2QICA

Crystal structure of the ing1 phd finger in complex with a histone h3k4me3 peptide
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
51
structure length
51
Chain Sequence
b'EPTYCLCNQVSYGEMIGCDNDECPIEWFHFSCVGLNHKPKGKWYCPKCRGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Inhibitor of growth protein 1
publication title Histone H3K4me3 binding is required for the DNA repair and apoptotic activities of ING1 tumor suppressor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Antitumor protein, apoptosis
total genus 8
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 2007-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2qicA00
2LXHC 3SOXA 4X3GA 3HCTA 2K1JA 2YYRA 5B75A 5DKAA 2MUMA 4R7EA 3ZVYA 2F6NA 4GNGA 4R8PK 5FB0A 2ECNA 3C6WA 1X4UA 1WEPA 4YADA 2FSAA 2KU3A 4MVTA 2MA6A 4FO9A 4GB0A 4UI9B 1RMDA 3FL2A 4WZ2A 4ZQLA 3U5MA 4V3LC 2EA6A 2KE1A 2MD8C 3ZPVE 3PUQA 3HCUA 3PURA 3O36A 2YW8A 5H1VA 5TDWA 4AYCB 4A4CA 2YREA 3O70A 2HDPA 4LADB 4WZ0A 3KV5A 1HYIA 4WZ3B 1WE9A 2VJEA 2VJFB 3EB5A 3LQHA 4YAXA 4W4UA 1VD4A 5LKZA 5KH7A 5B77A 2YT5A 1HYJA 2G45A 2MIQA 5B79A 2DX8A 5TABA 2ZETC 2ECTA 4GNFA 5KH3A 2LGKA 1WIMA 2MT5A 2ECIA 2FUUA 3RPGC 2Y1MA 3ASLA 2E6SA 2MD7B 5G05B 2CSYA 2C2VS 2KIZA 2UZGA 5FERA 1WEWA 4BHWA 2VPDA 1WILA 3LQJA 4CA1A 2LGGA 4I7CA 3O34A 4XI1A 4YC9A 3I2DA 2KWKA 2QJ0A 1LDJB 1WEUA 5EYAF 1K2FA 1T1HA 3L11A 5TRBA 2AN6A 5G0FA 4Q6FA 4AYCA 3DPLR 4YABA 3MHSA 2YHOA 2YURA 2LN0A 4UP5A 2EODA 5TBNA 2ECVA 3O35A 2VJFA 3M62A 5D1KB 1JM7A 2MNZA 1WEQA 5DINA 1E4UA 2VP7A 4R2YA 3RTRB 4AP4A 2YUCA 4I7BA 3ZYQA 2LDRA 2PNXA 2JMJA 3IHPA 4P5OB 1V87A 2K4DA 1Z6UA 4O64A 1U6GB 4B86C 5B8DA 1WEOA 1ZBDB 1LDKC 2M3HA 3N9LA 2K16A 3U5OA 2CT2A 4MSXA 3N9NA 1FBVA 2L0BA 5C13A 3N9QA 1WEEA 2ECWA 2YHNA 4PPEA 2LXPC 1WESA 2RSDA 2L80A 2LV9A 3N9OA 3MHHA 1JM7B 3GV4A 4LK9A 4YATA 4AUQB 2LRIC 1VYXA 5H1TA 1VFYA 5B76A 4FK5A 4I7DA 5LKXA 2YQMA 4N4FA 3ZVZB 2MNYA 2XEUA 3L1ZB 4QF2A 2D8SA 2KWOA 2LQ6A 5KH9A 4ZUXU 1MM3A 2YU4A 2M1RA 3RPGB 3EB6A 2JRJA 2H0DB 2KGGA 4YBTA 5C11A 4B7YC 4NN2A 2LGVA 5AIUA 3LRQA 1Z60A 4FIPA 4GNEA 3L1XA 3M99A 3SOUA 3SHBA 4UP0A 4S3OB 3V43A 4WA6A 2JMIA 2L75A 1MM2A 5G04B 1FP0A 2VPBA 3ZTGA 4V3KC 2VPEA 2KYUA 4TKPB 1X4IA 2EGPA 2LGLA 3PHDA 2G6QA 2M85A 4YBSA 1WFKA 2KFTA 3QZVA 2KR4A 1BORA 4ZDTA 2KWJA 2KWNA 2F42A 4N3WA 5LCWB 5B78A 3ZNIA 3HCSA 2HYED 3KV6A 3O7AA 2KGIA 4LJNA 4A49A 3C5KA 3VK6A 3U5NA 1WGMA 4A0CD 5JG6A 1XWHA 2H0DA 2Y1NA 1X4JA 5AITA 5H9MA 2CKLB 5FEYA 2I50A 2Y43A 2RI7A 4LLBA 2VPGA 1Z2QA 4YBMA 1G25A 2QICA 5D1MB 5H1UA 2OXQC 1JOCA 3O33A 3KNVA 2YSMA 5J3XA 1F62A 4F52B 1N87A 3NG2A 3N9MA 1CHCA 4PTBA 5D1LB 2IDAA 3M63A 3T6RA 3DQVR 1IYMA 3KQIA 3GL6A 3O37A 1WENA 2L5UA 2NAAA 2YSJA 2ECGA 2FUIA 5I3LA 2ECJA 2KREA 4QF3A 3T7LA 2C2LA 4BBQA 1WEMA 2K17A 2XB1A 2PUYA 2MA5A 2JMDA 3ZPV1 2F6JA 2M6MA 4GNDA 4IC3A 4L58A 2CSZA 3SOWA 5LKUA 4LKAA 2YQLA 2BAYA 3LQIA 4IC2A 4L7XA 1DVPA 2QIZA 3U5PA 2L43A 2E6RA 5FB1A 4CCGX 2CKLA 5LKTA 3N9PA 4A4BA 2VJEB 4S3OC 1WEVA 4FJCA 2G43A 5TDRA 3HTKC 4AVXA 4C9ZA 2VNFA
chains in the Genus database with same CATH superfamily
2LXHC 3SOXA 4X3GA 3HCTA 2K1JA 2YYRA 5B75A 5DKAA 2MUMA 4R7EA 3ZVYA 2F6NA 4GNGA 4R8PK 5FB0A 5SVYA 2ECNA 3C6WA 1X4UA 1WEPA 4YADA 2FSAA 2KU3A 4MVTA 2MA6A 4FO9A 4GB0A 2CRRA 1RMDA 4UI9B 3FL2A 4WZ2A 4ZQLA 3PLWA 3U5MA 4V3LC 2EA6A 2KE1A 3O47A 4OGCA 2MD8C 3ZPVE 3PUQA 3HCUA 3PURA 3O36A 2YW8A 5H1VA 5SVIB 5TDWA 4AYCB 4A4CA 2YREA 3FANA 3LVRE 3O70A 2HDPA 4LADB 3T9KA 4WZ0A 3KV5A 1HYIA 4WZ3B 1WE9A 3DDTA 2VJEA 2VJFB 3EB5A 3LQHA 4YAXA 4W4UA 1VD4A 5LKZA 5KH7A 5B77A 2YT5A 1HYJA 2G45A 2MIQA 5B79A 2DX8A 3E2DA 5TABA 2ZETC 2XP0A 2ECTA 4GNFA 5KH3A 2LGKA 1WIMA 2MT5A 2ECIA 2FUUA 3KDEC 3FJUB 4O62A 3RPGC 2Y1MA 3ASLA 2E6SA 3SUBA 2MD7B 5G05B 2CSYA 2C2VS 2KIZA 2UZGA 5FERA 2D8UA 1WEWA 4BHWA 2VPDA 1WILA 3LQJA 4CA1A 2LGGA 4I7CA 3O34A 4XI1A 4YC9A 3I2DA 2KWKA 2QJ0A 1LDJB 1WEUA 5EYAF 1K2FA 1T1HA 3LDYA 3L11A 5TRBA 2AN6A 5G0FA 4Q6FA 4AYCA 3DPLR 4YABA 4QQ4A 3MHSA 2YHOA 2YURA 2LN0A 4UP5A 2DJAA 2EODA 5TBNA 2ECVA 3O35A 2VJFA 3M62A 5D1KB 1JM7A 2MNZA 1WEQA 5DINA 1E4UA 2VP7A 4R2YA 2L7PA 3RTRB 4AP4A 2YUCA 4I7BA 3ZYQA 2LDRA 2CONA 2PNXA 3JUEA 3FEHA 2JMJA 3LVQE 4P5OB 3IHPA 1V87A 2K4DA 1Z6UA 4O64A 1U6GB 4B86C 5B8DA 1WEOA 1ZBDB 2KKXA 1LDKC 2M3HA 3FAOA 3N9LA 2K16A 3U5OA 2CT2A 4MSXA 3N9NA 1FBVA 2L0BA 5C13A 3N9QA 4F1PA 1WEEA 2ECWA 2YHNA 4PPEA 2LXPC 1WESA 2RSDA 2EGMA 2OWAA 2L80A 2FD4A 2LV9A 1MBMA 3N9OA 3MHHA 1JM7B 3GV4A 4LK9A 4YATA 4AUQB 2LRIC 1VYXA 5H1TA 1VFYA 5B76A 4FK5A 4I7DA 5LKXA 2YQMA 4N4FA 3ZVZB 2LAUA 2MNYA 2XEUA 3L1ZB 4QF2A 2D8SA 2XOYA 2KWOA 2LQ6A 3LJUX 2DSMA 2XOCA 5KH9A 4ZUXU 1MM3A 2YU4A 3DWDA 2YVRA 2M1RA 3RPGB 3M7KA 3EB6A 2JRJA 2H0DB 2KGGA 4YBTA 5C11A 4B7YC 4NN2A 2LGVA 5AIUA 3LRQA 1Z60A 4FIPA 4GNEA 3L1XA 3M99A 3SOUA 3SHBA 4UP0A 2CSVA 4S3OB 3V43A 4WA6A 2JMIA 2L75A 1MM2A 2RR4A 5G04B 1FP0A 2VPBA 3ZTGA 4V3KC 2VPEA 2KYUA 5K3QA 4TKPB 1X4IA 2XOZA 2EGPA 2LGLA 3PHDA 2G6QA 2M85A 4YBSA 2FFWA 1WFKA 2KFTA 3QZVA 2KR4A 1BORA 4ZDTA 3FM8C 2KWJA 2KWNA 2F42A 4N3WA 5LCWB 5B78A 2P57A 3ZNIA 3HCSA 2HYED 3KV6A 3O7AA 2KGIA 4LJNA 4A49A 3C5KA 3VK6A 3U5NA 1WGMA 4A0CD 5JG6A 1XWHA 2H0DA 2Y1NA 1X4JA 5AITA 5H9MA 2CKLB 5FEYA 2I50A 2Y43A 2RI7A 2IQJA 4LLBA 2VPGA 1Z2QA 4YBMA 1G25A 3Q1DA 2QICA 5D1MB 5H1UA 2OXQC 1JOCA 3MDBC 4OGEA 3O33A 3KNVA 2YSMA 5J3XA 1F62A 4F52B 1N87A 3NG2A 3N9MA 2JM3A 1CHCA 4PTBA 5D1LB 2IDAA 3M63A 3T6RA 3DQVR 1IYMA 3KQIA 3GL6A 3O37A 1WENA 2L5UA 2NAAA 2YSJA 2ECGA 2FUIA 5I3LA 2ECJA 2KREA 4QF3A 3T7LA 2C2LA 2CRWA 4BBQA 4Z0OA 1WEMA 2K17A 2XB1A 2E61A 2PUYA 3H7HA 1DCQA 2MA5A 2JMDA 3ZPV1 2KKYA 2F6JA 2M6MA 4H9DA 4GNDA 2B0OE 4IC3A 4L58A 2CSZA 3SOWA 5LKUA 4Z0RA 4LKAA 2YQLA 2BAYA 3LQIA 4L7XA 4IC2A 1DVPA 2QIZA 3U5PA 2JUNA 2L43A 2E6RA 5FB1A 5SVXA 4CCGX 2CKLA 5LKTA 3N9PA 2M13A 4A4BA 2VJEB 4S3OC 1WEVA 2MKEA 4FJCA 5SVIA 2G43A 2EXUA 5TDRA 3HTKC 4AVXA 4C9ZA 2VNFA
chains in the Genus database with same CATH topology
2LXHC 3SOXA 4X3GA 3HCTA 2K1JA 2YYRA 5B75A 5DKAA 2MUMA 4R7EA 3ZVYA 2F6NA 4GNGA 4R8PK 5FB0A 2ECNA 3C6WA 1X4UA 1WEPA 4YADA 2FSAA 2KU3A 4MVTA 2MA6A 4FO9A 4GB0A 4UI9B 1RMDA 3FL2A 4WZ2A 4ZQLA 3U5MA 4V3LC 2EA6A 2KE1A 2MD8C 3ZPVE 3PUQA 3HCUA 3PURA 3O36A 2YW8A 5H1VA 5TDWA 4AYCB 4A4CA 2YREA 3O70A 2HDPA 4LADB 4WZ0A 3KV5A 1HYIA 4WZ3B 1WE9A 2VJEA 2VJFB 3EB5A 3LQHA 4YAXA 4W4UA 1VD4A 5LKZA 5KH7A 5B77A 2YT5A 1HYJA 2G45A 2MIQA 5B79A 2DX8A 5TABA 2ZETC 2ECTA 4GNFA 5KH3A 2LGKA 1WIMA 2MT5A 2ECIA 2FUUA 3RPGC 2Y1MA 3ASLA 2E6SA 2MD7B 5G05B 2CSYA 2C2VS 2KIZA 2UZGA 5FERA 1WEWA 4BHWA 2VPDA 1WILA 3LQJA 4CA1A 2LGGA 4I7CA 3O34A 4XI1A 4YC9A 3I2DA 2KWKA 2QJ0A 1LDJB 1WEUA 5EYAF 1K2FA 1T1HA 3L11A 5TRBA 2AN6A 5G0FA 4Q6FA 4AYCA 3DPLR 4YABA 3MHSA 2YHOA 2YURA 2LN0A 4UP5A 2EODA 5TBNA 2ECVA 3O35A 2VJFA 3M62A 5D1KB 1JM7A 2MNZA 1WEQA 5DINA 1E4UA 2VP7A 4R2YA 3RTRB 4AP4A 2YUCA 4I7BA 3ZYQA 2LDRA 2PNXA 2JMJA 3IHPA 4P5OB 1V87A 2K4DA 1Z6UA 4O64A 1U6GB 4B86C 5B8DA 1WEOA 1ZBDB 1LDKC 2M3HA 3N9LA 2K16A 3U5OA 2CT2A 4MSXA 3N9NA 1FBVA 2L0BA 5C13A 3N9QA 1WEEA 2ECWA 2YHNA 4PPEA 2LXPC 1WESA 2RSDA 2L80A 2LV9A 3N9OA 3MHHA 1JM7B 3GV4A 4LK9A 4YATA 4AUQB 2LRIC 1VYXA 5H1TA 1VFYA 5B76A 4FK5A 4I7DA 5LKXA 2YQMA 4N4FA 3ZVZB 2MNYA 2XEUA 3L1ZB 4QF2A 2D8SA 2KWOA 2LQ6A 5KH9A 4ZUXU 1MM3A 2YU4A 2M1RA 3RPGB 3EB6A 2JRJA 2H0DB 2KGGA 4YBTA 5C11A 4B7YC 4NN2A 2LGVA 5AIUA 3LRQA 1Z60A 4FIPA 4GNEA 3L1XA 3M99A 3SOUA 3SHBA 4UP0A 4S3OB 3V43A 4WA6A 2JMIA 2L75A 1MM2A 5G04B 1FP0A 2VPBA 3ZTGA 4V3KC 2VPEA 2KYUA 4TKPB 1X4IA 2EGPA 2LGLA 3PHDA 2G6QA 2M85A 4YBSA 1WFKA 2KFTA 3QZVA 2KR4A 1BORA 4ZDTA 2KWJA 2KWNA 2F42A 4N3WA 5LCWB 5B78A 3ZNIA 3HCSA 2HYED 3KV6A 3O7AA 2KGIA 4LJNA 4A49A 3C5KA 3VK6A 3U5NA 1WGMA 4A0CD 5JG6A 1XWHA 2H0DA 2Y1NA 1X4JA 5AITA 5H9MA 2CKLB 5FEYA 2I50A 2Y43A 2RI7A 4LLBA 2VPGA 1Z2QA 4YBMA 1G25A 2QICA 5D1MB 5H1UA 2OXQC 1JOCA 3O33A 3KNVA 2YSMA 5J3XA 1F62A 4F52B 1N87A 3NG2A 3N9MA 1CHCA 4PTBA 5D1LB 2IDAA 3M63A 3T6RA 3DQVR 1IYMA 3KQIA 3GL6A 3O37A 1WENA 2L5UA 2NAAA 2YSJA 2ECGA 2FUIA 5I3LA 2ECJA 2KREA 4QF3A 3T7LA 2C2LA 4BBQA 1WEMA 2K17A 2XB1A 2PUYA 2MA5A 2JMDA 3ZPV1 2F6JA 2M6MA 4GNDA 4IC3A 4L58A 2CSZA 3SOWA 5LKUA 4LKAA 2YQLA 2BAYA 3LQIA 4IC2A 4L7XA 1DVPA 2QIZA 3U5PA 2L43A 2E6RA 5FB1A 4CCGX 2CKLA 5LKTA 3N9PA 4A4BA 2VJEB 4S3OC 1WEVA 4FJCA 2G43A 5TDRA 3HTKC 4AVXA 4C9ZA 2VNFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LXH C;  3SOX A;  4X3G A;  3HCT A;  2K1J A;  2YYR A;  5B75 A;  5DKA A;  2MUM A;  4R7E A;  3ZVY A;  2F6N A;  4GNG A;  4R8P K;  5FB0 A;  2ECN A;  3C6W A;  1X4U A;  1WEP A;  4YAD A;  2FSA A;  2KU3 A;  4MVT A;  2MA6 A;  4FO9 A;  4GB0 A;  4UI9 B;  1RMD A;  3FL2 A;  4WZ2 A;  4ZQL A;  3U5M A;  4V3L C;  2EA6 A;  2KE1 A;  2MD8 C;  3ZPV E;  3PUQ A;  3HCU A;  3PUR A;  3O36 A;  2YW8 A;  5H1V A;  5TDW A;  4AYC B;  4A4C A;  2YRE A;  3O70 A;  2HDP A;  4LAD B;  4WZ0 A;  3KV5 A;  1HYI A;  4WZ3 B;  1WE9 A;  2VJE A;  2VJF B;  3EB5 A;  3LQH A;  4YAX A;  4W4U A;  1VD4 A;  5LKZ A;  5KH7 A;  5B77 A;  2YT5 A;  1HYJ A;  2G45 A;  2MIQ A;  5B79 A;  2DX8 A;  5TAB A;  2ZET C;  2ECT A;  4GNF A;  5KH3 A;  2LGK A;  1WIM A;  2MT5 A;  2ECI A;  2FUU A;  3RPG C;  2Y1M A;  3ASL A;  2E6S A;  2MD7 B;  5G05 B;  2CSY A;  2C2V S;  2KIZ A;  2UZG A;  5FER A;  1WEW A;  4BHW A;  2VPD A;  1WIL A;  3LQJ A;  4CA1 A;  2LGG A;  4I7C A;  3O34 A;  4XI1 A;  4YC9 A;  3I2D A;  2KWK A;  2QJ0 A;  1LDJ B;  1WEU A;  5EYA F;  1K2F A;  1T1H A;  3L11 A;  5TRB A;  2AN6 A;  5G0F A;  4Q6F A;  4AYC A;  3DPL R;  4YAB A;  3MHS A;  2YHO A;  2YUR A;  2LN0 A;  4UP5 A;  2EOD A;  5TBN A;  2ECV A;  3O35 A;  2VJF A;  3M62 A;  5D1K B;  1JM7 A;  2MNZ A;  1WEQ A;  5DIN A;  1E4U A;  2VP7 A;  4R2Y A;  3RTR B;  4AP4 A;  2YUC A;  4I7B A;  3ZYQ A;  2LDR A;  2PNX A;  2JMJ A;  3IHP A;  4P5O B;  1V87 A;  2K4D A;  1Z6U A;  4O64 A;  1U6G B;  4B86 C;  5B8D A;  1WEO A;  1ZBD B;  1LDK C;  2M3H A;  3N9L A;  2K16 A;  3U5O A;  2CT2 A;  4MSX A;  3N9N A;  1FBV A;  2L0B A;  5C13 A;  3N9Q A;  1WEE A;  2ECW A;  2YHN A;  4PPE A;  2LXP C;  1WES A;  2RSD A;  2L80 A;  2LV9 A;  3N9O A;  3MHH A;  1JM7 B;  3GV4 A;  4LK9 A;  4YAT A;  4AUQ B;  2LRI C;  1VYX A;  5H1T A;  1VFY A;  5B76 A;  4FK5 A;  4I7D A;  5LKX A;  2YQM A;  4N4F A;  3ZVZ B;  2MNY A;  2XEU A;  3L1Z B;  4QF2 A;  2D8S A;  2KWO A;  2LQ6 A;  5KH9 A;  4ZUX U;  1MM3 A;  2YU4 A;  2M1R A;  3RPG B;  3EB6 A;  2JRJ A;  2H0D B;  2KGG A;  4YBT A;  5C11 A;  4B7Y C;  4NN2 A;  2LGV A;  5AIU A;  3LRQ A;  1Z60 A;  4FIP A;  4GNE A;  3L1X A;  3M99 A;  3SOU A;  3SHB A;  4UP0 A;  4S3O B;  3V43 A;  4WA6 A;  2JMI A;  2L75 A;  1MM2 A;  5G04 B;  1FP0 A;  2VPB A;  3ZTG A;  4V3K C;  2VPE A;  2KYU A;  4TKP B;  1X4I A;  2EGP A;  2LGL A;  3PHD A;  2G6Q A;  2M85 A;  4YBS A;  1WFK A;  2KFT A;  3QZV A;  2KR4 A;  1BOR A;  4ZDT A;  2KWJ A;  2KWN A;  2F42 A;  4N3W A;  5LCW B;  5B78 A;  3ZNI A;  3HCS A;  2HYE D;  3KV6 A;  3O7A A;  2KGI A;  4LJN A;  4A49 A;  3C5K A;  3VK6 A;  3U5N A;  1WGM A;  4A0C D;  5JG6 A;  1XWH A;  2H0D A;  2Y1N A;  1X4J A;  5AIT A;  5H9M A;  2CKL B;  5FEY A;  2I50 A;  2Y43 A;  2RI7 A;  4LLB A;  2VPG A;  1Z2Q A;  4YBM A;  1G25 A;  2QIC A;  5D1M B;  5H1U A;  2OXQ C;  1JOC A;  3O33 A;  3KNV A;  2YSM A;  5J3X A;  1F62 A;  4F52 B;  1N87 A;  3NG2 A;  3N9M A;  1CHC A;  4PTB A;  5D1L B;  2IDA A;  3M63 A;  3T6R A;  3DQV R;  1IYM A;  3KQI A;  3GL6 A;  3O37 A;  1WEN A;  2L5U A;  2NAA A;  2YSJ A;  2ECG A;  2FUI A;  5I3L A;  2ECJ A;  2KRE A;  4QF3 A;  3T7L A;  2C2L A;  4BBQ A;  1WEM A;  2K17 A;  2XB1 A;  2PUY A;  2MA5 A;  2JMD A;  3ZPV 1;  2F6J A;  2M6M A;  4GND A;  4IC3 A;  4L58 A;  2CSZ A;  3SOW A;  5LKU A;  4LKA A;  2YQL A;  2BAY A;  3LQI A;  4IC2 A;  4L7X A;  1DVP A;  2QIZ A;  3U5P A;  2L43 A;  2E6R A;  5FB1 A;  4CCG X;  2CKL A;  5LKT A;  3N9P A;  4A4B A;  2VJE B;  4S3O C;  1WEV A;  4FJC A;  2G43 A;  5TDR A;  3HTK C;  4AVX A;  4C9Z A;  2VNF A; 
#chains in the Genus database with same CATH topology
 2LXH C;  3SOX A;  4X3G A;  3HCT A;  2K1J A;  2YYR A;  5B75 A;  5DKA A;  2MUM A;  4R7E A;  3ZVY A;  2F6N A;  4GNG A;  4R8P K;  5FB0 A;  5SVY A;  2ECN A;  3C6W A;  1X4U A;  1WEP A;  4YAD A;  2FSA A;  2KU3 A;  4MVT A;  2MA6 A;  4FO9 A;  4GB0 A;  2CRR A;  1RMD A;  4UI9 B;  3FL2 A;  4WZ2 A;  4ZQL A;  3PLW A;  3U5M A;  4V3L C;  2EA6 A;  2KE1 A;  3O47 A;  4OGC A;  2MD8 C;  3ZPV E;  3PUQ A;  3HCU A;  3PUR A;  3O36 A;  2YW8 A;  5H1V A;  5SVI B;  5TDW A;  4AYC B;  4A4C A;  2YRE A;  3FAN A;  3LVR E;  3O70 A;  2HDP A;  4LAD B;  3T9K A;  4WZ0 A;  3KV5 A;  1HYI A;  4WZ3 B;  1WE9 A;  3DDT A;  2VJE A;  2VJF B;  3EB5 A;  3LQH A;  4YAX A;  4W4U A;  1VD4 A;  5LKZ A;  5KH7 A;  5B77 A;  2YT5 A;  1HYJ A;  2G45 A;  2MIQ A;  5B79 A;  2DX8 A;  3E2D A;  5TAB A;  2ZET C;  2XP0 A;  2ECT A;  4GNF A;  5KH3 A;  2LGK A;  1WIM A;  2MT5 A;  2ECI A;  2FUU A;  3KDE C;  3FJU B;  4O62 A;  3RPG C;  2Y1M A;  3ASL A;  2E6S A;  3SUB A;  2MD7 B;  5G05 B;  2CSY A;  2C2V S;  2KIZ A;  2UZG A;  5FER A;  2D8U A;  1WEW A;  4BHW A;  2VPD A;  1WIL A;  3LQJ A;  4CA1 A;  2LGG A;  4I7C A;  3O34 A;  4XI1 A;  4YC9 A;  3I2D A;  2KWK A;  2QJ0 A;  1LDJ B;  1WEU A;  5EYA F;  1K2F A;  1T1H A;  3LDY A;  3L11 A;  5TRB A;  2AN6 A;  5G0F A;  4Q6F A;  4AYC A;  3DPL R;  4YAB A;  4QQ4 A;  3MHS A;  2YHO A;  2YUR A;  2LN0 A;  4UP5 A;  2DJA A;  2EOD A;  5TBN A;  2ECV A;  3O35 A;  2VJF A;  3M62 A;  5D1K B;  1JM7 A;  2MNZ A;  1WEQ A;  5DIN A;  1E4U A;  2VP7 A;  4R2Y A;  2L7P A;  3RTR B;  4AP4 A;  2YUC A;  4I7B A;  3ZYQ A;  2LDR A;  2CON A;  2PNX A;  3JUE A;  3FEH A;  2JMJ A;  3LVQ E;  4P5O B;  3IHP A;  1V87 A;  2K4D A;  1Z6U A;  4O64 A;  1U6G B;  4B86 C;  5B8D A;  1WEO A;  1ZBD B;  2KKX A;  1LDK C;  2M3H A;  3FAO A;  3N9L A;  2K16 A;  3U5O A;  2CT2 A;  4MSX A;  3N9N A;  1FBV A;  2L0B A;  5C13 A;  3N9Q A;  4F1P A;  1WEE A;  2ECW A;  2YHN A;  4PPE A;  2LXP C;  1WES A;  2RSD A;  2EGM A;  2OWA A;  2L80 A;  2FD4 A;  2LV9 A;  1MBM A;  3N9O A;  3MHH A;  1JM7 B;  3GV4 A;  4LK9 A;  4YAT A;  4AUQ B;  2LRI C;  1VYX A;  5H1T A;  1VFY A;  5B76 A;  4FK5 A;  4I7D A;  5LKX A;  2YQM A;  4N4F A;  3ZVZ B;  2LAU A;  2MNY A;  2XEU A;  3L1Z B;  4QF2 A;  2D8S A;  2XOY A;  2KWO A;  2LQ6 A;  3LJU X;  2DSM A;  2XOC A;  5KH9 A;  4ZUX U;  1MM3 A;  2YU4 A;  3DWD A;  2YVR A;  2M1R A;  3RPG B;  3M7K A;  3EB6 A;  2JRJ A;  2H0D B;  2KGG A;  4YBT A;  5C11 A;  4B7Y C;  4NN2 A;  2LGV A;  5AIU A;  3LRQ A;  1Z60 A;  4FIP A;  4GNE A;  3L1X A;  3M99 A;  3SOU A;  3SHB A;  4UP0 A;  2CSV A;  4S3O B;  3V43 A;  4WA6 A;  2JMI A;  2L75 A;  1MM2 A;  2RR4 A;  5G04 B;  1FP0 A;  2VPB A;  3ZTG A;  4V3K C;  2VPE A;  2KYU A;  5K3Q A;  4TKP B;  1X4I A;  2XOZ A;  2EGP A;  2LGL A;  3PHD A;  2G6Q A;  2M85 A;  4YBS A;  2FFW A;  1WFK A;  2KFT A;  3QZV A;  2KR4 A;  1BOR A;  4ZDT A;  3FM8 C;  2KWJ A;  2KWN A;  2F42 A;  4N3W A;  5LCW B;  5B78 A;  2P57 A;  3ZNI A;  3HCS A;  2HYE D;  3KV6 A;  3O7A A;  2KGI A;  4LJN A;  4A49 A;  3C5K A;  3VK6 A;  3U5N A;  1WGM A;  4A0C D;  5JG6 A;  1XWH A;  2H0D A;  2Y1N A;  1X4J A;  5AIT A;  5H9M A;  2CKL B;  5FEY A;  2I50 A;  2Y43 A;  2RI7 A;  2IQJ A;  4LLB A;  2VPG A;  1Z2Q A;  4YBM A;  1G25 A;  3Q1D A;  2QIC A;  5D1M B;  5H1U A;  2OXQ C;  1JOC A;  3MDB C;  4OGE A;  3O33 A;  3KNV A;  2YSM A;  5J3X A;  1F62 A;  4F52 B;  1N87 A;  3NG2 A;  3N9M A;  2JM3 A;  1CHC A;  4PTB A;  5D1L B;  2IDA A;  3M63 A;  3T6R A;  3DQV R;  1IYM A;  3KQI A;  3GL6 A;  3O37 A;  1WEN A;  2L5U A;  2NAA A;  2YSJ A;  2ECG A;  2FUI A;  5I3L A;  2ECJ A;  2KRE A;  4QF3 A;  3T7L A;  2C2L A;  2CRW A;  4BBQ A;  4Z0O A;  1WEM A;  2K17 A;  2XB1 A;  2E61 A;  2PUY A;  3H7H A;  1DCQ A;  2MA5 A;  2JMD A;  3ZPV 1;  2KKY A;  2F6J A;  2M6M A;  4H9D A;  4GND A;  2B0O E;  4IC3 A;  4L58 A;  2CSZ A;  3SOW A;  5LKU A;  4Z0R A;  4LKA A;  2YQL A;  2BAY A;  3LQI A;  4L7X A;  4IC2 A;  1DVP A;  2QIZ A;  3U5P A;  2JUN A;  2L43 A;  2E6R A;  5FB1 A;  5SVX A;  4CCG X;  2CKL A;  5LKT A;  3N9P A;  2M13 A;  4A4B A;  2VJE B;  4S3O C;  1WEV A;  2MKE A;  4FJC A;  5SVI A;  2G43 A;  2EXU A;  5TDR A;  3HTK C;  4AVX A;  4C9Z A;  2VNF A; 
#chains in the Genus database with same CATH homology
 2LXH C;  3SOX A;  4X3G A;  3HCT A;  2K1J A;  2YYR A;  5B75 A;  5DKA A;  2MUM A;  4R7E A;  3ZVY A;  2F6N A;  4GNG A;  4R8P K;  5FB0 A;  2ECN A;  3C6W A;  1X4U A;  1WEP A;  4YAD A;  2FSA A;  2KU3 A;  4MVT A;  2MA6 A;  4FO9 A;  4GB0 A;  4UI9 B;  1RMD A;  3FL2 A;  4WZ2 A;  4ZQL A;  3U5M A;  4V3L C;  2EA6 A;  2KE1 A;  2MD8 C;  3ZPV E;  3PUQ A;  3HCU A;  3PUR A;  3O36 A;  2YW8 A;  5H1V A;  5TDW A;  4AYC B;  4A4C A;  2YRE A;  3O70 A;  2HDP A;  4LAD B;  4WZ0 A;  3KV5 A;  1HYI A;  4WZ3 B;  1WE9 A;  2VJE A;  2VJF B;  3EB5 A;  3LQH A;  4YAX A;  4W4U A;  1VD4 A;  5LKZ A;  5KH7 A;  5B77 A;  2YT5 A;  1HYJ A;  2G45 A;  2MIQ A;  5B79 A;  2DX8 A;  5TAB A;  2ZET C;  2ECT A;  4GNF A;  5KH3 A;  2LGK A;  1WIM A;  2MT5 A;  2ECI A;  2FUU A;  3RPG C;  2Y1M A;  3ASL A;  2E6S A;  2MD7 B;  5G05 B;  2CSY A;  2C2V S;  2KIZ A;  2UZG A;  5FER A;  1WEW A;  4BHW A;  2VPD A;  1WIL A;  3LQJ A;  4CA1 A;  2LGG A;  4I7C A;  3O34 A;  4XI1 A;  4YC9 A;  3I2D A;  2KWK A;  2QJ0 A;  1LDJ B;  1WEU A;  5EYA F;  1K2F A;  1T1H A;  3L11 A;  5TRB A;  2AN6 A;  5G0F A;  4Q6F A;  4AYC A;  3DPL R;  4YAB A;  3MHS A;  2YHO A;  2YUR A;  2LN0 A;  4UP5 A;  2EOD A;  5TBN A;  2ECV A;  3O35 A;  2VJF A;  3M62 A;  5D1K B;  1JM7 A;  2MNZ A;  1WEQ A;  5DIN A;  1E4U A;  2VP7 A;  4R2Y A;  3RTR B;  4AP4 A;  2YUC A;  4I7B A;  3ZYQ A;  2LDR A;  2PNX A;  2JMJ A;  3IHP A;  4P5O B;  1V87 A;  2K4D A;  1Z6U A;  4O64 A;  1U6G B;  4B86 C;  5B8D A;  1WEO A;  1ZBD B;  1LDK C;  2M3H A;  3N9L A;  2K16 A;  3U5O A;  2CT2 A;  4MSX A;  3N9N A;  1FBV A;  2L0B A;  5C13 A;  3N9Q A;  1WEE A;  2ECW A;  2YHN A;  4PPE A;  2LXP C;  1WES A;  2RSD A;  2L80 A;  2LV9 A;  3N9O A;  3MHH A;  1JM7 B;  3GV4 A;  4LK9 A;  4YAT A;  4AUQ B;  2LRI C;  1VYX A;  5H1T A;  1VFY A;  5B76 A;  4FK5 A;  4I7D A;  5LKX A;  2YQM A;  4N4F A;  3ZVZ B;  2MNY A;  2XEU A;  3L1Z B;  4QF2 A;  2D8S A;  2KWO A;  2LQ6 A;  5KH9 A;  4ZUX U;  1MM3 A;  2YU4 A;  2M1R A;  3RPG B;  3EB6 A;  2JRJ A;  2H0D B;  2KGG A;  4YBT A;  5C11 A;  4B7Y C;  4NN2 A;  2LGV A;  5AIU A;  3LRQ A;  1Z60 A;  4FIP A;  4GNE A;  3L1X A;  3M99 A;  3SOU A;  3SHB A;  4UP0 A;  4S3O B;  3V43 A;  4WA6 A;  2JMI A;  2L75 A;  1MM2 A;  5G04 B;  1FP0 A;  2VPB A;  3ZTG A;  4V3K C;  2VPE A;  2KYU A;  4TKP B;  1X4I A;  2EGP A;  2LGL A;  3PHD A;  2G6Q A;  2M85 A;  4YBS A;  1WFK A;  2KFT A;  3QZV A;  2KR4 A;  1BOR A;  4ZDT A;  2KWJ A;  2KWN A;  2F42 A;  4N3W A;  5LCW B;  5B78 A;  3ZNI A;  3HCS A;  2HYE D;  3KV6 A;  3O7A A;  2KGI A;  4LJN A;  4A49 A;  3C5K A;  3VK6 A;  3U5N A;  1WGM A;  4A0C D;  5JG6 A;  1XWH A;  2H0D A;  2Y1N A;  1X4J A;  5AIT A;  5H9M A;  2CKL B;  5FEY A;  2I50 A;  2Y43 A;  2RI7 A;  4LLB A;  2VPG A;  1Z2Q A;  4YBM A;  1G25 A;  2QIC A;  5D1M B;  5H1U A;  2OXQ C;  1JOC A;  3O33 A;  3KNV A;  2YSM A;  5J3X A;  1F62 A;  4F52 B;  1N87 A;  3NG2 A;  3N9M A;  1CHC A;  4PTB A;  5D1L B;  2IDA A;  3M63 A;  3T6R A;  3DQV R;  1IYM A;  3KQI A;  3GL6 A;  3O37 A;  1WEN A;  2L5U A;  2NAA A;  2YSJ A;  2ECG A;  2FUI A;  5I3L A;  2ECJ A;  2KRE A;  4QF3 A;  3T7L A;  2C2L A;  4BBQ A;  1WEM A;  2K17 A;  2XB1 A;  2PUY A;  2MA5 A;  2JMD A;  3ZPV 1;  2F6J A;  2M6M A;  4GND A;  4IC3 A;  4L58 A;  2CSZ A;  3SOW A;  5LKU A;  4LKA A;  2YQL A;  2BAY A;  3LQI A;  4IC2 A;  4L7X A;  1DVP A;  2QIZ A;  3U5P A;  2L43 A;  2E6R A;  5FB1 A;  4CCG X;  2CKL A;  5LKT A;  3N9P A;  4A4B A;  2VJE B;  4S3O C;  1WEV A;  4FJC A;  2G43 A;  5TDR A;  3HTK C;  4AVX A;  4C9Z A;  2VNF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...