2QICA

Crystal structure of the ing1 phd finger in complex with a histone h3k4me3 peptide
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
51
structure length
51
Chain Sequence
EPTYCLCNQVSYGEMIGCDNDECPIEWFHFSCVGLNHKPKGKWYCPKCRGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Histone H3K4me3 binding is required for the DNA repair and apoptotic activities of ING1 tumor suppressor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Antitumor protein, apoptosis
molecule keywords Inhibitor of growth protein 1
total genus 8
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 2007-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2qicA00
5AIUA 1Z60A 4L58A 2ECTA 2MNZA 4LLBA 2BAYA 4S3OB 2XB1A 3C6WA 4UP5A 1X4IA 3LQHA 4FIPA 4N4FA 2MNYA 2L43A 2YURA 4YADA 2KGGA 2CT2A 4ZDTA 4CA1A 2PUYA 3LQJA 3ZPVE 1JM7A 4XI1A 4QF3A 4O64A 4A4BA 4WZ0A 2E6RA 3O33A 2EA6A 2RSDA 5C11A 2CKLA 2LRIC 3DPLR 2H0DA 2HDPA 2L5UA 2CKLB 3EB5A 2LXPC 2H0DB 2CSZA 3HCSA 1X4JA 4YBSA 4X3GA 2LGVA 2FUIA 1WEVA 2KFTA 2VJEB 3ZYQA 1WEPA 3HCTA 5FERA 2ECNA 4IC3A 3KNVA 4AP4A 4I7CA 1BORA 4YC9A 5G0FA 1VFYA 4AYCA 2C2LA 3N9QA 2YSJA 2LXHC 4AYCB 1HYJA 2G43A 4GNDA 2XEUA 3QZVA 4R7EA 2ECIA 4A0CD 4C9ZA 3O36A 3N9OA 2L80A 1X4UA 4A49A 2C2VS 4YBTA 1T1HA 4Q6FA 4WA6A 4AVXA 1F62A 2NAAA 1RMDA 4WZ3B 4B86C 4YABA 1WESA 1LDKC 1MM3A 2VPGA 1E4UA 2M85A 4MSXA 3RPGB 4A4CA 3ZNIA 2QJ0A 5FEYA 3N9LA 3M62A 5LCWB 3DQVR 3PURA 1G25A 3M99A 2FSAA 3U5NA 2MT5A 5H1VA 3O35A 4W4UA 4S3OC 5DKAA 2LGLA 2KREA 3LRQA 3U5MA 2QICA 1FBVA 2M3HA 3SOUA 4GNEA 2M1RA 3GV4A 3O70A 2EODA 1FP0A 2MA5A 4FO9A 3T6RA 2DX8A 1HYIA 4V3LC 3C5KA 2M6MA 2OXQC 5EYAF 4PPEA 2LDRA 5FB1A 2VJFB 3HTKC 2KU3A 3L1ZB 3L1XA 3LQIA 1WEUA 1WILA 2VJFA 4WZ2A 3KV6A 5C13A 1WEWA 1IYMA 2KR4A 3MHSA 4L7XA 2MD8C 4P5OB 1WIMA 5KH9A 4LJNA 2UZGA 4V3KC 1WENA 2VNFA 1WEEA 2MIQA 5D1LB 3HCUA 2MA6A 2LN0A 3MHHA 1Z6UA 2ECJA 3ZVYA 5G05B 3O34A 5LKXA 2KWJA 2MD7B 1WFKA 3T7LA 2KWKA 1VD4A 2EGPA 4TKPB 1VYXA 2ZETC 3KQIA 3O7AA 2JMIA 4FJCA 1DVPA 5JG6A 4GNFA 4YBMA 2L0BA 3RTRB 5I3LA 2KGIA 1WGMA 5B75A 2KYUA 4I7BA 3IHPA 2KE1A 2G45A 2LGKA 4FK5A 5D1MB 2I50A 2FUUA 2L75A 2Y1MA 1N87A 2Y43A 1WEMA 1ZBDB 4B7YC 5H1UA 2KWOA 1JOCA 2YQLA 3SOXA 3V43A 2KIZA 5TBNA 1MM2A 4BHWA 2K1JA 2ECVA 5H9MA 1WEQA 3ZTGA 4R8PK 2MUMA 2YUCA 5B79A 2ECGA 4LKAA 4ZUXU 1WE9A 2JRJA 1Z2QA 2K17A 4CCGX 5DINA 2LQ6A 2RI7A 2YQMA 4ZQLA 2AN6A 5TDWA 4AUQB 2YW8A 1K2FA 5G04B 4F52B 4LADB 2YT5A 5H1TA 5KH3A 5KH7A 3KV5A 4R2YA 3N9PA 2YSMA 2VP7A 2IDAA 3N9NA 5B76A 2YHNA 4I7DA 2CSYA 1U6GB 2E6SA 2KWNA 2F42A 5TABA 4UP0A 2D8SA 2YYRA 2QIZA 4MVTA 2JMJA 4PTBA 5TDRA 4UI9B 5J3XA 4QF2A 3ZPV1 3PHDA 2VPEA 5B77A 4IC2A 1LDJB 1JM7B 2ECWA 5AITA 5B78A 5LKZA 4GNGA 2K16A 1WEOA 2PNXA 1V87A 2K4DA 3NG2A 5LKUA 3GL6A 4YAXA 3FL2A 4NN2A 2Y1NA 3RPGC 4BBQA 3N9MA 3M63A 2HYED 2VJEA 3EB6A 2F6JA 4N3WA 2G6QA 3I2DA 3ASLA 3U5PA 5D1KB 2YU4A 3PUQA 4GB0A 3O37A 1XWHA 5FB0A 4LK9A 5TRBA 5LKTA 1CHCA 2YREA 5B8DA 3L11A 2JMDA 2YHOA 2LGGA 3VK6A 3SOWA 3ZVZB 3U5OA 2F6NA 2VPBA 2LV9A 3SHBA 4YATA 2VPDA
chains in the Genus database with same CATH superfamily
5AIUA 4F1PA 1Z60A 3DWDA 2ECTA 4L58A 3KDEC 2MNZA 4LLBA 2BAYA 1MBMA 4S3OB 4H9DA 2XB1A 3C6WA 4UP5A 2DSMA 2KKYA 2P57A 5SVIB 1X4IA 3LQHA 4FIPA 4N4FA 2B0OE 2L43A 2MNYA 2YURA 3FJUB 4YADA 2KGGA 2CT2A 4ZDTA 4CA1A 2PUYA 3LQJA 3ZPVE 1JM7A 4XI1A 4QF3A 3Q1DA 4O64A 4A4BA 3LVRE 3FEHA 4WZ0A 2E6RA 3O33A 2EA6A 2RSDA 2KKXA 5C11A 2CKLA 2LRIC 3DPLR 2H0DA 2HDPA 4Z0RA 2L5UA 2CKLB 3EB5A 2LXPC 2H0DB 2CSZA 3HCSA 1X4JA 3FANA 4YBSA 4X3GA 5SVXA 2LGVA 2FUIA 1WEVA 5K3QA 2KFTA 2CSVA 2FD4A 2VJEB 3ZYQA 1WEPA 3HCTA 5FERA 2ECNA 4IC3A 3KNVA 4AP4A 4I7CA 1BORA 4YC9A 5G0FA 1VFYA 4AYCA 2OWAA 2C2LA 3N9QA 2YSJA 2LXHC 4AYCB 1HYJA 2G43A 4GNDA 2XEUA 3QZVA 4R7EA 2ECIA 2XOYA 4A0CD 4C9ZA 3MDBC 3O36A 3N9OA 2L80A 1X4UA 4A49A 2C2VS 4YBTA 1T1HA 4Q6FA 4WA6A 4AVXA 1F62A 2NAAA 1RMDA 4WZ3B 4B86C 4YABA 2E61A 1WESA 2CRRA 2MKEA 1LDKC 1MM3A 2VPGA 1E4UA 2M85A 2XOCA 4MSXA 3RPGB 4A4CA 3ZNIA 2QJ0A 5FEYA 3N9LA 3M62A 5LCWB 3DQVR 3PURA 1G25A 3M99A 2FSAA 3U5NA 2MT5A 5H1VA 1DCQA 3O35A 4W4UA 4S3OC 5DKAA 2LGLA 2KREA 3LRQA 3U5MA 2QICA 1FBVA 2M3HA 3SOUA 4GNEA 2M1RA 3GV4A 3O70A 2EODA 2RR4A 1FP0A 2MA5A 4FO9A 3T6RA 2DX8A 1HYIA 4V3LC 3C5KA 2M6MA 2OXQC 5EYAF 4PPEA 2LDRA 5FB1A 2VJFB 3DDTA 3HTKC 2KU3A 3L1ZB 3L1XA 3LQIA 1WEUA 1WILA 2VJFA 4WZ2A 3KV6A 5C13A 1WEWA 1IYMA 2D8UA 2KR4A 3MHSA 4L7XA 2MD8C 4P5OB 1WIMA 5KH9A 4LJNA 2UZGA 2JM3A 4V3KC 1WENA 4QQ4A 2VNFA 1WEEA 2MIQA 5D1LB 3HCUA 2MA6A 2LN0A 3MHHA 1Z6UA 2ECJA 3ZVYA 5G05B 3O34A 5LKXA 2KWJA 2MD7B 1WFKA 3T7LA 2KWKA 1VD4A 2EGPA 4TKPB 1VYXA 2ZETC 3KQIA 3O7AA 3FM8C 2JMIA 4FJCA 1DVPA 2M13A 5JG6A 4GNFA 4YBMA 2EGMA 3SUBA 3FAOA 2L0BA 3RTRB 5I3LA 2KGIA 3E2DA 1WGMA 4OGCA 5B75A 2KYUA 4I7BA 3IHPA 2KE1A 2G45A 2LGKA 4FK5A 5D1MB 2I50A 2FUUA 2L75A 2Y1MA 1N87A 2Y43A 1WEMA 1ZBDB 2FFWA 4B7YC 5H1UA 2KWOA 2YVRA 1JOCA 2YQLA 3SOXA 3V43A 2KIZA 5TBNA 1MM2A 4BHWA 2K1JA 2ECVA 5H9MA 1WEQA 3ZTGA 4R8PK 2MUMA 2YUCA 5B79A 2ECGA 4LKAA 4ZUXU 1WE9A 2JRJA 3PLWA 3M7KA 1Z2QA 2K17A 4CCGX 5DINA 2LQ6A 2RI7A 2YQMA 4ZQLA 2AN6A 5TDWA 2XOZA 4AUQB 2YW8A 1K2FA 2LAUA 5G04B 4F52B 4LADB 2YT5A 5H1TA 5KH3A 5KH7A 3KV5A 4R2YA 2L7PA 3N9PA 2YSMA 2EXUA 4O62A 2VP7A 2IDAA 3N9NA 5B76A 2YHNA 4I7DA 2CSYA 3LDYA 1U6GB 2E6SA 2KWNA 2F42A 5TABA 4UP0A 2D8SA 2YYRA 2QIZA 4MVTA 2JMJA 3H7HA 4PTBA 5SVIA 5TDRA 4UI9B 5J3XA 4QF2A 3ZPV1 3PHDA 2VPEA 4OGEA 5B77A 4IC2A 3JUEA 1LDJB 1JM7B 2ECWA 5AITA 5B78A 3O47A 3LVQE 5LKZA 4GNGA 2K16A 1WEOA 2PNXA 1V87A 2K4DA 3NG2A 5LKUA 3GL6A 4YAXA 3FL2A 4NN2A 2IQJA 2Y1NA 3RPGC 2CONA 4BBQA 3N9MA 3T9KA 3M63A 2HYED 5SVYA 2VJEA 3EB6A 2F6JA 2CRWA 4N3WA 2G6QA 3I2DA 2XP0A 3ASLA 3U5PA 5D1KB 2YU4A 3PUQA 4GB0A 3O37A 1XWHA 5FB0A 4LK9A 5TRBA 4Z0OA 5LKTA 1CHCA 2DJAA 2YREA 3L11A 5B8DA 2JMDA 2YHOA 2LGGA 3LJUX 3VK6A 3SOWA 3ZVZB 3U5OA 2F6NA 2JUNA 2VPBA 2LV9A 3SHBA 4YATA 2VPDA
chains in the Genus database with same CATH topology
5AIUA 1Z60A 4L58A 2ECTA 2MNZA 4LLBA 2BAYA 4S3OB 2XB1A 3C6WA 4UP5A 1X4IA 3LQHA 4FIPA 4N4FA 2MNYA 2L43A 2YURA 4YADA 2KGGA 2CT2A 4ZDTA 4CA1A 2PUYA 3LQJA 3ZPVE 1JM7A 4XI1A 4QF3A 4O64A 4A4BA 4WZ0A 2E6RA 3O33A 2EA6A 2RSDA 5C11A 2CKLA 2LRIC 3DPLR 2H0DA 2HDPA 2L5UA 2CKLB 3EB5A 2LXPC 2H0DB 2CSZA 3HCSA 1X4JA 4YBSA 4X3GA 2LGVA 2FUIA 1WEVA 2KFTA 2VJEB 3ZYQA 1WEPA 3HCTA 5FERA 2ECNA 4IC3A 3KNVA 4AP4A 4I7CA 1BORA 4YC9A 5G0FA 1VFYA 4AYCA 2C2LA 3N9QA 2YSJA 2LXHC 4AYCB 1HYJA 2G43A 4GNDA 2XEUA 3QZVA 4R7EA 2ECIA 4A0CD 4C9ZA 3O36A 3N9OA 2L80A 1X4UA 4A49A 2C2VS 4YBTA 1T1HA 4Q6FA 4WA6A 4AVXA 1F62A 2NAAA 1RMDA 4WZ3B 4B86C 4YABA 1WESA 1LDKC 1MM3A 2VPGA 1E4UA 2M85A 4MSXA 3RPGB 4A4CA 3ZNIA 2QJ0A 5FEYA 3N9LA 3M62A 5LCWB 3DQVR 3PURA 1G25A 3M99A 2FSAA 3U5NA 2MT5A 5H1VA 3O35A 4W4UA 4S3OC 5DKAA 2LGLA 2KREA 3LRQA 3U5MA 2QICA 1FBVA 2M3HA 3SOUA 4GNEA 2M1RA 3GV4A 3O70A 2EODA 1FP0A 2MA5A 4FO9A 3T6RA 2DX8A 1HYIA 4V3LC 3C5KA 2M6MA 2OXQC 5EYAF 4PPEA 2LDRA 5FB1A 2VJFB 3HTKC 2KU3A 3L1ZB 3L1XA 3LQIA 1WEUA 1WILA 2VJFA 4WZ2A 3KV6A 5C13A 1WEWA 1IYMA 2KR4A 3MHSA 4L7XA 2MD8C 4P5OB 1WIMA 5KH9A 4LJNA 2UZGA 4V3KC 1WENA 2VNFA 1WEEA 2MIQA 5D1LB 3HCUA 2MA6A 2LN0A 3MHHA 1Z6UA 2ECJA 3ZVYA 5G05B 3O34A 5LKXA 2KWJA 2MD7B 1WFKA 3T7LA 2KWKA 1VD4A 2EGPA 4TKPB 1VYXA 2ZETC 3KQIA 3O7AA 2JMIA 4FJCA 1DVPA 5JG6A 4GNFA 4YBMA 2L0BA 3RTRB 5I3LA 2KGIA 1WGMA 5B75A 2KYUA 4I7BA 3IHPA 2KE1A 2G45A 2LGKA 4FK5A 5D1MB 2I50A 2FUUA 2L75A 2Y1MA 1N87A 2Y43A 1WEMA 1ZBDB 4B7YC 5H1UA 2KWOA 1JOCA 2YQLA 3SOXA 3V43A 2KIZA 5TBNA 1MM2A 4BHWA 2K1JA 2ECVA 5H9MA 1WEQA 3ZTGA 4R8PK 2MUMA 2YUCA 5B79A 2ECGA 4LKAA 4ZUXU 1WE9A 2JRJA 1Z2QA 2K17A 4CCGX 5DINA 2LQ6A 2RI7A 2YQMA 4ZQLA 2AN6A 5TDWA 4AUQB 2YW8A 1K2FA 5G04B 4F52B 4LADB 2YT5A 5H1TA 5KH3A 5KH7A 3KV5A 4R2YA 3N9PA 2YSMA 2VP7A 2IDAA 3N9NA 5B76A 2YHNA 4I7DA 2CSYA 1U6GB 2E6SA 2KWNA 2F42A 5TABA 4UP0A 2D8SA 2YYRA 2QIZA 4MVTA 2JMJA 4PTBA 5TDRA 4UI9B 5J3XA 4QF2A 3ZPV1 3PHDA 2VPEA 5B77A 4IC2A 1LDJB 1JM7B 2ECWA 5AITA 5B78A 5LKZA 4GNGA 2K16A 1WEOA 2PNXA 1V87A 2K4DA 3NG2A 5LKUA 3GL6A 4YAXA 3FL2A 4NN2A 2Y1NA 3RPGC 4BBQA 3N9MA 3M63A 2HYED 2VJEA 3EB6A 2F6JA 4N3WA 2G6QA 3I2DA 3ASLA 3U5PA 5D1KB 2YU4A 3PUQA 4GB0A 3O37A 1XWHA 5FB0A 4LK9A 5TRBA 5LKTA 1CHCA 2YREA 5B8DA 3L11A 2JMDA 2YHOA 2LGGA 3VK6A 3SOWA 3ZVZB 3U5OA 2F6NA 2VPBA 2LV9A 3SHBA 4YATA 2VPDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AIU A;  1Z60 A;  4L58 A;  2ECT A;  2MNZ A;  4LLB A;  2BAY A;  4S3O B;  2XB1 A;  3C6W A;  4UP5 A;  1X4I A;  3LQH A;  4FIP A;  4N4F A;  2MNY A;  2L43 A;  2YUR A;  4YAD A;  2KGG A;  2CT2 A;  4ZDT A;  4CA1 A;  2PUY A;  3LQJ A;  3ZPV E;  1JM7 A;  4XI1 A;  4QF3 A;  4O64 A;  4A4B A;  4WZ0 A;  2E6R A;  3O33 A;  2EA6 A;  2RSD A;  5C11 A;  2CKL A;  2LRI C;  3DPL R;  2H0D A;  2HDP A;  2L5U A;  2CKL B;  3EB5 A;  2LXP C;  2H0D B;  2CSZ A;  3HCS A;  1X4J A;  4YBS A;  4X3G A;  2LGV A;  2FUI A;  1WEV A;  2KFT A;  2VJE B;  3ZYQ A;  1WEP A;  3HCT A;  5FER A;  2ECN A;  4IC3 A;  3KNV A;  4AP4 A;  4I7C A;  1BOR A;  4YC9 A;  5G0F A;  1VFY A;  4AYC A;  2C2L A;  3N9Q A;  2YSJ A;  2LXH C;  4AYC B;  1HYJ A;  2G43 A;  4GND A;  2XEU A;  3QZV A;  4R7E A;  2ECI A;  4A0C D;  4C9Z A;  3O36 A;  3N9O A;  2L80 A;  1X4U A;  4A49 A;  2C2V S;  4YBT A;  1T1H A;  4Q6F A;  4WA6 A;  4AVX A;  1F62 A;  2NAA A;  1RMD A;  4WZ3 B;  4B86 C;  4YAB A;  1WES A;  1LDK C;  1MM3 A;  2VPG A;  1E4U A;  2M85 A;  4MSX A;  3RPG B;  4A4C A;  3ZNI A;  2QJ0 A;  5FEY A;  3N9L A;  3M62 A;  5LCW B;  3DQV R;  3PUR A;  1G25 A;  3M99 A;  2FSA A;  3U5N A;  2MT5 A;  5H1V A;  3O35 A;  4W4U A;  4S3O C;  5DKA A;  2LGL A;  2KRE A;  3LRQ A;  3U5M A;  2QIC A;  1FBV A;  2M3H A;  3SOU A;  4GNE A;  2M1R A;  3GV4 A;  3O70 A;  2EOD A;  1FP0 A;  2MA5 A;  4FO9 A;  3T6R A;  2DX8 A;  1HYI A;  4V3L C;  3C5K A;  2M6M A;  2OXQ C;  5EYA F;  4PPE A;  2LDR A;  5FB1 A;  2VJF B;  3HTK C;  2KU3 A;  3L1Z B;  3L1X A;  3LQI A;  1WEU A;  1WIL A;  2VJF A;  4WZ2 A;  3KV6 A;  5C13 A;  1WEW A;  1IYM A;  2KR4 A;  3MHS A;  4L7X A;  2MD8 C;  4P5O B;  1WIM A;  5KH9 A;  4LJN A;  2UZG A;  4V3K C;  1WEN A;  2VNF A;  1WEE A;  2MIQ A;  5D1L B;  3HCU A;  2MA6 A;  2LN0 A;  3MHH A;  1Z6U A;  2ECJ A;  3ZVY A;  5G05 B;  3O34 A;  5LKX A;  2KWJ A;  2MD7 B;  1WFK A;  3T7L A;  2KWK A;  1VD4 A;  2EGP A;  4TKP B;  1VYX A;  2ZET C;  3KQI A;  3O7A A;  2JMI A;  4FJC A;  1DVP A;  5JG6 A;  4GNF A;  4YBM A;  2L0B A;  3RTR B;  5I3L A;  2KGI A;  1WGM A;  5B75 A;  2KYU A;  4I7B A;  3IHP A;  2KE1 A;  2G45 A;  2LGK A;  4FK5 A;  5D1M B;  2I50 A;  2FUU A;  2L75 A;  2Y1M A;  1N87 A;  2Y43 A;  1WEM A;  1ZBD B;  4B7Y C;  5H1U A;  2KWO A;  1JOC A;  2YQL A;  3SOX A;  3V43 A;  2KIZ A;  5TBN A;  1MM2 A;  4BHW A;  2K1J A;  2ECV A;  5H9M A;  1WEQ A;  3ZTG A;  4R8P K;  2MUM A;  2YUC A;  5B79 A;  2ECG A;  4LKA A;  4ZUX U;  1WE9 A;  2JRJ A;  1Z2Q A;  2K17 A;  4CCG X;  5DIN A;  2LQ6 A;  2RI7 A;  2YQM A;  4ZQL A;  2AN6 A;  5TDW A;  4AUQ B;  2YW8 A;  1K2F A;  5G04 B;  4F52 B;  4LAD B;  2YT5 A;  5H1T A;  5KH3 A;  5KH7 A;  3KV5 A;  4R2Y A;  3N9P A;  2YSM A;  2VP7 A;  2IDA A;  3N9N A;  5B76 A;  2YHN A;  4I7D A;  2CSY A;  1U6G B;  2E6S A;  2KWN A;  2F42 A;  5TAB A;  4UP0 A;  2D8S A;  2YYR A;  2QIZ A;  4MVT A;  2JMJ A;  4PTB A;  5TDR A;  4UI9 B;  5J3X A;  4QF2 A;  3ZPV 1;  3PHD A;  2VPE A;  5B77 A;  4IC2 A;  1LDJ B;  1JM7 B;  2ECW A;  5AIT A;  5B78 A;  5LKZ A;  4GNG A;  2K16 A;  1WEO A;  2PNX A;  1V87 A;  2K4D A;  3NG2 A;  5LKU A;  3GL6 A;  4YAX A;  3FL2 A;  4NN2 A;  2Y1N A;  3RPG C;  4BBQ A;  3N9M A;  3M63 A;  2HYE D;  2VJE A;  3EB6 A;  2F6J A;  4N3W A;  2G6Q A;  3I2D A;  3ASL A;  3U5P A;  5D1K B;  2YU4 A;  3PUQ A;  4GB0 A;  3O37 A;  1XWH A;  5FB0 A;  4LK9 A;  5TRB A;  5LKT A;  1CHC A;  2YRE A;  5B8D A;  3L11 A;  2JMD A;  2YHO A;  2LGG A;  3VK6 A;  3SOW A;  3ZVZ B;  3U5O A;  2F6N A;  2VPB A;  2LV9 A;  3SHB A;  4YAT A;  2VPD A; 
#chains in the Genus database with same CATH topology
 5AIU A;  4F1P A;  1Z60 A;  3DWD A;  2ECT A;  4L58 A;  3KDE C;  2MNZ A;  4LLB A;  2BAY A;  1MBM A;  4S3O B;  4H9D A;  2XB1 A;  3C6W A;  4UP5 A;  2DSM A;  2KKY A;  2P57 A;  5SVI B;  1X4I A;  3LQH A;  4FIP A;  4N4F A;  2B0O E;  2L43 A;  2MNY A;  2YUR A;  3FJU B;  4YAD A;  2KGG A;  2CT2 A;  4ZDT A;  4CA1 A;  2PUY A;  3LQJ A;  3ZPV E;  1JM7 A;  4XI1 A;  4QF3 A;  3Q1D A;  4O64 A;  4A4B A;  3LVR E;  3FEH A;  4WZ0 A;  2E6R A;  3O33 A;  2EA6 A;  2RSD A;  2KKX A;  5C11 A;  2CKL A;  2LRI C;  3DPL R;  2H0D A;  2HDP A;  4Z0R A;  2L5U A;  2CKL B;  3EB5 A;  2LXP C;  2H0D B;  2CSZ A;  3HCS A;  1X4J A;  3FAN A;  4YBS A;  4X3G A;  5SVX A;  2LGV A;  2FUI A;  1WEV A;  5K3Q A;  2KFT A;  2CSV A;  2FD4 A;  2VJE B;  3ZYQ A;  1WEP A;  3HCT A;  5FER A;  2ECN A;  4IC3 A;  3KNV A;  4AP4 A;  4I7C A;  1BOR A;  4YC9 A;  5G0F A;  1VFY A;  4AYC A;  2OWA A;  2C2L A;  3N9Q A;  2YSJ A;  2LXH C;  4AYC B;  1HYJ A;  2G43 A;  4GND A;  2XEU A;  3QZV A;  4R7E A;  2ECI A;  2XOY A;  4A0C D;  4C9Z A;  3MDB C;  3O36 A;  3N9O A;  2L80 A;  1X4U A;  4A49 A;  2C2V S;  4YBT A;  1T1H A;  4Q6F A;  4WA6 A;  4AVX A;  1F62 A;  2NAA A;  1RMD A;  4WZ3 B;  4B86 C;  4YAB A;  2E61 A;  1WES A;  2CRR A;  2MKE A;  1LDK C;  1MM3 A;  2VPG A;  1E4U A;  2M85 A;  2XOC A;  4MSX A;  3RPG B;  4A4C A;  3ZNI A;  2QJ0 A;  5FEY A;  3N9L A;  3M62 A;  5LCW B;  3DQV R;  3PUR A;  1G25 A;  3M99 A;  2FSA A;  3U5N A;  2MT5 A;  5H1V A;  1DCQ A;  3O35 A;  4W4U A;  4S3O C;  5DKA A;  2LGL A;  2KRE A;  3LRQ A;  3U5M A;  2QIC A;  1FBV A;  2M3H A;  3SOU A;  4GNE A;  2M1R A;  3GV4 A;  3O70 A;  2EOD A;  2RR4 A;  1FP0 A;  2MA5 A;  4FO9 A;  3T6R A;  2DX8 A;  1HYI A;  4V3L C;  3C5K A;  2M6M A;  2OXQ C;  5EYA F;  4PPE A;  2LDR A;  5FB1 A;  2VJF B;  3DDT A;  3HTK C;  2KU3 A;  3L1Z B;  3L1X A;  3LQI A;  1WEU A;  1WIL A;  2VJF A;  4WZ2 A;  3KV6 A;  5C13 A;  1WEW A;  1IYM A;  2D8U A;  2KR4 A;  3MHS A;  4L7X A;  2MD8 C;  4P5O B;  1WIM A;  5KH9 A;  4LJN A;  2UZG A;  2JM3 A;  4V3K C;  1WEN A;  4QQ4 A;  2VNF A;  1WEE A;  2MIQ A;  5D1L B;  3HCU A;  2MA6 A;  2LN0 A;  3MHH A;  1Z6U A;  2ECJ A;  3ZVY A;  5G05 B;  3O34 A;  5LKX A;  2KWJ A;  2MD7 B;  1WFK A;  3T7L A;  2KWK A;  1VD4 A;  2EGP A;  4TKP B;  1VYX A;  2ZET C;  3KQI A;  3O7A A;  3FM8 C;  2JMI A;  4FJC A;  1DVP A;  2M13 A;  5JG6 A;  4GNF A;  4YBM A;  2EGM A;  3SUB A;  3FAO A;  2L0B A;  3RTR B;  5I3L A;  2KGI A;  3E2D A;  1WGM A;  4OGC A;  5B75 A;  2KYU A;  4I7B A;  3IHP A;  2KE1 A;  2G45 A;  2LGK A;  4FK5 A;  5D1M B;  2I50 A;  2FUU A;  2L75 A;  2Y1M A;  1N87 A;  2Y43 A;  1WEM A;  1ZBD B;  2FFW A;  4B7Y C;  5H1U A;  2KWO A;  2YVR A;  1JOC A;  2YQL A;  3SOX A;  3V43 A;  2KIZ A;  5TBN A;  1MM2 A;  4BHW A;  2K1J A;  2ECV A;  5H9M A;  1WEQ A;  3ZTG A;  4R8P K;  2MUM A;  2YUC A;  5B79 A;  2ECG A;  4LKA A;  4ZUX U;  1WE9 A;  2JRJ A;  3PLW A;  3M7K A;  1Z2Q A;  2K17 A;  4CCG X;  5DIN A;  2LQ6 A;  2RI7 A;  2YQM A;  4ZQL A;  2AN6 A;  5TDW A;  2XOZ A;  4AUQ B;  2YW8 A;  1K2F A;  2LAU A;  5G04 B;  4F52 B;  4LAD B;  2YT5 A;  5H1T A;  5KH3 A;  5KH7 A;  3KV5 A;  4R2Y A;  2L7P A;  3N9P A;  2YSM A;  2EXU A;  4O62 A;  2VP7 A;  2IDA A;  3N9N A;  5B76 A;  2YHN A;  4I7D A;  2CSY A;  3LDY A;  1U6G B;  2E6S A;  2KWN A;  2F42 A;  5TAB A;  4UP0 A;  2D8S A;  2YYR A;  2QIZ A;  4MVT A;  2JMJ A;  3H7H A;  4PTB A;  5SVI A;  5TDR A;  4UI9 B;  5J3X A;  4QF2 A;  3ZPV 1;  3PHD A;  2VPE A;  4OGE A;  5B77 A;  4IC2 A;  3JUE A;  1LDJ B;  1JM7 B;  2ECW A;  5AIT A;  5B78 A;  3O47 A;  3LVQ E;  5LKZ A;  4GNG A;  2K16 A;  1WEO A;  2PNX A;  1V87 A;  2K4D A;  3NG2 A;  5LKU A;  3GL6 A;  4YAX A;  3FL2 A;  4NN2 A;  2IQJ A;  2Y1N A;  3RPG C;  2CON A;  4BBQ A;  3N9M A;  3T9K A;  3M63 A;  2HYE D;  5SVY A;  2VJE A;  3EB6 A;  2F6J A;  2CRW A;  4N3W A;  2G6Q A;  3I2D A;  2XP0 A;  3ASL A;  3U5P A;  5D1K B;  2YU4 A;  3PUQ A;  4GB0 A;  3O37 A;  1XWH A;  5FB0 A;  4LK9 A;  5TRB A;  4Z0O A;  5LKT A;  1CHC A;  2DJA A;  2YRE A;  3L11 A;  5B8D A;  2JMD A;  2YHO A;  2LGG A;  3LJU X;  3VK6 A;  3SOW A;  3ZVZ B;  3U5O A;  2F6N A;  2JUN A;  2VPB A;  2LV9 A;  3SHB A;  4YAT A;  2VPD A; 
#chains in the Genus database with same CATH homology
 5AIU A;  1Z60 A;  4L58 A;  2ECT A;  2MNZ A;  4LLB A;  2BAY A;  4S3O B;  2XB1 A;  3C6W A;  4UP5 A;  1X4I A;  3LQH A;  4FIP A;  4N4F A;  2MNY A;  2L43 A;  2YUR A;  4YAD A;  2KGG A;  2CT2 A;  4ZDT A;  4CA1 A;  2PUY A;  3LQJ A;  3ZPV E;  1JM7 A;  4XI1 A;  4QF3 A;  4O64 A;  4A4B A;  4WZ0 A;  2E6R A;  3O33 A;  2EA6 A;  2RSD A;  5C11 A;  2CKL A;  2LRI C;  3DPL R;  2H0D A;  2HDP A;  2L5U A;  2CKL B;  3EB5 A;  2LXP C;  2H0D B;  2CSZ A;  3HCS A;  1X4J A;  4YBS A;  4X3G A;  2LGV A;  2FUI A;  1WEV A;  2KFT A;  2VJE B;  3ZYQ A;  1WEP A;  3HCT A;  5FER A;  2ECN A;  4IC3 A;  3KNV A;  4AP4 A;  4I7C A;  1BOR A;  4YC9 A;  5G0F A;  1VFY A;  4AYC A;  2C2L A;  3N9Q A;  2YSJ A;  2LXH C;  4AYC B;  1HYJ A;  2G43 A;  4GND A;  2XEU A;  3QZV A;  4R7E A;  2ECI A;  4A0C D;  4C9Z A;  3O36 A;  3N9O A;  2L80 A;  1X4U A;  4A49 A;  2C2V S;  4YBT A;  1T1H A;  4Q6F A;  4WA6 A;  4AVX A;  1F62 A;  2NAA A;  1RMD A;  4WZ3 B;  4B86 C;  4YAB A;  1WES A;  1LDK C;  1MM3 A;  2VPG A;  1E4U A;  2M85 A;  4MSX A;  3RPG B;  4A4C A;  3ZNI A;  2QJ0 A;  5FEY A;  3N9L A;  3M62 A;  5LCW B;  3DQV R;  3PUR A;  1G25 A;  3M99 A;  2FSA A;  3U5N A;  2MT5 A;  5H1V A;  3O35 A;  4W4U A;  4S3O C;  5DKA A;  2LGL A;  2KRE A;  3LRQ A;  3U5M A;  2QIC A;  1FBV A;  2M3H A;  3SOU A;  4GNE A;  2M1R A;  3GV4 A;  3O70 A;  2EOD A;  1FP0 A;  2MA5 A;  4FO9 A;  3T6R A;  2DX8 A;  1HYI A;  4V3L C;  3C5K A;  2M6M A;  2OXQ C;  5EYA F;  4PPE A;  2LDR A;  5FB1 A;  2VJF B;  3HTK C;  2KU3 A;  3L1Z B;  3L1X A;  3LQI A;  1WEU A;  1WIL A;  2VJF A;  4WZ2 A;  3KV6 A;  5C13 A;  1WEW A;  1IYM A;  2KR4 A;  3MHS A;  4L7X A;  2MD8 C;  4P5O B;  1WIM A;  5KH9 A;  4LJN A;  2UZG A;  4V3K C;  1WEN A;  2VNF A;  1WEE A;  2MIQ A;  5D1L B;  3HCU A;  2MA6 A;  2LN0 A;  3MHH A;  1Z6U A;  2ECJ A;  3ZVY A;  5G05 B;  3O34 A;  5LKX A;  2KWJ A;  2MD7 B;  1WFK A;  3T7L A;  2KWK A;  1VD4 A;  2EGP A;  4TKP B;  1VYX A;  2ZET C;  3KQI A;  3O7A A;  2JMI A;  4FJC A;  1DVP A;  5JG6 A;  4GNF A;  4YBM A;  2L0B A;  3RTR B;  5I3L A;  2KGI A;  1WGM A;  5B75 A;  2KYU A;  4I7B A;  3IHP A;  2KE1 A;  2G45 A;  2LGK A;  4FK5 A;  5D1M B;  2I50 A;  2FUU A;  2L75 A;  2Y1M A;  1N87 A;  2Y43 A;  1WEM A;  1ZBD B;  4B7Y C;  5H1U A;  2KWO A;  1JOC A;  2YQL A;  3SOX A;  3V43 A;  2KIZ A;  5TBN A;  1MM2 A;  4BHW A;  2K1J A;  2ECV A;  5H9M A;  1WEQ A;  3ZTG A;  4R8P K;  2MUM A;  2YUC A;  5B79 A;  2ECG A;  4LKA A;  4ZUX U;  1WE9 A;  2JRJ A;  1Z2Q A;  2K17 A;  4CCG X;  5DIN A;  2LQ6 A;  2RI7 A;  2YQM A;  4ZQL A;  2AN6 A;  5TDW A;  4AUQ B;  2YW8 A;  1K2F A;  5G04 B;  4F52 B;  4LAD B;  2YT5 A;  5H1T A;  5KH3 A;  5KH7 A;  3KV5 A;  4R2Y A;  3N9P A;  2YSM A;  2VP7 A;  2IDA A;  3N9N A;  5B76 A;  2YHN A;  4I7D A;  2CSY A;  1U6G B;  2E6S A;  2KWN A;  2F42 A;  5TAB A;  4UP0 A;  2D8S A;  2YYR A;  2QIZ A;  4MVT A;  2JMJ A;  4PTB A;  5TDR A;  4UI9 B;  5J3X A;  4QF2 A;  3ZPV 1;  3PHD A;  2VPE A;  5B77 A;  4IC2 A;  1LDJ B;  1JM7 B;  2ECW A;  5AIT A;  5B78 A;  5LKZ A;  4GNG A;  2K16 A;  1WEO A;  2PNX A;  1V87 A;  2K4D A;  3NG2 A;  5LKU A;  3GL6 A;  4YAX A;  3FL2 A;  4NN2 A;  2Y1N A;  3RPG C;  4BBQ A;  3N9M A;  3M63 A;  2HYE D;  2VJE A;  3EB6 A;  2F6J A;  4N3W A;  2G6Q A;  3I2D A;  3ASL A;  3U5P A;  5D1K B;  2YU4 A;  3PUQ A;  4GB0 A;  3O37 A;  1XWH A;  5FB0 A;  4LK9 A;  5TRB A;  5LKT A;  1CHC A;  2YRE A;  5B8D A;  3L11 A;  2JMD A;  2YHO A;  2LGG A;  3VK6 A;  3SOW A;  3ZVZ B;  3U5O A;  2F6N A;  2VPB A;  2LV9 A;  3SHB A;  4YAT A;  2VPD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...