2YRE A;  4F52 B;  3VK6 A;  1WIM A;  4YAB A;  3EB5 A;  3C6W A;  1X4U A;  1JOC A;  5FB1 A;  1WEW A;  1LDJ B;  5G04 B;  4YAX A; 
#chains in the Genus database with same CATH topology
 4LAD B;  3T9K A;  5DIN A;  3ZVZ B;  5B77 A;  5JG6 A;  5H1V A;  2KE1 A;  2VPE A;  4V3L C;  2ECV A;  5J3X A;  3KQI A;  4FJC A;  1HYI A;  2HDP A;  1WEO A;  2LRI C;  3DDT A;  4GND A;  4F1P A;  5LKU A;  5KH7 A;  4N3W A;  3M62 A;  2KR4 A;  2M1R A;  2KGI A;  1WEN A;  5H1T A;  1HYJ A;  3MDB C;  1WFK A;  2IQJ A;  3LQJ A;  2VJF B;  3PUQ A;  4OGE A;  4A4B A;  3QZV A;  2VPB A;  2KWK A;  2L43 A;  1N87 A;  2LAU A;  4A4C A;  2M85 A;  2P57 A;  5B75 A;  4O62 A;  2DSM A;  5B79 A;  3O37 A;  2RSD A;  2ZET C;  4UP5 A;  3KNV A;  4L7X A;  2YQM A;  3NG2 A;  2LXH C;  4WZ2 A;  2OXQ C;  3U5N A;  4H9D A;  1WEV A;  2L7P A;  1V87 A;  3SOU A;  2E6R A;  1X4J A;  4IC3 A;  5G0F A;  2ECJ A;  4S3O B;  1MBM A;  4LK9 A;  2FUI A;  2OWA A;  4L58 A;  2MIQ A;  3DPL R;  4X3G A;  3GV4 A;  4S3O C;  4YC9 A;  3U5O A;  5B8D A;  2G43 A;  3O34 A;  4N4F A;  3V43 A;  3T6R A;  2YUR A;  2LV9 A;  4B7Y C;  4Q6F A;  1X4I A;  2CKL A;  3HCS A;  3N9O A;  2CSV A;  1WE9 A;  4CCG X;  3N9L A;  2BAY A;  2I50 A;  2KYU A;  2K17 A;  1WGM A;  1IYM A;  3KDE C;  2QJ0 A;  4PPE A;  1FBV A;  2KU3 A;  3U5M A;  3FJU B;  1JM7 A;  4LLB A;  3GL6 A;  2LQ6 A;  2EOD A;  1FP0 A;  5G05 B;  2AN6 A;  1CHC A;  3PLW A;  4R7E A;  4WZ0 A;  3FAO A;  3T7L A;  3M99 A;  2F6N A;  3ZNI A;  5H1U A;  2VJE A;  3FAN A;  5TAB A;  3N9N A;  2D8U A;  2FFW A;  3JUE A;  4ZUX U;  1WEM A;  2EGM A;  2VP7 A;  4PTB A;  4B86 C;  2Y1M A;  2XOZ A;  5FEY A;  4QF3 A;  2H0D A;  4O64 A;  3KV5 A;  3I2D A;  2E6S A;  4R2Y A;  2KWJ A;  3H7H A;  1VFY A;  2YW8 A;  1Z6U A;  4YAT A;  1DCQ A;  3SHB A;  4V3K C;  2YVR A;  3ZPV E;  1WES A;  2CT2 A;  5B76 A;  2HYE D;  3MHS A;  2XP0 A;  2VPD A;  3C5K A;  4ZQL A;  1U6G B;  2JM3 A;  4CA1 A;  4LKA A;  2ECG A;  5SVX A;  4AYC A;  3ZVY A;  4GNG A;  4NN2 A;  2RI7 A;  5SVY A;  2JMD A;  4I7B A;  2VPG A;  1MM3 A;  2EXU A;  4AYC B;  2L0B A;  1LDK C;  3LRQ A;  2MUM A;  4GB0 A;  2YSJ A;  3MHH A;  3L1X A;  4I7D A;  4FIP A;  5D1M B;  4LJN A;  2KKX A;  5B78 A;  2CRW A;  4YBS A;  2YT5 A;  3O47 A;  2JRJ A;  4Z0O A;  3O35 A;  1XWH A;  5C11 A;  3Q1D A;  3O33 A;  2Y43 A;  3U5P A;  3N9M A;  3HCU A;  3SOW A;  3DWD A;  4WA6 A;  4BBQ A;  2VNF A;  5FER A;  4YBM A;  2ECI A;  3LJU X;  2FD4 A;  2DJA A;  2CKL B;  2KGG A;  3DQV R;  1ZBD B;  2LGV A;  4Z0R A;  2QIC A;  2LDR A;  4FO9 A;  4QF2 A;  3HCT A;  4P5O B;  2ECN A;  2JUN A;  1WEE A;  5LCW B;  2LGL A;  1T1H A;  2MD7 B;  3FEH A;  1E4U A;  2K4D A;  4MVT A;  2XOC A;  5I3L A;  2NAA A;  1JM7 B;  1F62 A;  4AVX A;  3O70 A;  2EA6 A;  2DX8 A;  2PUY A;  2YSM A;  2XOY A;  2FUU A;  4UP0 A;  4WZ3 B;  2XB1 A;  5TRB A;  3EB6 A;  2L80 A;  4AP4 A;  3HTK C;  2LXP C;  4BHW A;  2VJE B;  5LKZ A;  2F6J A;  3SUB A;  5LKX A;  3E2D A;  2B0O E;  5AIU A;  2M6M A;  1WEQ A;  2XEU A;  2KRE A;  4MSX A;  3RTR B;  3SOX A;  1WEU A;  3PUR A;  3L11 A;  1G25 A;  2ECT A;  2KKY A;  2G6Q A;  2MNY A;  2H0D B;  1WIL A;  2C2V S;  2YQL A;  3LVR E;  5D1L B;  1Z60 A;  2JMJ A;  5SVI A;  2IDA A;  5LKT A;  2MNZ A;  4XI1 A;  3KV6 A;  2KWO A;  2CON A;  2VJF A;  1BOR A;  3O36 A;  3LVQ E;  2KIZ A;  2C2L A;  2MT5 A;  4W4U A;  5FB0 A;  5K3Q A;  4YAD A;  5SVI B;  3RPG B;  2L5U A;  2CSY A;  4ZDT A;  1K2F A;  3ZYQ A;  4R8P K;  2YHN A;  1WEP A;  3RPG C;  4A0C D;  5TDR A;  3ZPV 1;  3PHD A;  5AIT A;  3O7A A;  2YU4 A;  4IC2 A;  2Y1N A;  4C9Z A;  2LN0 A;  2JMI A;  2YYR A;  2KWN A;  2F42 A;  3LQH A;  3M7K A;  3IHP A;  5D1K B;  2RR4 A;  2CSZ A;  2UZG A;  3ASL A;  5KH3 A;  2M13 A;  2K16 A;  5H9M A;  2MKE A;  3L1Z B;  4I7C A;  2K1J A;  1DVP A;  2ECW A;  4OGC A;  5C13 A;  2QIZ A;  4AUQ B;  5EYA F;  2YUC A;  2CRR A;  4TKP B;  2LGG A;  4QQ4 A;  2EGP A;  3M63 A;  3LQI A;  5TBN A;  4UI9 B;  3N9Q A;  2FSA A;  1VD4 A;  5KH9 A;  1VYX A;  2G45 A;  2M3H A;  2L75 A;  2MD8 C;  2MA6 A;  4GNF A;  1MM2 A;  2LGK A;  2YHO A;  5DKA A;  1Z2Q A;  4GNE A;  3ZTG A;  3FL2 A;  2D8S A;  2KFT A;  2E61 A;  4FK5 A;  3LDY A;  2MA5 A;  1RMD A;  2PNX A;  4YBT A;  4A49 A;  5TDW A;  3N9P A;  2YRE A;  4F52 B;  3VK6 A;  1WIM A;  3FM8 C;  4YAB A;  3EB5 A;  3C6W A;  1X4U A;  1JOC A;  5FB1 A;  1WEW A;  1LDJ B;  5G04 B;  4YAX A; 
#chains in the Genus database with same CATH homology
 4LAD B;  5DIN A;  3ZVZ B;  5B77 A;  5JG6 A;  5H1V A;  2KE1 A;  2VPE A;  4V3L C;  2ECV A;  5J3X A;  3KQI A;  4FJC A;  1HYI A;  2HDP A;  1WEO A;  2LRI C;  4GND A;  5LKU A;  5KH7 A;  4N3W A;  3M62 A;  2KR4 A;  2M1R A;  2KGI A;  1WEN A;  5H1T A;  1HYJ A;  1WFK A;  3LQJ A;  2VJF B;  3PUQ A;  4A4B A;  3QZV A;  2VPB A;  2KWK A;  2L43 A;  1N87 A;  4A4C A;  2M85 A;  5B75 A;  5B79 A;  3O37 A;  2RSD A;  2ZET C;  4UP5 A;  3KNV A;  4L7X A;  2YQM A;  4WZ2 A;  3NG2 A;  2LXH C;  2OXQ C;  3U5N A;  1WEV A;  1V87 A;  3SOU A;  2E6R A;  1X4J A;  4IC3 A;  5G0F A;  2ECJ A;  4S3O B;  4LK9 A;  2FUI A;  4L58 A;  2MIQ A;  3DPL R;  4X3G A;  3GV4 A;  4S3O C;  4YC9 A;  3U5O A;  5B8D A;  2G43 A;  3O34 A;  4N4F A;  3V43 A;  3T6R A;  2YUR A;  2LV9 A;  4B7Y C;  4Q6F A;  1X4I A;  2CKL A;  3HCS A;  3N9O A;  1WE9 A;  4CCG X;  3N9L A;  2BAY A;  2I50 A;  2KYU A;  2K17 A;  1WGM A;  1IYM A;  2QJ0 A;  4PPE A;  1FBV A;  2KU3 A;  3U5M A;  1JM7 A;  4LLB A;  3GL6 A;  2LQ6 A;  2EOD A;  1FP0 A;  5G05 B;  2AN6 A;  1CHC A;  4R7E A;  4WZ0 A;  3T7L A;  3M99 A;  2F6N A;  3ZNI A;  5H1U A;  2VJE A;  5TAB A;  3N9N A;  4ZUX U;  1WEM A;  2VP7 A;  4PTB A;  4B86 C;  2Y1M A;  5FEY A;  4QF3 A;  2H0D A;  4O64 A;  3KV5 A;  3I2D A;  2E6S A;  4R2Y A;  2KWJ A;  1VFY A;  2YW8 A;  1Z6U A;  4YAT A;  3SHB A;  4V3K C;  3ZPV E;  1WES A;  2CT2 A;  5B76 A;  2HYE D;  3MHS A;  2VPD A;  3C5K A;  4ZQL A;  1U6G B;  4CA1 A;  4LKA A;  2ECG A;  4AYC A;  3ZVY A;  4GNG A;  4NN2 A;  2RI7 A;  2JMD A;  4I7B A;  2VPG A;  1MM3 A;  4AYC B;  2L0B A;  1LDK C;  3LRQ A;  2MUM A;  4GB0 A;  2YSJ A;  3MHH A;  3L1X A;  4I7D A;  4FIP A;  5D1M B;  4LJN A;  5B78 A;  4YBS A;  2YT5 A;  2JRJ A;  3O35 A;  1XWH A;  5C11 A;  3O33 A;  2Y43 A;  3U5P A;  3N9M A;  3HCU A;  3SOW A;  4WA6 A;  4BBQ A;  2VNF A;  5FER A;  4YBM A;  2ECI A;  2CKL B;  2KGG A;  3DQV R;  1ZBD B;  2LGV A;  2QIC A;  2LDR A;  4FO9 A;  4QF2 A;  3HCT A;  4P5O B;  2ECN A;  1WEE A;  5LCW B;  2LGL A;  1T1H A;  2MD7 B;  1E4U A;  2K4D A;  4MVT A;  5I3L A;  2NAA A;  1JM7 B;  1F62 A;  4AVX A;  3O70 A;  2EA6 A;  2DX8 A;  2PUY A;  2YSM A;  2FUU A;  4UP0 A;  4WZ3 B;  2XB1 A;  5TRB A;  3EB6 A;  2L80 A;  4AP4 A;  3HTK C;  2LXP C;  4BHW A;  2VJE B;  5LKZ A;  2F6J A;  5LKX A;  5AIU A;  2M6M A;  1WEQ A;  2XEU A;  2KRE A;  4MSX A;  3RTR B;  3SOX A;  1WEU A;  3PUR A;  3L11 A;  1G25 A;  2ECT A;  2G6Q A;  2MNY A;  2H0D B;  1WIL A;  2C2V S;  2YQL A;  5D1L B;  1Z60 A;  2JMJ A;  2IDA A;  5LKT A;  2MNZ A;  4XI1 A;  3KV6 A;  2KWO A;  2VJF A;  1BOR A;  3O36 A;  2KIZ A;  2C2L A;  2MT5 A;  4W4U A;  5FB0 A;  4YAD A;  3RPG B;  2L5U A;  2CSY A;  4ZDT A;  1K2F A;  3ZYQ A;  4R8P K;  2YHN A;  1WEP A;  3RPG C;  4A0C D;  5TDR A;  3ZPV 1;  3PHD A;  5AIT A;  3O7A A;  2YU4 A;  4IC2 A;  2Y1N A;  4C9Z A;  2LN0 A;  2JMI A;  2YYR A;  2KWN A;  2F42 A;  3LQH A;  3IHP A;  5D1K B;  2CSZ A;  2UZG A;  3ASL A;  5KH3 A;  2K16 A;  5H9M A;  3L1Z B;  4I7C A;  2K1J A;  1DVP A;  2ECW A;  5C13 A;  2QIZ A;  4AUQ B;  5EYA F;  2YUC A;  4TKP B;  2LGG A;  2EGP A;  3M63 A;  3LQI A;  5TBN A;  4UI9 B;  3N9Q A;  2FSA A;  1VD4 A;  5KH9 A;  1VYX A;  2G45 A;  2M3H A;  2L75 A;  2MD8 C;  2MA6 A;  4GNF A;  1MM2 A;  2LGK A;  2YHO A;  5DKA A;  1Z2Q A;  4GNE A;  3ZTG A;  3FL2 A;  2D8S A;  2KFT A;  4FK5 A;  2MA5 A;  1RMD A;  2PNX A;  4YBT A;  4A49 A;  5TDW A;  3N9P A;  2YRE A;  4F52 B;  3VK6 A;  1WIM A;  4YAB A;  3EB5 A;  3C6W A;  1X4U A;  1JOC A;  5FB1 A;  1WEW A;  1LDJ B;  5G04 B;  4YAX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...