2QICA

Crystal structure of the ing1 phd finger in complex with a histone h3k4me3 peptide
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
51
structure length
51
Chain Sequence
EPTYCLCNQVSYGEMIGCDNDECPIEWFHFSCVGLNHKPKGKWYCPKCRGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Inhibitor of growth protein 1
publication title Histone H3K4me3 binding is required for the DNA repair and apoptotic activities of ING1 tumor suppressor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Antitumor protein, apoptosis
total genus 8
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 2007-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2qicA00
2HDPA 2CKLB 5TRBA 3FL2A 4FJCA 4NN2A 1LDKC 1X4UA 2KWJA 2FUUA 2LXHC 1WEOA 3HCSA 2H0DB 3N9NA 4LJNA 3LQHA 4FO9A 4CCGX 2M3HA 1JM7B 3IHPA 4L7XA 5FB0A 2L80A 4IC3A 2L43A 4S3OC 2C2VS 2MA5A 3N9PA 4LK9A 3MHSA 2QJ0A 2KE1A 3O37A 2QICA 3O33A 3O70A 2VJFA 1K2FA 1WILA 3ZNIA 3HCUA 2VPEA 5LKUA 2KFTA 4YABA 4B7YC 2E6SA 4R2YA 2VNFA 2YW8A 2RI7A 4R8PK 3LQIA 2YUCA 4YATA 5B8DA 1DVPA 2EA6A 3N9OA 2ECJA 3N9QA 1VD4A 3T7LA 4F52B 4I7BA 5B78A 2LGKA 2YQLA 1WEPA 3N9MA 4I7CA 1FBVA 3ZVYA 1HYIA 4C9ZA 2KWOA 1X4IA 2YREA 3ZPV1 3L11A 2K1JA 2KWNA 2L0BA 3M62A 2L75A 4O64A 4A49A 5KH9A 3LRQA 2G45A 5H1VA 2ECVA 3ASLA 2YYRA 1F62A 3U5PA 2PUYA 3EB5A 2VPBA 4QF2A 1MM3A 5G0FA 3RTRB 2LGVA 4ZQLA 2YURA 3KV5A 5C11A 4V3KC 1XWHA 2CSYA 3SOUA 4PPEA 2ZETC 4ZDTA 2IDAA 2CT2A 5KH7A 5D1MB 5EYAF 2KGGA 5TBNA 5DINA 2I50A 1WEQA 3C6WA 4IC2A 3V43A 5TDRA 3C5KA 2JRJA 2XB1A 2VPDA 1WEVA 1WEMA 3QZVA 2MA6A 4AYCB 4YBSA 4YBMA 5FB1A 4LLBA 4W4UA 1CHCA 3O36A 4GB0A 2YSJA 4L58A 3VK6A 2MD7B 5AITA 2LGLA 2K17A 2VJEB 4A0CD 2ECWA 5B76A 2EGPA 2F6NA 1Z60A 2Y1NA 5LKZA 3KNVA 4FK5A 4YADA 5H1TA 2RSDA 3DPLR 5C13A 5DKAA 4PTBA 4A4CA 2Y43A 5B75A 2E6RA 5G04B 2LRIC 2NAAA 2XEUA 5FEYA 3ZTGA 2AN6A 4WA6A 5G05B 4I7DA 1MM2A 4UP0A 2PNXA 2LXPC 2MUMA 1HYJA 2F6JA 1FP0A 4FIPA 4YAXA 4YBTA 5LKXA 2KYUA 4ZUXU 2G43A 2KIZA 4LADB 4Q6FA 3SOWA 2OXQC 1U6GB 1WENA 4P5OB 1VFYA 2CKLA 2G6QA 3O35A 5H9MA 2DX8A 2C2LA 2ECGA 2H0DA 5D1KB 2EODA 4WZ3B 3N9LA 4V3LC 1WE9A 3U5MA 1Z2QA 1JM7A 1RMDA 3PURA 2JMIA 2LV9A 2D8SA 3KV6A 3LQJA 2YHNA 3RPGC 5FERA 1WEEA 4AUQB 2YU4A 1VYXA 4AYCA 2KU3A 3ZPVE 2L5UA 2JMDA 3O34A 1X4JA 3SHBA 2CSZA 2MNZA 4A4BA 4YC9A 3PUQA 4GNFA 4CA1A 2MIQA 1WEUA 2YT5A 1V87A 2QIZA 2KGIA 5LCWB 2MT5A 5I3LA 4GNDA 1T1HA 3HCTA 1JOCA 2M6MA 3U5OA 1IYMA 3L1XA 2ECNA 2Y1MA 4N3WA 5AIUA 4LKAA 4BHWA 5B77A 1LDJB 4MSXA 5D1LB 3T6RA 2M1RA 1WEWA 4S3OB 5J3XA 4B86C 5H1UA 1E4UA 1WIMA 3KQIA 2VP7A 2ECIA 3GV4A 5KH3A 3I2DA 2LDRA 4UI9B 4WZ0A 4AVXA 2HYED 3NG2A 1WGMA 5JG6A 2MNYA 3DQVR 4R7EA 3HTKC 3U5NA 2LN0A 2YQMA 5LKTA 1G25A 4TKPB 2KWKA 3PHDA 4WZ2A 4AP4A 4X3GA 4XI1A 1WESA 4GNGA 3M99A 2MD8C 1ZBDB 2VJFB 2VPGA 3SOXA 3L1ZB 3M63A 4N4FA 4MVTA 3ZYQA 2UZGA 4QF3A 2LQ6A 2FUIA 3MHHA 2ECTA 4GNEA 1Z6UA 3EB6A 4BBQA 2BAYA 5TABA 2LGGA 5B79A 2YHOA 1BORA 5TDWA 1N87A 1WFKA 3O7AA 2KREA 2K4DA 2FSAA 2JMJA 2M85A 3GL6A 2K16A 2KR4A 2YSMA 4UP5A 2F42A 3ZVZB 3RPGB 2VJEA
chains in the Genus database with same CATH superfamily
2HDPA 2CKLB 5TRBA 3FL2A 3JUEA 4FJCA 4NN2A 1LDKC 1X4UA 2KWJA 2FUUA 2LXHC 1WEOA 3HCSA 2H0DB 3N9NA 4LJNA 3LQHA 4FO9A 4CCGX 2M3HA 1JM7B 3IHPA 4L7XA 5FB0A 2L80A 4IC3A 2L43A 4S3OC 2C2VS 4O62A 2MA5A 3N9PA 4LK9A 5SVIA 3MHSA 2QJ0A 2KE1A 3O37A 3T9KA 2QICA 3O33A 3O70A 2VJFA 1K2FA 1WILA 3ZNIA 3HCUA 2VPEA 5LKUA 2KFTA 4YABA 4B7YC 2E6SA 4R2YA 2VNFA 2YW8A 2RI7A 4R8PK 3LQIA 2DJAA 2YUCA 4YATA 5B8DA 1DVPA 2EA6A 3N9OA 2ECJA 3N9QA 1VD4A 3T7LA 4F52B 4I7BA 5B78A 4OGCA 2LGKA 2YQLA 3M7KA 1WEPA 3N9MA 4I7CA 1FBVA 3ZVYA 3H7HA 2IQJA 5K3QA 1HYIA 4C9ZA 3LVQE 2KWOA 1X4IA 2E61A 3KDEC 2YREA 3ZPV1 3L11A 2K1JA 1DCQA 2KWNA 2L0BA 3M62A 2CSVA 2L75A 4O64A 4A49A 5KH9A 2CRWA 3LRQA 4F1PA 2G45A 5H1VA 2EXUA 2ECVA 3ASLA 2YYRA 1F62A 3U5PA 2PUYA 3DWDA 3EB5A 2VPBA 4QF2A 1MM3A 5G0FA 3RTRB 2LGVA 5SVXA 4ZQLA 2YURA 3O47A 3KV5A 5C11A 4V3KC 1XWHA 2CSYA 3SOUA 4PPEA 2ZETC 4ZDTA 3LJUX 2IDAA 3E2DA 2CT2A 5KH7A 5D1MB 5EYAF 2EGMA 2KGGA 5TBNA 5DINA 4H9DA 2I50A 1WEQA 3C6WA 4IC2A 3V43A 5TDRA 3C5KA 2JRJA 2FD4A 2XB1A 2VPDA 1WEVA 1WEMA 3QZVA 2D8UA 2MA6A 4AYCB 4YBSA 4YBMA 5FB1A 4LLBA 4W4UA 1CHCA 3O36A 4GB0A 2YSJA 4L58A 4QQ4A 3VK6A 2MD7B 5AITA 2LGLA 2K17A 2VJEB 4A0CD 2ECWA 3FAOA 5B76A 2EGPA 2F6NA 1Z60A 2Y1NA 5LKZA 3KNVA 4FK5A 4YADA 5H1TA 2RSDA 3DPLR 5C13A 5DKAA 2L7PA 4PTBA 4A4CA 2Y43A 5B75A 2E6RA 5G04B 2LRIC 2NAAA 2XEUA 5FEYA 3ZTGA 2AN6A 4WA6A 5G05B 4I7DA 2OWAA 2XOZA 1MM2A 4UP0A 2PNXA 2LXPC 2MUMA 1HYJA 2F6JA 1FP0A 4FIPA 4YAXA 4YBTA 5LKXA 2KYUA 4ZUXU 2G43A 2KIZA 5SVIB 3FANA 4LADB 4Q6FA 3SOWA 2OXQC 2YVRA 1U6GB 1WENA 4P5OB 1VFYA 2CKLA 2G6QA 3O35A 4OGEA 5H9MA 2DX8A 2C2LA 2ECGA 2H0DA 5D1KB 2EODA 4WZ3B 3N9LA 4V3LC 1WE9A 3U5MA 1Z2QA 2RR4A 1JM7A 1RMDA 3PURA 2JMIA 2LV9A 2D8SA 3KV6A 3LQJA 2YHNA 3RPGC 5FERA 1WEEA 4AUQB 2YU4A 1VYXA 4Z0RA 4AYCA 2KU3A 3ZPVE 2L5UA 3Q1DA 2JMDA 3O34A 1X4JA 3SHBA 2CSZA 2MNZA 2FFWA 4A4BA 2MKEA 4YC9A 3PUQA 4GNFA 4CA1A 2MIQA 1WEUA 2YT5A 1V87A 2QIZA 2KGIA 2M13A 5LCWB 2XOCA 2MT5A 5I3LA 4GNDA 3FEHA 1T1HA 3HCTA 1JOCA 2M6MA 3U5OA 1IYMA 2CRRA 2ECNA 3L1XA 2Y1MA 3PLWA 4N3WA 3MDBC 4LKAA 5AIUA 4BHWA 5B77A 1LDJB 4MSXA 5D1LB 3T6RA 2M1RA 1WEWA 3FJUB 4S3OB 5J3XA 4B86C 5H1UA 4Z0OA 1E4UA 1WIMA 3KQIA 2VP7A 2ECIA 3GV4A 5KH3A 3I2DA 2XP0A 2LDRA 4UI9B 4WZ0A 3FM8C 4AVXA 2HYED 3NG2A 1WGMA 2DSMA 5JG6A 5SVYA 2MNYA 3DQVR 4R7EA 3HTKC 3U5NA 3LDYA 2LN0A 2YQMA 5LKTA 1G25A 4TKPB 2CONA 3DDTA 2KWKA 2JUNA 3PHDA 4WZ2A 4AP4A 4X3GA 3SUBA 4XI1A 1WESA 4GNGA 3M99A 2MD8C 1ZBDB 2VJFB 2B0OE 2VPGA 3SOXA 3L1ZB 3M63A 4N4FA 4MVTA 3ZYQA 2UZGA 4QF3A 2XOYA 2LQ6A 2KKYA 2FUIA 3MHHA 2ECTA 4GNEA 1Z6UA 3EB6A 4BBQA 2BAYA 5TABA 2LGGA 5B79A 2YHOA 1BORA 5TDWA 2JM3A 1N87A 1WFKA 3O7AA 2KREA 2K4DA 3LVRE 2FSAA 2JMJA 2M85A 1MBMA 3GL6A 2K16A 2KKXA 2KR4A 2YSMA 4UP5A 2LAUA 2P57A 2F42A 3ZVZB 3RPGB 2VJEA
chains in the Genus database with same CATH topology
2HDPA 2CKLB 5TRBA 3FL2A 4FJCA 4NN2A 1LDKC 1X4UA 2KWJA 2FUUA 2LXHC 1WEOA 3HCSA 2H0DB 3N9NA 4LJNA 3LQHA 4FO9A 4CCGX 2M3HA 1JM7B 3IHPA 4L7XA 5FB0A 2L80A 4IC3A 2L43A 4S3OC 2C2VS 2MA5A 3N9PA 4LK9A 3MHSA 2QJ0A 2KE1A 3O37A 2QICA 3O33A 3O70A 2VJFA 1K2FA 1WILA 3ZNIA 3HCUA 2VPEA 5LKUA 2KFTA 4YABA 4B7YC 2E6SA 4R2YA 2VNFA 2YW8A 2RI7A 4R8PK 3LQIA 2YUCA 4YATA 5B8DA 1DVPA 2EA6A 3N9OA 2ECJA 3N9QA 1VD4A 3T7LA 4F52B 4I7BA 5B78A 2LGKA 2YQLA 1WEPA 3N9MA 4I7CA 1FBVA 3ZVYA 1HYIA 4C9ZA 2KWOA 1X4IA 2YREA 3ZPV1 3L11A 2K1JA 2KWNA 2L0BA 3M62A 2L75A 4O64A 4A49A 5KH9A 3LRQA 2G45A 5H1VA 2ECVA 3ASLA 2YYRA 1F62A 3U5PA 2PUYA 3EB5A 2VPBA 4QF2A 1MM3A 5G0FA 3RTRB 2LGVA 4ZQLA 2YURA 3KV5A 5C11A 4V3KC 1XWHA 2CSYA 3SOUA 4PPEA 2ZETC 4ZDTA 2IDAA 2CT2A 5KH7A 5D1MB 5EYAF 2KGGA 5TBNA 5DINA 2I50A 1WEQA 3C6WA 4IC2A 3V43A 5TDRA 3C5KA 2JRJA 2XB1A 2VPDA 1WEVA 1WEMA 3QZVA 2MA6A 4AYCB 4YBSA 4YBMA 5FB1A 4LLBA 4W4UA 1CHCA 3O36A 4GB0A 2YSJA 4L58A 3VK6A 2MD7B 5AITA 2LGLA 2K17A 2VJEB 4A0CD 2ECWA 5B76A 2EGPA 2F6NA 1Z60A 2Y1NA 5LKZA 3KNVA 4FK5A 4YADA 5H1TA 2RSDA 3DPLR 5C13A 5DKAA 4PTBA 4A4CA 2Y43A 5B75A 2E6RA 5G04B 2LRIC 2NAAA 2XEUA 5FEYA 3ZTGA 2AN6A 4WA6A 5G05B 4I7DA 1MM2A 4UP0A 2PNXA 2LXPC 2MUMA 1HYJA 2F6JA 1FP0A 4FIPA 4YAXA 4YBTA 5LKXA 2KYUA 4ZUXU 2G43A 2KIZA 4LADB 4Q6FA 3SOWA 2OXQC 1U6GB 1WENA 4P5OB 1VFYA 2CKLA 2G6QA 3O35A 5H9MA 2DX8A 2C2LA 2ECGA 2H0DA 5D1KB 2EODA 4WZ3B 3N9LA 4V3LC 1WE9A 3U5MA 1Z2QA 1JM7A 1RMDA 3PURA 2JMIA 2LV9A 2D8SA 3KV6A 3LQJA 2YHNA 3RPGC 5FERA 1WEEA 4AUQB 2YU4A 1VYXA 4AYCA 2KU3A 3ZPVE 2L5UA 2JMDA 3O34A 1X4JA 3SHBA 2CSZA 2MNZA 4A4BA 4YC9A 3PUQA 4GNFA 4CA1A 2MIQA 1WEUA 2YT5A 1V87A 2QIZA 2KGIA 5LCWB 2MT5A 5I3LA 4GNDA 1T1HA 3HCTA 1JOCA 2M6MA 3U5OA 1IYMA 3L1XA 2ECNA 2Y1MA 4N3WA 5AIUA 4LKAA 4BHWA 5B77A 1LDJB 4MSXA 5D1LB 3T6RA 2M1RA 1WEWA 4S3OB 5J3XA 4B86C 5H1UA 1E4UA 1WIMA 3KQIA 2VP7A 2ECIA 3GV4A 5KH3A 3I2DA 2LDRA 4UI9B 4WZ0A 4AVXA 2HYED 3NG2A 1WGMA 5JG6A 2MNYA 3DQVR 4R7EA 3HTKC 3U5NA 2LN0A 2YQMA 5LKTA 1G25A 4TKPB 2KWKA 3PHDA 4WZ2A 4AP4A 4X3GA 4XI1A 1WESA 4GNGA 3M99A 2MD8C 1ZBDB 2VJFB 2VPGA 3SOXA 3L1ZB 3M63A 4N4FA 4MVTA 3ZYQA 2UZGA 4QF3A 2LQ6A 2FUIA 3MHHA 2ECTA 4GNEA 1Z6UA 3EB6A 4BBQA 2BAYA 5TABA 2LGGA 5B79A 2YHOA 1BORA 5TDWA 1N87A 1WFKA 3O7AA 2KREA 2K4DA 2FSAA 2JMJA 2M85A 3GL6A 2K16A 2KR4A 2YSMA 4UP5A 2F42A 3ZVZB 3RPGB 2VJEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HDP A;  2CKL B;  5TRB A;  3FL2 A;  4FJC A;  4NN2 A;  1LDK C;  1X4U A;  2KWJ A;  2FUU A;  2LXH C;  1WEO A;  3HCS A;  2H0D B;  3N9N A;  4LJN A;  3LQH A;  4FO9 A;  4CCG X;  2M3H A;  1JM7 B;  3IHP A;  4L7X A;  5FB0 A;  2L80 A;  4IC3 A;  2L43 A;  4S3O C;  2C2V S;  2MA5 A;  3N9P A;  4LK9 A;  3MHS A;  2QJ0 A;  2KE1 A;  3O37 A;  2QIC A;  3O33 A;  3O70 A;  2VJF A;  1K2F A;  1WIL A;  3ZNI A;  3HCU A;  2VPE A;  5LKU A;  2KFT A;  4YAB A;  4B7Y C;  2E6S A;  4R2Y A;  2VNF A;  2YW8 A;  2RI7 A;  4R8P K;  3LQI A;  2YUC A;  4YAT A;  5B8D A;  1DVP A;  2EA6 A;  3N9O A;  2ECJ A;  3N9Q A;  1VD4 A;  3T7L A;  4F52 B;  4I7B A;  5B78 A;  2LGK A;  2YQL A;  1WEP A;  3N9M A;  4I7C A;  1FBV A;  3ZVY A;  1HYI A;  4C9Z A;  2KWO A;  1X4I A;  2YRE A;  3ZPV 1;  3L11 A;  2K1J A;  2KWN A;  2L0B A;  3M62 A;  2L75 A;  4O64 A;  4A49 A;  5KH9 A;  3LRQ A;  2G45 A;  5H1V A;  2ECV A;  3ASL A;  2YYR A;  1F62 A;  3U5P A;  2PUY A;  3EB5 A;  2VPB A;  4QF2 A;  1MM3 A;  5G0F A;  3RTR B;  2LGV A;  4ZQL A;  2YUR A;  3KV5 A;  5C11 A;  4V3K C;  1XWH A;  2CSY A;  3SOU A;  4PPE A;  2ZET C;  4ZDT A;  2IDA A;  2CT2 A;  5KH7 A;  5D1M B;  5EYA F;  2KGG A;  5TBN A;  5DIN A;  2I50 A;  1WEQ A;  3C6W A;  4IC2 A;  3V43 A;  5TDR A;  3C5K A;  2JRJ A;  2XB1 A;  2VPD A;  1WEV A;  1WEM A;  3QZV A;  2MA6 A;  4AYC B;  4YBS A;  4YBM A;  5FB1 A;  4LLB A;  4W4U A;  1CHC A;  3O36 A;  4GB0 A;  2YSJ A;  4L58 A;  3VK6 A;  2MD7 B;  5AIT A;  2LGL A;  2K17 A;  2VJE B;  4A0C D;  2ECW A;  5B76 A;  2EGP A;  2F6N A;  1Z60 A;  2Y1N A;  5LKZ A;  3KNV A;  4FK5 A;  4YAD A;  5H1T A;  2RSD A;  3DPL R;  5C13 A;  5DKA A;  4PTB A;  4A4C A;  2Y43 A;  5B75 A;  2E6R A;  5G04 B;  2LRI C;  2NAA A;  2XEU A;  5FEY A;  3ZTG A;  2AN6 A;  4WA6 A;  5G05 B;  4I7D A;  1MM2 A;  4UP0 A;  2PNX A;  2LXP C;  2MUM A;  1HYJ A;  2F6J A;  1FP0 A;  4FIP A;  4YAX A;  4YBT A;  5LKX A;  2KYU A;  4ZUX U;  2G43 A;  2KIZ A;  4LAD B;  4Q6F A;  3SOW A;  2OXQ C;  1U6G B;  1WEN A;  4P5O B;  1VFY A;  2CKL A;  2G6Q A;  3O35 A;  5H9M A;  2DX8 A;  2C2L A;  2ECG A;  2H0D A;  5D1K B;  2EOD A;  4WZ3 B;  3N9L A;  4V3L C;  1WE9 A;  3U5M A;  1Z2Q A;  1JM7 A;  1RMD A;  3PUR A;  2JMI A;  2LV9 A;  2D8S A;  3KV6 A;  3LQJ A;  2YHN A;  3RPG C;  5FER A;  1WEE A;  4AUQ B;  2YU4 A;  1VYX A;  4AYC A;  2KU3 A;  3ZPV E;  2L5U A;  2JMD A;  3O34 A;  1X4J A;  3SHB A;  2CSZ A;  2MNZ A;  4A4B A;  4YC9 A;  3PUQ A;  4GNF A;  4CA1 A;  2MIQ A;  1WEU A;  2YT5 A;  1V87 A;  2QIZ A;  2KGI A;  5LCW B;  2MT5 A;  5I3L A;  4GND A;  1T1H A;  3HCT A;  1JOC A;  2M6M A;  3U5O A;  1IYM A;  3L1X A;  2ECN A;  2Y1M A;  4N3W A;  5AIU A;  4LKA A;  4BHW A;  5B77 A;  1LDJ B;  4MSX A;  5D1L B;  3T6R A;  2M1R A;  1WEW A;  4S3O B;  5J3X A;  4B86 C;  5H1U A;  1E4U A;  1WIM A;  3KQI A;  2VP7 A;  2ECI A;  3GV4 A;  5KH3 A;  3I2D A;  2LDR A;  4UI9 B;  4WZ0 A;  4AVX A;  2HYE D;  3NG2 A;  1WGM A;  5JG6 A;  2MNY A;  3DQV R;  4R7E A;  3HTK C;  3U5N A;  2LN0 A;  2YQM A;  5LKT A;  1G25 A;  4TKP B;  2KWK A;  3PHD A;  4WZ2 A;  4AP4 A;  4X3G A;  4XI1 A;  1WES A;  4GNG A;  3M99 A;  2MD8 C;  1ZBD B;  2VJF B;  2VPG A;  3SOX A;  3L1Z B;  3M63 A;  4N4F A;  4MVT A;  3ZYQ A;  2UZG A;  4QF3 A;  2LQ6 A;  2FUI A;  3MHH A;  2ECT A;  4GNE A;  1Z6U A;  3EB6 A;  4BBQ A;  2BAY A;  5TAB A;  2LGG A;  5B79 A;  2YHO A;  1BOR A;  5TDW A;  1N87 A;  1WFK A;  3O7A A;  2KRE A;  2K4D A;  2FSA A;  2JMJ A;  2M85 A;  3GL6 A;  2K16 A;  2KR4 A;  2YSM A;  4UP5 A;  2F42 A;  3ZVZ B;  3RPG B;  2VJE A; 
#chains in the Genus database with same CATH topology
 2HDP A;  2CKL B;  5TRB A;  3FL2 A;  3JUE A;  4FJC A;  4NN2 A;  1LDK C;  1X4U A;  2KWJ A;  2FUU A;  2LXH C;  1WEO A;  3HCS A;  2H0D B;  3N9N A;  4LJN A;  3LQH A;  4FO9 A;  4CCG X;  2M3H A;  1JM7 B;  3IHP A;  4L7X A;  5FB0 A;  2L80 A;  4IC3 A;  2L43 A;  4S3O C;  2C2V S;  4O62 A;  2MA5 A;  3N9P A;  4LK9 A;  5SVI A;  3MHS A;  2QJ0 A;  2KE1 A;  3O37 A;  3T9K A;  2QIC A;  3O33 A;  3O70 A;  2VJF A;  1K2F A;  1WIL A;  3ZNI A;  3HCU A;  2VPE A;  5LKU A;  2KFT A;  4YAB A;  4B7Y C;  2E6S A;  4R2Y A;  2VNF A;  2YW8 A;  2RI7 A;  4R8P K;  3LQI A;  2DJA A;  2YUC A;  4YAT A;  5B8D A;  1DVP A;  2EA6 A;  3N9O A;  2ECJ A;  3N9Q A;  1VD4 A;  3T7L A;  4F52 B;  4I7B A;  5B78 A;  4OGC A;  2LGK A;  2YQL A;  3M7K A;  1WEP A;  3N9M A;  4I7C A;  1FBV A;  3ZVY A;  3H7H A;  2IQJ A;  5K3Q A;  1HYI A;  4C9Z A;  3LVQ E;  2KWO A;  1X4I A;  2E61 A;  3KDE C;  2YRE A;  3ZPV 1;  3L11 A;  2K1J A;  1DCQ A;  2KWN A;  2L0B A;  3M62 A;  2CSV A;  2L75 A;  4O64 A;  4A49 A;  5KH9 A;  2CRW A;  3LRQ A;  4F1P A;  2G45 A;  5H1V A;  2EXU A;  2ECV A;  3ASL A;  2YYR A;  1F62 A;  3U5P A;  2PUY A;  3DWD A;  3EB5 A;  2VPB A;  4QF2 A;  1MM3 A;  5G0F A;  3RTR B;  2LGV A;  5SVX A;  4ZQL A;  2YUR A;  3O47 A;  3KV5 A;  5C11 A;  4V3K C;  1XWH A;  2CSY A;  3SOU A;  4PPE A;  2ZET C;  4ZDT A;  3LJU X;  2IDA A;  3E2D A;  2CT2 A;  5KH7 A;  5D1M B;  5EYA F;  2EGM A;  2KGG A;  5TBN A;  5DIN A;  4H9D A;  2I50 A;  1WEQ A;  3C6W A;  4IC2 A;  3V43 A;  5TDR A;  3C5K A;  2JRJ A;  2FD4 A;  2XB1 A;  2VPD A;  1WEV A;  1WEM A;  3QZV A;  2D8U A;  2MA6 A;  4AYC B;  4YBS A;  4YBM A;  5FB1 A;  4LLB A;  4W4U A;  1CHC A;  3O36 A;  4GB0 A;  2YSJ A;  4L58 A;  4QQ4 A;  3VK6 A;  2MD7 B;  5AIT A;  2LGL A;  2K17 A;  2VJE B;  4A0C D;  2ECW A;  3FAO A;  5B76 A;  2EGP A;  2F6N A;  1Z60 A;  2Y1N A;  5LKZ A;  3KNV A;  4FK5 A;  4YAD A;  5H1T A;  2RSD A;  3DPL R;  5C13 A;  5DKA A;  2L7P A;  4PTB A;  4A4C A;  2Y43 A;  5B75 A;  2E6R A;  5G04 B;  2LRI C;  2NAA A;  2XEU A;  5FEY A;  3ZTG A;  2AN6 A;  4WA6 A;  5G05 B;  4I7D A;  2OWA A;  2XOZ A;  1MM2 A;  4UP0 A;  2PNX A;  2LXP C;  2MUM A;  1HYJ A;  2F6J A;  1FP0 A;  4FIP A;  4YAX A;  4YBT A;  5LKX A;  2KYU A;  4ZUX U;  2G43 A;  2KIZ A;  5SVI B;  3FAN A;  4LAD B;  4Q6F A;  3SOW A;  2OXQ C;  2YVR A;  1U6G B;  1WEN A;  4P5O B;  1VFY A;  2CKL A;  2G6Q A;  3O35 A;  4OGE A;  5H9M A;  2DX8 A;  2C2L A;  2ECG A;  2H0D A;  5D1K B;  2EOD A;  4WZ3 B;  3N9L A;  4V3L C;  1WE9 A;  3U5M A;  1Z2Q A;  2RR4 A;  1JM7 A;  1RMD A;  3PUR A;  2JMI A;  2LV9 A;  2D8S A;  3KV6 A;  3LQJ A;  2YHN A;  3RPG C;  5FER A;  1WEE A;  4AUQ B;  2YU4 A;  1VYX A;  4Z0R A;  4AYC A;  2KU3 A;  3ZPV E;  2L5U A;  3Q1D A;  2JMD A;  3O34 A;  1X4J A;  3SHB A;  2CSZ A;  2MNZ A;  2FFW A;  4A4B A;  2MKE A;  4YC9 A;  3PUQ A;  4GNF A;  4CA1 A;  2MIQ A;  1WEU A;  2YT5 A;  1V87 A;  2QIZ A;  2KGI A;  2M13 A;  5LCW B;  2XOC A;  2MT5 A;  5I3L A;  4GND A;  3FEH A;  1T1H A;  3HCT A;  1JOC A;  2M6M A;  3U5O A;  1IYM A;  2CRR A;  2ECN A;  3L1X A;  2Y1M A;  3PLW A;  4N3W A;  3MDB C;  4LKA A;  5AIU A;  4BHW A;  5B77 A;  1LDJ B;  4MSX A;  5D1L B;  3T6R A;  2M1R A;  1WEW A;  3FJU B;  4S3O B;  5J3X A;  4B86 C;  5H1U A;  4Z0O A;  1E4U A;  1WIM A;  3KQI A;  2VP7 A;  2ECI A;  3GV4 A;  5KH3 A;  3I2D A;  2XP0 A;  2LDR A;  4UI9 B;  4WZ0 A;  3FM8 C;  4AVX A;  2HYE D;  3NG2 A;  1WGM A;  2DSM A;  5JG6 A;  5SVY A;  2MNY A;  3DQV R;  4R7E A;  3HTK C;  3U5N A;  3LDY A;  2LN0 A;  2YQM A;  5LKT A;  1G25 A;  4TKP B;  2CON A;  3DDT A;  2KWK A;  2JUN A;  3PHD A;  4WZ2 A;  4AP4 A;  4X3G A;  3SUB A;  4XI1 A;  1WES A;  4GNG A;  3M99 A;  2MD8 C;  1ZBD B;  2VJF B;  2B0O E;  2VPG A;  3SOX A;  3L1Z B;  3M63 A;  4N4F A;  4MVT A;  3ZYQ A;  2UZG A;  4QF3 A;  2XOY A;  2LQ6 A;  2KKY A;  2FUI A;  3MHH A;  2ECT A;  4GNE A;  1Z6U A;  3EB6 A;  4BBQ A;  2BAY A;  5TAB A;  2LGG A;  5B79 A;  2YHO A;  1BOR A;  5TDW A;  2JM3 A;  1N87 A;  1WFK A;  3O7A A;  2KRE A;  2K4D A;  3LVR E;  2FSA A;  2JMJ A;  2M85 A;  1MBM A;  3GL6 A;  2K16 A;  2KKX A;  2KR4 A;  2YSM A;  4UP5 A;  2LAU A;  2P57 A;  2F42 A;  3ZVZ B;  3RPG B;  2VJE A; 
#chains in the Genus database with same CATH homology
 2HDP A;  2CKL B;  5TRB A;  3FL2 A;  4FJC A;  4NN2 A;  1LDK C;  1X4U A;  2KWJ A;  2FUU A;  2LXH C;  1WEO A;  3HCS A;  2H0D B;  3N9N A;  4LJN A;  3LQH A;  4FO9 A;  4CCG X;  2M3H A;  1JM7 B;  3IHP A;  4L7X A;  5FB0 A;  2L80 A;  4IC3 A;  2L43 A;  4S3O C;  2C2V S;  2MA5 A;  3N9P A;  4LK9 A;  3MHS A;  2QJ0 A;  2KE1 A;  3O37 A;  2QIC A;  3O33 A;  3O70 A;  2VJF A;  1K2F A;  1WIL A;  3ZNI A;  3HCU A;  2VPE A;  5LKU A;  2KFT A;  4YAB A;  4B7Y C;  2E6S A;  4R2Y A;  2VNF A;  2YW8 A;  2RI7 A;  4R8P K;  3LQI A;  2YUC A;  4YAT A;  5B8D A;  1DVP A;  2EA6 A;  3N9O A;  2ECJ A;  3N9Q A;  1VD4 A;  3T7L A;  4F52 B;  4I7B A;  5B78 A;  2LGK A;  2YQL A;  1WEP A;  3N9M A;  4I7C A;  1FBV A;  3ZVY A;  1HYI A;  4C9Z A;  2KWO A;  1X4I A;  2YRE A;  3ZPV 1;  3L11 A;  2K1J A;  2KWN A;  2L0B A;  3M62 A;  2L75 A;  4O64 A;  4A49 A;  5KH9 A;  3LRQ A;  2G45 A;  5H1V A;  2ECV A;  3ASL A;  2YYR A;  1F62 A;  3U5P A;  2PUY A;  3EB5 A;  2VPB A;  4QF2 A;  1MM3 A;  5G0F A;  3RTR B;  2LGV A;  4ZQL A;  2YUR A;  3KV5 A;  5C11 A;  4V3K C;  1XWH A;  2CSY A;  3SOU A;  4PPE A;  2ZET C;  4ZDT A;  2IDA A;  2CT2 A;  5KH7 A;  5D1M B;  5EYA F;  2KGG A;  5TBN A;  5DIN A;  2I50 A;  1WEQ A;  3C6W A;  4IC2 A;  3V43 A;  5TDR A;  3C5K A;  2JRJ A;  2XB1 A;  2VPD A;  1WEV A;  1WEM A;  3QZV A;  2MA6 A;  4AYC B;  4YBS A;  4YBM A;  5FB1 A;  4LLB A;  4W4U A;  1CHC A;  3O36 A;  4GB0 A;  2YSJ A;  4L58 A;  3VK6 A;  2MD7 B;  5AIT A;  2LGL A;  2K17 A;  2VJE B;  4A0C D;  2ECW A;  5B76 A;  2EGP A;  2F6N A;  1Z60 A;  2Y1N A;  5LKZ A;  3KNV A;  4FK5 A;  4YAD A;  5H1T A;  2RSD A;  3DPL R;  5C13 A;  5DKA A;  4PTB A;  4A4C A;  2Y43 A;  5B75 A;  2E6R A;  5G04 B;  2LRI C;  2NAA A;  2XEU A;  5FEY A;  3ZTG A;  2AN6 A;  4WA6 A;  5G05 B;  4I7D A;  1MM2 A;  4UP0 A;  2PNX A;  2LXP C;  2MUM A;  1HYJ A;  2F6J A;  1FP0 A;  4FIP A;  4YAX A;  4YBT A;  5LKX A;  2KYU A;  4ZUX U;  2G43 A;  2KIZ A;  4LAD B;  4Q6F A;  3SOW A;  2OXQ C;  1U6G B;  1WEN A;  4P5O B;  1VFY A;  2CKL A;  2G6Q A;  3O35 A;  5H9M A;  2DX8 A;  2C2L A;  2ECG A;  2H0D A;  5D1K B;  2EOD A;  4WZ3 B;  3N9L A;  4V3L C;  1WE9 A;  3U5M A;  1Z2Q A;  1JM7 A;  1RMD A;  3PUR A;  2JMI A;  2LV9 A;  2D8S A;  3KV6 A;  3LQJ A;  2YHN A;  3RPG C;  5FER A;  1WEE A;  4AUQ B;  2YU4 A;  1VYX A;  4AYC A;  2KU3 A;  3ZPV E;  2L5U A;  2JMD A;  3O34 A;  1X4J A;  3SHB A;  2CSZ A;  2MNZ A;  4A4B A;  4YC9 A;  3PUQ A;  4GNF A;  4CA1 A;  2MIQ A;  1WEU A;  2YT5 A;  1V87 A;  2QIZ A;  2KGI A;  5LCW B;  2MT5 A;  5I3L A;  4GND A;  1T1H A;  3HCT A;  1JOC A;  2M6M A;  3U5O A;  1IYM A;  3L1X A;  2ECN A;  2Y1M A;  4N3W A;  5AIU A;  4LKA A;  4BHW A;  5B77 A;  1LDJ B;  4MSX A;  5D1L B;  3T6R A;  2M1R A;  1WEW A;  4S3O B;  5J3X A;  4B86 C;  5H1U A;  1E4U A;  1WIM A;  3KQI A;  2VP7 A;  2ECI A;  3GV4 A;  5KH3 A;  3I2D A;  2LDR A;  4UI9 B;  4WZ0 A;  4AVX A;  2HYE D;  3NG2 A;  1WGM A;  5JG6 A;  2MNY A;  3DQV R;  4R7E A;  3HTK C;  3U5N A;  2LN0 A;  2YQM A;  5LKT A;  1G25 A;  4TKP B;  2KWK A;  3PHD A;  4WZ2 A;  4AP4 A;  4X3G A;  4XI1 A;  1WES A;  4GNG A;  3M99 A;  2MD8 C;  1ZBD B;  2VJF B;  2VPG A;  3SOX A;  3L1Z B;  3M63 A;  4N4F A;  4MVT A;  3ZYQ A;  2UZG A;  4QF3 A;  2LQ6 A;  2FUI A;  3MHH A;  2ECT A;  4GNE A;  1Z6U A;  3EB6 A;  4BBQ A;  2BAY A;  5TAB A;  2LGG A;  5B79 A;  2YHO A;  1BOR A;  5TDW A;  1N87 A;  1WFK A;  3O7A A;  2KRE A;  2K4D A;  2FSA A;  2JMJ A;  2M85 A;  3GL6 A;  2K16 A;  2KR4 A;  2YSM A;  4UP5 A;  2F42 A;  3ZVZ B;  3RPG B;  2VJE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...