2QICA

Crystal structure of the ing1 phd finger in complex with a histone h3k4me3 peptide
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
51
structure length
51
Chain Sequence
EPTYCLCNQVSYGEMIGCDNDECPIEWFHFSCVGLNHKPKGKWYCPKCRGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Antitumor protein, apoptosis
molecule keywords Inhibitor of growth protein 1
publication title Histone H3K4me3 binding is required for the DNA repair and apoptotic activities of ING1 tumor suppressor.
pubmed doi rcsb
source organism Homo sapiens
total genus 8
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 2007-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2qicA00
2LXHC 2K4DA 5D1KB 1CHCA 2JMJA 2BAYA 2EGPA 3DQVR 5B78A 1WESA 1WFKA 2K16A 4YAXA 5KH9A 1V87A 1ZBDB 2F42A 2ECTA 2YSMA 3LQHA 4I7BA 2MNYA 1VD4A 2K17A 2MD8C 3PHDA 2RSDA 3SOXA 4ZUXU 4O64A 4S3OC 2VPBA 3IHPA 3KQIA 2KR4A 3ZTGA 4WZ2A 4XI1A 2CT2A 4YADA 3HCUA 1WIMA 5AIUA 3T6RA 5TABA 1WENA 2KWNA 2XB1A 4A0CD 2YQMA 2LN0A 4FO9A 4YC9A 2LGVA 2CKLB 1X4IA 2D8SA 3N9QA 4WZ0A 2MA6A 1FBVA 5D1LB 5DKAA 4CCGX 3ZNIA 2L75A 3QZVA 2CSZA 3KV6A 3L11A 2ECIA 2YHOA 1XWHA 2FSAA 3O35A 1FP0A 4B86C 1E4UA 1WEPA 1WEOA 2H0DA 2ECVA 2Y1NA 4LK9A 5DINA 1Z60A 4YATA 4R7EA 1WEUA 4LLBA 2VP7A 2YHNA 3GL6A 1WEMA 1VFYA 4QF2A 4MVTA 2F6NA 4R2YA 3RPGC 3N9MA 4IC2A 3O34A 4N4FA 4GNGA 2KU3A 5KH7A 5LKUA 3SOWA 2C2VS 1N87A 5G04B 2DX8A 5TRBA 4BBQA 4V3KC 4YABA 2L43A 1MM2A 5TDRA 4I7DA 5LKTA 4NN2A 4L7XA 1JM7B 3MHHA 2VJEB 2QJ0A 4L58A 3VK6A 2JMDA 2XEUA 2HYED 5TDWA 3ZYQA 5G05B 3EB6A 2VJFB 4LKAA 4AYCB 4LADB 5H9MA 2PUYA 3ZPVE 2YUCA 2CKLA 4W4UA 5LKZA 2JRJA 2YT5A 5C13A 5FERA 4PTBA 2M6MA 2M85A 4GB0A 3HTKC 5H1VA 4ZQLA 3M99A 2LGLA 3FL2A 2FUIA 4A4CA 2KWOA 2M3HA 4N3WA 3O33A 5J3XA 1HYIA 2YURA 3O70A 2MT5A 2HDPA 3U5NA 1Z6UA 2ECWA 2C2LA 4TKPB 5H1TA 2EODA 3ZVYA 2G6QA 3V43A 1IYMA 2ECGA 2F6JA 2JMIA 3PUQA 2YREA 1WEEA 3O36A 2RI7A 4IC3A 5H1UA 2K1JA 4A4BA 3HCTA 4F52B 3I2DA 2G43A 3O7AA 4UI9B 5B75A 2CSYA 4C9ZA 1JOCA 5KH3A 2OXQC 2VJFA 2YYRA 1X4UA 4AYCA 3M62A 2KGIA 2LV9A 3N9LA 2LGKA 5D1MB 4WZ3B 2YSJA 2ECNA 3LQIA 3RTRB 2YU4A 4X3GA 2MA5A 4Q6FA 2QIZA 3C5KA 5LKXA 2KIZA 1WGMA 1T1HA 3ZVZB 2G45A 2E6RA 4GNFA 1WILA 3ASLA 3C6WA 3LRQA 2LQ6A 2KWJA 2IDAA 5B76A 2KGGA 1X4JA 4MSXA 4UP5A 5FB0A 1HYJA 2H0DB 2VPDA 2PNXA 1WEQA 2LXPC 3SHBA 4FJCA 2ZETC 5B8DA 2MUMA 2QICA 4ZDTA 1LDKC 3O37A 3HCSA 3LQJA 4UP0A 1RMDA 3RPGB 5AITA 2M1RA 4A49A 4R8PK 3PURA 3M63A 3U5MA 4I7CA 4PPEA 1DVPA 5B77A 1Z2QA 4FK5A 4P5OB 5EYAF 1WEWA 3DPLR 5FEYA 4QF3A 3GV4A 1BORA 2VPEA 2Y1MA 1U6GB 4GNEA 4YBMA 2LGGA 3KV5A 4BHWA 3T7LA 2Y43A 2FUUA 2L5UA 1JM7A 4LJNA 2VJEA 3U5OA 3L1ZB 2VPGA 2KYUA 3N9PA 2AN6A 2E6SA 5B79A 1F62A 4AUQB 1MM3A 5FB1A 2UZGA 5TBNA 2EA6A 2LRIC 4S3OB 4WA6A 1WE9A 3N9OA 4CA1A 5I3LA 3SOUA 1K2FA 2YQLA 3N9NA 4YBSA 4V3LC 1G25A 5JG6A 2KE1A 2MD7B 3KNVA 1LDJB 3MHSA 2KFTA 4GNDA 5G0FA 2I50A 4AVXA 4FIPA 3L1XA 2VNFA 2L0BA 2LDRA 2KWKA 4B7YC 2MNZA 3ZPV1 3U5PA 2MIQA 1VYXA 4YBTA 2ECJA 2NAAA 3EB5A 4AP4A 2KREA 5LCWB 5C11A 3NG2A 2L80A 1WEVA 2YW8A
chains in the Genus database with same CATH superfamily
2LXHC 2K4DA 5D1KB 1CHCA 2JMJA 2BAYA 2EGPA 3PLWA 3FM8C 3DQVR 2P57A 5B78A 1WESA 1WFKA 2K16A 4YAXA 5KH9A 1V87A 1ZBDB 2F42A 2ECTA 2YSMA 3LQHA 4I7BA 2MNYA 1VD4A 2K17A 2MD8C 3PHDA 2RSDA 3SOXA 4ZUXU 4O64A 4S3OC 2VPBA 3IHPA 3KQIA 2KR4A 3ZTGA 4WZ2A 4XI1A 3LDYA 2CT2A 4YADA 3HCUA 1WIMA 5AIUA 3T6RA 5TABA 1WENA 2KWNA 2D8UA 2XB1A 4A0CD 2YQMA 2LN0A 4FO9A 4YC9A 2LGVA 2CKLB 1X4IA 2M13A 2D8SA 3N9QA 4WZ0A 2EGMA 3FAOA 2MA6A 1FBVA 5D1LB 5DKAA 4CCGX 3ZNIA 5SVYA 2L75A 3QZVA 2CSZA 3KV6A 3L11A 2ECIA 2YHOA 1XWHA 2FSAA 3O35A 1FP0A 2EXUA 4B86C 1E4UA 1WEPA 1WEOA 2H0DA 4F1PA 2ECVA 2Y1NA 4LK9A 3KDEC 5DINA 1Z60A 4YATA 4R7EA 1WEUA 4LLBA 2VP7A 2YHNA 3GL6A 1WEMA 1VFYA 4QF2A 4MVTA 2F6NA 4R2YA 3RPGC 4OGCA 3N9MA 4IC2A 3O34A 4N4FA 4GNGA 2KU3A 5KH7A 2OWAA 5LKUA 2XOYA 3SOWA 2C2VS 1N87A 5G04B 2DX8A 5TRBA 4Z0OA 4BBQA 4V3KC 4YABA 2L43A 1MM2A 5TDRA 4I7DA 5LKTA 4NN2A 4L7XA 1JM7B 3MHHA 2VJEB 2QJ0A 4O62A 4L58A 3VK6A 3FEHA 2JMDA 2XEUA 2HYED 5TDWA 3ZYQA 2FD4A 5G05B 3EB6A 2VJFB 4LKAA 4AYCB 4LADB 5H9MA 2PUYA 3ZPVE 2YUCA 2CKLA 4W4UA 3LVQE 5LKZA 2JRJA 2YT5A 5C13A 5FERA 4PTBA 2M6MA 2KKYA 1MBMA 2M85A 4GB0A 3HTKC 5H1VA 4ZQLA 3M99A 4Z0RA 2LGLA 3FL2A 2FUIA 4A4CA 2KWOA 2M3HA 4N3WA 3O33A 5J3XA 1HYIA 3FANA 2YURA 3O70A 2MT5A 2HDPA 3U5NA 1Z6UA 2ECWA 3DWDA 2C2LA 4TKPB 5H1TA 2EODA 2KKXA 3ZVYA 2G6QA 3V43A 1IYMA 2ECGA 2F6JA 2L7PA 2JMIA 3PUQA 2YREA 1WEEA 3SUBA 3O36A 2RI7A 2RR4A 4IC3A 5H1UA 2K1JA 4A4BA 3HCTA 5SVIA 4F52B 3I2DA 2G43A 3O7AA 4UI9B 5B75A 3H7HA 2CSYA 4C9ZA 1JOCA 5KH3A 2OXQC 2VJFA 2CRRA 2YYRA 1X4UA 4AYCA 3M62A 2KGIA 2LV9A 2XOZA 3N9LA 2LGKA 5D1MB 4WZ3B 2YSJA 2ECNA 3LQIA 3RTRB 2YU4A 4X3GA 2FFWA 2JM3A 2MA5A 4Q6FA 2QIZA 3C5KA 2B0OE 5LKXA 2KIZA 1WGMA 1T1HA 3ZVZB 2G45A 2E6RA 4GNFA 1WILA 3ASLA 3C6WA 3LRQA 2LQ6A 2KWJA 2XP0A 2IDAA 1DCQA 5B76A 2KGGA 1X4JA 4MSXA 4UP5A 5FB0A 1HYJA 2H0DB 2VPDA 2PNXA 1WEQA 2LXPC 3SHBA 4FJCA 5K3QA 2ZETC 5B8DA 3O47A 2MUMA 2QICA 3FJUB 4ZDTA 1LDKC 3O37A 2JUNA 3HCSA 3LQJA 4UP0A 1RMDA 3RPGB 2MKEA 3LJUX 5AITA 2M1RA 4A49A 4R8PK 3PURA 3M63A 3U5MA 4I7CA 4PPEA 2DJAA 1DVPA 5B77A 1Z2QA 4H9DA 4FK5A 3JUEA 4P5OB 2CSVA 1WEWA 5EYAF 3DPLR 5FEYA 3T9KA 4QF3A 3GV4A 1BORA 2VPEA 2Y1MA 1U6GB 4GNEA 2YVRA 4YBMA 2LGGA 3KV5A 4BHWA 3T7LA 2Y43A 2FUUA 2L5UA 1JM7A 4LJNA 2VJEA 3U5OA 3L1ZB 3DDTA 2VPGA 2KYUA 3MDBC 3N9PA 2AN6A 2DSMA 2E6SA 5B79A 1F62A 4AUQB 2IQJA 1MM3A 5FB1A 2UZGA 5TBNA 2EA6A 2LRIC 4S3OB 4WA6A 3LVRE 1WE9A 3N9OA 4CA1A 5I3LA 3SOUA 1K2FA 2YQLA 4OGEA 3N9NA 4YBSA 4V3LC 1G25A 5JG6A 2KE1A 2MD7B 3E2DA 1LDJB 3KNVA 3MHSA 4QQ4A 2KFTA 4GNDA 5G0FA 2I50A 4AVXA 2CRWA 4FIPA 3L1XA 3Q1DA 2VNFA 2L0BA 2LDRA 3M7KA 2KWKA 4B7YC 2MNZA 3ZPV1 3U5PA 2MIQA 1VYXA 2CONA 2E61A 4YBTA 2ECJA 2NAAA 3EB5A 5SVIB 2LAUA 4AP4A 2KREA 5LCWB 2XOCA 5SVXA 5C11A 3NG2A 2L80A 1WEVA 2YW8A
chains in the Genus database with same CATH topology
2LXHC 2K4DA 5D1KB 1CHCA 2JMJA 2BAYA 2EGPA 3DQVR 5B78A 1WESA 1WFKA 2K16A 4YAXA 5KH9A 1V87A 1ZBDB 2F42A 2ECTA 2YSMA 3LQHA 4I7BA 2MNYA 1VD4A 2K17A 2MD8C 3PHDA 2RSDA 3SOXA 4ZUXU 4O64A 4S3OC 2VPBA 3IHPA 3KQIA 2KR4A 3ZTGA 4WZ2A 4XI1A 2CT2A 4YADA 3HCUA 1WIMA 5AIUA 3T6RA 5TABA 1WENA 2KWNA 2XB1A 4A0CD 2YQMA 2LN0A 4FO9A 4YC9A 2LGVA 2CKLB 1X4IA 2D8SA 3N9QA 4WZ0A 2MA6A 1FBVA 5D1LB 5DKAA 4CCGX 3ZNIA 2L75A 3QZVA 2CSZA 3KV6A 3L11A 2ECIA 2YHOA 1XWHA 2FSAA 3O35A 1FP0A 4B86C 1E4UA 1WEPA 1WEOA 2H0DA 2ECVA 2Y1NA 4LK9A 5DINA 1Z60A 4YATA 4R7EA 1WEUA 4LLBA 2VP7A 2YHNA 3GL6A 1WEMA 1VFYA 4QF2A 4MVTA 2F6NA 4R2YA 3RPGC 3N9MA 4IC2A 3O34A 4N4FA 4GNGA 2KU3A 5KH7A 5LKUA 3SOWA 2C2VS 1N87A 5G04B 2DX8A 5TRBA 4BBQA 4V3KC 4YABA 2L43A 1MM2A 5TDRA 4I7DA 5LKTA 4NN2A 4L7XA 1JM7B 3MHHA 2VJEB 2QJ0A 4L58A 3VK6A 2JMDA 2XEUA 2HYED 5TDWA 3ZYQA 5G05B 3EB6A 2VJFB 4LKAA 4AYCB 4LADB 5H9MA 2PUYA 3ZPVE 2YUCA 2CKLA 4W4UA 5LKZA 2JRJA 2YT5A 5C13A 5FERA 4PTBA 2M6MA 2M85A 4GB0A 3HTKC 5H1VA 4ZQLA 3M99A 2LGLA 3FL2A 2FUIA 4A4CA 2KWOA 2M3HA 4N3WA 3O33A 5J3XA 1HYIA 2YURA 3O70A 2MT5A 2HDPA 3U5NA 1Z6UA 2ECWA 2C2LA 4TKPB 5H1TA 2EODA 3ZVYA 2G6QA 3V43A 1IYMA 2ECGA 2F6JA 2JMIA 3PUQA 2YREA 1WEEA 3O36A 2RI7A 4IC3A 5H1UA 2K1JA 4A4BA 3HCTA 4F52B 3I2DA 2G43A 3O7AA 4UI9B 5B75A 2CSYA 4C9ZA 1JOCA 5KH3A 2OXQC 2VJFA 2YYRA 1X4UA 4AYCA 3M62A 2KGIA 2LV9A 3N9LA 2LGKA 5D1MB 4WZ3B 2YSJA 2ECNA 3LQIA 3RTRB 2YU4A 4X3GA 2MA5A 4Q6FA 2QIZA 3C5KA 5LKXA 2KIZA 1WGMA 1T1HA 3ZVZB 2G45A 2E6RA 4GNFA 1WILA 3ASLA 3C6WA 3LRQA 2LQ6A 2KWJA 2IDAA 5B76A 2KGGA 1X4JA 4MSXA 4UP5A 5FB0A 1HYJA 2H0DB 2VPDA 2PNXA 1WEQA 2LXPC 3SHBA 4FJCA 2ZETC 5B8DA 2MUMA 2QICA 4ZDTA 1LDKC 3O37A 3HCSA 3LQJA 4UP0A 1RMDA 3RPGB 5AITA 2M1RA 4A49A 4R8PK 3PURA 3M63A 3U5MA 4I7CA 4PPEA 1DVPA 5B77A 1Z2QA 4FK5A 4P5OB 5EYAF 1WEWA 3DPLR 5FEYA 4QF3A 3GV4A 1BORA 2VPEA 2Y1MA 1U6GB 4GNEA 4YBMA 2LGGA 3KV5A 4BHWA 3T7LA 2Y43A 2FUUA 2L5UA 1JM7A 4LJNA 2VJEA 3U5OA 3L1ZB 2VPGA 2KYUA 3N9PA 2AN6A 2E6SA 5B79A 1F62A 4AUQB 1MM3A 5FB1A 2UZGA 5TBNA 2EA6A 2LRIC 4S3OB 4WA6A 1WE9A 3N9OA 4CA1A 5I3LA 3SOUA 1K2FA 2YQLA 3N9NA 4YBSA 4V3LC 1G25A 5JG6A 2KE1A 2MD7B 3KNVA 1LDJB 3MHSA 2KFTA 4GNDA 5G0FA 2I50A 4AVXA 4FIPA 3L1XA 2VNFA 2L0BA 2LDRA 2KWKA 4B7YC 2MNZA 3ZPV1 3U5PA 2MIQA 1VYXA 4YBTA 2ECJA 2NAAA 3EB5A 4AP4A 2KREA 5LCWB 5C11A 3NG2A 2L80A 1WEVA 2YW8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LXH C;  2K4D A;  5D1K B;  1CHC A;  2JMJ A;  2BAY A;  2EGP A;  3DQV R;  5B78 A;  1WES A;  1WFK A;  2K16 A;  4YAX A;  5KH9 A;  1V87 A;  1ZBD B;  2F42 A;  2ECT A;  2YSM A;  3LQH A;  4I7B A;  2MNY A;  1VD4 A;  2K17 A;  2MD8 C;  3PHD A;  2RSD A;  3SOX A;  4ZUX U;  4O64 A;  4S3O C;  2VPB A;  3IHP A;  3KQI A;  2KR4 A;  3ZTG A;  4WZ2 A;  4XI1 A;  2CT2 A;  4YAD A;  3HCU A;  1WIM A;  5AIU A;  3T6R A;  5TAB A;  1WEN A;  2KWN A;  2XB1 A;  4A0C D;  2YQM A;  2LN0 A;  4FO9 A;  4YC9 A;  2LGV A;  2CKL B;  1X4I A;  2D8S A;  3N9Q A;  4WZ0 A;  2MA6 A;  1FBV A;  5D1L B;  5DKA A;  4CCG X;  3ZNI A;  2L75 A;  3QZV A;  2CSZ A;  3KV6 A;  3L11 A;  2ECI A;  2YHO A;  1XWH A;  2FSA A;  3O35 A;  1FP0 A;  4B86 C;  1E4U A;  1WEP A;  1WEO A;  2H0D A;  2ECV A;  2Y1N A;  4LK9 A;  5DIN A;  1Z60 A;  4YAT A;  4R7E A;  1WEU A;  4LLB A;  2VP7 A;  2YHN A;  3GL6 A;  1WEM A;  1VFY A;  4QF2 A;  4MVT A;  2F6N A;  4R2Y A;  3RPG C;  3N9M A;  4IC2 A;  3O34 A;  4N4F A;  4GNG A;  2KU3 A;  5KH7 A;  5LKU A;  3SOW A;  2C2V S;  1N87 A;  5G04 B;  2DX8 A;  5TRB A;  4BBQ A;  4V3K C;  4YAB A;  2L43 A;  1MM2 A;  5TDR A;  4I7D A;  5LKT A;  4NN2 A;  4L7X A;  1JM7 B;  3MHH A;  2VJE B;  2QJ0 A;  4L58 A;  3VK6 A;  2JMD A;  2XEU A;  2HYE D;  5TDW A;  3ZYQ A;  5G05 B;  3EB6 A;  2VJF B;  4LKA A;  4AYC B;  4LAD B;  5H9M A;  2PUY A;  3ZPV E;  2YUC A;  2CKL A;  4W4U A;  5LKZ A;  2JRJ A;  2YT5 A;  5C13 A;  5FER A;  4PTB A;  2M6M A;  2M85 A;  4GB0 A;  3HTK C;  5H1V A;  4ZQL A;  3M99 A;  2LGL A;  3FL2 A;  2FUI A;  4A4C A;  2KWO A;  2M3H A;  4N3W A;  3O33 A;  5J3X A;  1HYI A;  2YUR A;  3O70 A;  2MT5 A;  2HDP A;  3U5N A;  1Z6U A;  2ECW A;  2C2L A;  4TKP B;  5H1T A;  2EOD A;  3ZVY A;  2G6Q A;  3V43 A;  1IYM A;  2ECG A;  2F6J A;  2JMI A;  3PUQ A;  2YRE A;  1WEE A;  3O36 A;  2RI7 A;  4IC3 A;  5H1U A;  2K1J A;  4A4B A;  3HCT A;  4F52 B;  3I2D A;  2G43 A;  3O7A A;  4UI9 B;  5B75 A;  2CSY A;  4C9Z A;  1JOC A;  5KH3 A;  2OXQ C;  2VJF A;  2YYR A;  1X4U A;  4AYC A;  3M62 A;  2KGI A;  2LV9 A;  3N9L A;  2LGK A;  5D1M B;  4WZ3 B;  2YSJ A;  2ECN A;  3LQI A;  3RTR B;  2YU4 A;  4X3G A;  2MA5 A;  4Q6F A;  2QIZ A;  3C5K A;  5LKX A;  2KIZ A;  1WGM A;  1T1H A;  3ZVZ B;  2G45 A;  2E6R A;  4GNF A;  1WIL A;  3ASL A;  3C6W A;  3LRQ A;  2LQ6 A;  2KWJ A;  2IDA A;  5B76 A;  2KGG A;  1X4J A;  4MSX A;  4UP5 A;  5FB0 A;  1HYJ A;  2H0D B;  2VPD A;  2PNX A;  1WEQ A;  2LXP C;  3SHB A;  4FJC A;  2ZET C;  5B8D A;  2MUM A;  2QIC A;  4ZDT A;  1LDK C;  3O37 A;  3HCS A;  3LQJ A;  4UP0 A;  1RMD A;  3RPG B;  5AIT A;  2M1R A;  4A49 A;  4R8P K;  3PUR A;  3M63 A;  3U5M A;  4I7C A;  4PPE A;  1DVP A;  5B77 A;  1Z2Q A;  4FK5 A;  4P5O B;  5EYA F;  1WEW A;  3DPL R;  5FEY A;  4QF3 A;  3GV4 A;  1BOR A;  2VPE A;  2Y1M A;  1U6G B;  4GNE A;  4YBM A;  2LGG A;  3KV5 A;  4BHW A;  3T7L A;  2Y43 A;  2FUU A;  2L5U A;  1JM7 A;  4LJN A;  2VJE A;  3U5O A;  3L1Z B;  2VPG A;  2KYU A;  3N9P A;  2AN6 A;  2E6S A;  5B79 A;  1F62 A;  4AUQ B;  1MM3 A;  5FB1 A;  2UZG A;  5TBN A;  2EA6 A;  2LRI C;  4S3O B;  4WA6 A;  1WE9 A;  3N9O A;  4CA1 A;  5I3L A;  3SOU A;  1K2F A;  2YQL A;  3N9N A;  4YBS A;  4V3L C;  1G25 A;  5JG6 A;  2KE1 A;  2MD7 B;  3KNV A;  1LDJ B;  3MHS A;  2KFT A;  4GND A;  5G0F A;  2I50 A;  4AVX A;  4FIP A;  3L1X A;  2VNF A;  2L0B A;  2LDR A;  2KWK A;  4B7Y C;  2MNZ A;  3ZPV 1;  3U5P A;  2MIQ A;  1VYX A;  4YBT A;  2ECJ A;  2NAA A;  3EB5 A;  4AP4 A;  2KRE A;  5LCW B;  5C11 A;  3NG2 A;  2L80 A;  1WEV A;  2YW8 A; 
#chains in the Genus database with same CATH topology
 2LXH C;  2K4D A;  5D1K B;  1CHC A;  2JMJ A;  2BAY A;  2EGP A;  3PLW A;  3FM8 C;  3DQV R;  2P57 A;  5B78 A;  1WES A;  1WFK A;  2K16 A;  4YAX A;  5KH9 A;  1V87 A;  1ZBD B;  2F42 A;  2ECT A;  2YSM A;  3LQH A;  4I7B A;  2MNY A;  1VD4 A;  2K17 A;  2MD8 C;  3PHD A;  2RSD A;  3SOX A;  4ZUX U;  4O64 A;  4S3O C;  2VPB A;  3IHP A;  3KQI A;  2KR4 A;  3ZTG A;  4WZ2 A;  4XI1 A;  3LDY A;  2CT2 A;  4YAD A;  3HCU A;  1WIM A;  5AIU A;  3T6R A;  5TAB A;  1WEN A;  2KWN A;  2D8U A;  2XB1 A;  4A0C D;  2YQM A;  2LN0 A;  4FO9 A;  4YC9 A;  2LGV A;  2CKL B;  1X4I A;  2M13 A;  2D8S A;  3N9Q A;  4WZ0 A;  2EGM A;  3FAO A;  2MA6 A;  1FBV A;  5D1L B;  5DKA A;  4CCG X;  3ZNI A;  5SVY A;  2L75 A;  3QZV A;  2CSZ A;  3KV6 A;  3L11 A;  2ECI A;  2YHO A;  1XWH A;  2FSA A;  3O35 A;  1FP0 A;  2EXU A;  4B86 C;  1E4U A;  1WEP A;  1WEO A;  2H0D A;  4F1P A;  2ECV A;  2Y1N A;  4LK9 A;  3KDE C;  5DIN A;  1Z60 A;  4YAT A;  4R7E A;  1WEU A;  4LLB A;  2VP7 A;  2YHN A;  3GL6 A;  1WEM A;  1VFY A;  4QF2 A;  4MVT A;  2F6N A;  4R2Y A;  3RPG C;  4OGC A;  3N9M A;  4IC2 A;  3O34 A;  4N4F A;  4GNG A;  2KU3 A;  5KH7 A;  2OWA A;  5LKU A;  2XOY A;  3SOW A;  2C2V S;  1N87 A;  5G04 B;  2DX8 A;  5TRB A;  4Z0O A;  4BBQ A;  4V3K C;  4YAB A;  2L43 A;  1MM2 A;  5TDR A;  4I7D A;  5LKT A;  4NN2 A;  4L7X A;  1JM7 B;  3MHH A;  2VJE B;  2QJ0 A;  4O62 A;  4L58 A;  3VK6 A;  3FEH A;  2JMD A;  2XEU A;  2HYE D;  5TDW A;  3ZYQ A;  2FD4 A;  5G05 B;  3EB6 A;  2VJF B;  4LKA A;  4AYC B;  4LAD B;  5H9M A;  2PUY A;  3ZPV E;  2YUC A;  2CKL A;  4W4U A;  3LVQ E;  5LKZ A;  2JRJ A;  2YT5 A;  5C13 A;  5FER A;  4PTB A;  2M6M A;  2KKY A;  1MBM A;  2M85 A;  4GB0 A;  3HTK C;  5H1V A;  4ZQL A;  3M99 A;  4Z0R A;  2LGL A;  3FL2 A;  2FUI A;  4A4C A;  2KWO A;  2M3H A;  4N3W A;  3O33 A;  5J3X A;  1HYI A;  3FAN A;  2YUR A;  3O70 A;  2MT5 A;  2HDP A;  3U5N A;  1Z6U A;  2ECW A;  3DWD A;  2C2L A;  4TKP B;  5H1T A;  2EOD A;  2KKX A;  3ZVY A;  2G6Q A;  3V43 A;  1IYM A;  2ECG A;  2F6J A;  2L7P A;  2JMI A;  3PUQ A;  2YRE A;  1WEE A;  3SUB A;  3O36 A;  2RI7 A;  2RR4 A;  4IC3 A;  5H1U A;  2K1J A;  4A4B A;  3HCT A;  5SVI A;  4F52 B;  3I2D A;  2G43 A;  3O7A A;  4UI9 B;  5B75 A;  3H7H A;  2CSY A;  4C9Z A;  1JOC A;  5KH3 A;  2OXQ C;  2VJF A;  2CRR A;  2YYR A;  1X4U A;  4AYC A;  3M62 A;  2KGI A;  2LV9 A;  2XOZ A;  3N9L A;  2LGK A;  5D1M B;  4WZ3 B;  2YSJ A;  2ECN A;  3LQI A;  3RTR B;  2YU4 A;  4X3G A;  2FFW A;  2JM3 A;  2MA5 A;  4Q6F A;  2QIZ A;  3C5K A;  2B0O E;  5LKX A;  2KIZ A;  1WGM A;  1T1H A;  3ZVZ B;  2G45 A;  2E6R A;  4GNF A;  1WIL A;  3ASL A;  3C6W A;  3LRQ A;  2LQ6 A;  2KWJ A;  2XP0 A;  2IDA A;  1DCQ A;  5B76 A;  2KGG A;  1X4J A;  4MSX A;  4UP5 A;  5FB0 A;  1HYJ A;  2H0D B;  2VPD A;  2PNX A;  1WEQ A;  2LXP C;  3SHB A;  4FJC A;  5K3Q A;  2ZET C;  5B8D A;  3O47 A;  2MUM A;  2QIC A;  3FJU B;  4ZDT A;  1LDK C;  3O37 A;  2JUN A;  3HCS A;  3LQJ A;  4UP0 A;  1RMD A;  3RPG B;  2MKE A;  3LJU X;  5AIT A;  2M1R A;  4A49 A;  4R8P K;  3PUR A;  3M63 A;  3U5M A;  4I7C A;  4PPE A;  2DJA A;  1DVP A;  5B77 A;  1Z2Q A;  4H9D A;  4FK5 A;  3JUE A;  4P5O B;  2CSV A;  1WEW A;  5EYA F;  3DPL R;  5FEY A;  3T9K A;  4QF3 A;  3GV4 A;  1BOR A;  2VPE A;  2Y1M A;  1U6G B;  4GNE A;  2YVR A;  4YBM A;  2LGG A;  3KV5 A;  4BHW A;  3T7L A;  2Y43 A;  2FUU A;  2L5U A;  1JM7 A;  4LJN A;  2VJE A;  3U5O A;  3L1Z B;  3DDT A;  2VPG A;  2KYU A;  3MDB C;  3N9P A;  2AN6 A;  2DSM A;  2E6S A;  5B79 A;  1F62 A;  4AUQ B;  2IQJ A;  1MM3 A;  5FB1 A;  2UZG A;  5TBN A;  2EA6 A;  2LRI C;  4S3O B;  4WA6 A;  3LVR E;  1WE9 A;  3N9O A;  4CA1 A;  5I3L A;  3SOU A;  1K2F A;  2YQL A;  4OGE A;  3N9N A;  4YBS A;  4V3L C;  1G25 A;  5JG6 A;  2KE1 A;  2MD7 B;  3E2D A;  1LDJ B;  3KNV A;  3MHS A;  4QQ4 A;  2KFT A;  4GND A;  5G0F A;  2I50 A;  4AVX A;  2CRW A;  4FIP A;  3L1X A;  3Q1D A;  2VNF A;  2L0B A;  2LDR A;  3M7K A;  2KWK A;  4B7Y C;  2MNZ A;  3ZPV 1;  3U5P A;  2MIQ A;  1VYX A;  2CON A;  2E61 A;  4YBT A;  2ECJ A;  2NAA A;  3EB5 A;  5SVI B;  2LAU A;  4AP4 A;  2KRE A;  5LCW B;  2XOC A;  5SVX A;  5C11 A;  3NG2 A;  2L80 A;  1WEV A;  2YW8 A; 
#chains in the Genus database with same CATH homology
 2LXH C;  2K4D A;  5D1K B;  1CHC A;  2JMJ A;  2BAY A;  2EGP A;  3DQV R;  5B78 A;  1WES A;  1WFK A;  2K16 A;  4YAX A;  5KH9 A;  1V87 A;  1ZBD B;  2F42 A;  2ECT A;  2YSM A;  3LQH A;  4I7B A;  2MNY A;  1VD4 A;  2K17 A;  2MD8 C;  3PHD A;  2RSD A;  3SOX A;  4ZUX U;  4O64 A;  4S3O C;  2VPB A;  3IHP A;  3KQI A;  2KR4 A;  3ZTG A;  4WZ2 A;  4XI1 A;  2CT2 A;  4YAD A;  3HCU A;  1WIM A;  5AIU A;  3T6R A;  5TAB A;  1WEN A;  2KWN A;  2XB1 A;  4A0C D;  2YQM A;  2LN0 A;  4FO9 A;  4YC9 A;  2LGV A;  2CKL B;  1X4I A;  2D8S A;  3N9Q A;  4WZ0 A;  2MA6 A;  1FBV A;  5D1L B;  5DKA A;  4CCG X;  3ZNI A;  2L75 A;  3QZV A;  2CSZ A;  3KV6 A;  3L11 A;  2ECI A;  2YHO A;  1XWH A;  2FSA A;  3O35 A;  1FP0 A;  4B86 C;  1E4U A;  1WEP A;  1WEO A;  2H0D A;  2ECV A;  2Y1N A;  4LK9 A;  5DIN A;  1Z60 A;  4YAT A;  4R7E A;  1WEU A;  4LLB A;  2VP7 A;  2YHN A;  3GL6 A;  1WEM A;  1VFY A;  4QF2 A;  4MVT A;  2F6N A;  4R2Y A;  3RPG C;  3N9M A;  4IC2 A;  3O34 A;  4N4F A;  4GNG A;  2KU3 A;  5KH7 A;  5LKU A;  3SOW A;  2C2V S;  1N87 A;  5G04 B;  2DX8 A;  5TRB A;  4BBQ A;  4V3K C;  4YAB A;  2L43 A;  1MM2 A;  5TDR A;  4I7D A;  5LKT A;  4NN2 A;  4L7X A;  1JM7 B;  3MHH A;  2VJE B;  2QJ0 A;  4L58 A;  3VK6 A;  2JMD A;  2XEU A;  2HYE D;  5TDW A;  3ZYQ A;  5G05 B;  3EB6 A;  2VJF B;  4LKA A;  4AYC B;  4LAD B;  5H9M A;  2PUY A;  3ZPV E;  2YUC A;  2CKL A;  4W4U A;  5LKZ A;  2JRJ A;  2YT5 A;  5C13 A;  5FER A;  4PTB A;  2M6M A;  2M85 A;  4GB0 A;  3HTK C;  5H1V A;  4ZQL A;  3M99 A;  2LGL A;  3FL2 A;  2FUI A;  4A4C A;  2KWO A;  2M3H A;  4N3W A;  3O33 A;  5J3X A;  1HYI A;  2YUR A;  3O70 A;  2MT5 A;  2HDP A;  3U5N A;  1Z6U A;  2ECW A;  2C2L A;  4TKP B;  5H1T A;  2EOD A;  3ZVY A;  2G6Q A;  3V43 A;  1IYM A;  2ECG A;  2F6J A;  2JMI A;  3PUQ A;  2YRE A;  1WEE A;  3O36 A;  2RI7 A;  4IC3 A;  5H1U A;  2K1J A;  4A4B A;  3HCT A;  4F52 B;  3I2D A;  2G43 A;  3O7A A;  4UI9 B;  5B75 A;  2CSY A;  4C9Z A;  1JOC A;  5KH3 A;  2OXQ C;  2VJF A;  2YYR A;  1X4U A;  4AYC A;  3M62 A;  2KGI A;  2LV9 A;  3N9L A;  2LGK A;  5D1M B;  4WZ3 B;  2YSJ A;  2ECN A;  3LQI A;  3RTR B;  2YU4 A;  4X3G A;  2MA5 A;  4Q6F A;  2QIZ A;  3C5K A;  5LKX A;  2KIZ A;  1WGM A;  1T1H A;  3ZVZ B;  2G45 A;  2E6R A;  4GNF A;  1WIL A;  3ASL A;  3C6W A;  3LRQ A;  2LQ6 A;  2KWJ A;  2IDA A;  5B76 A;  2KGG A;  1X4J A;  4MSX A;  4UP5 A;  5FB0 A;  1HYJ A;  2H0D B;  2VPD A;  2PNX A;  1WEQ A;  2LXP C;  3SHB A;  4FJC A;  2ZET C;  5B8D A;  2MUM A;  2QIC A;  4ZDT A;  1LDK C;  3O37 A;  3HCS A;  3LQJ A;  4UP0 A;  1RMD A;  3RPG B;  5AIT A;  2M1R A;  4A49 A;  4R8P K;  3PUR A;  3M63 A;  3U5M A;  4I7C A;  4PPE A;  1DVP A;  5B77 A;  1Z2Q A;  4FK5 A;  4P5O B;  5EYA F;  1WEW A;  3DPL R;  5FEY A;  4QF3 A;  3GV4 A;  1BOR A;  2VPE A;  2Y1M A;  1U6G B;  4GNE A;  4YBM A;  2LGG A;  3KV5 A;  4BHW A;  3T7L A;  2Y43 A;  2FUU A;  2L5U A;  1JM7 A;  4LJN A;  2VJE A;  3U5O A;  3L1Z B;  2VPG A;  2KYU A;  3N9P A;  2AN6 A;  2E6S A;  5B79 A;  1F62 A;  4AUQ B;  1MM3 A;  5FB1 A;  2UZG A;  5TBN A;  2EA6 A;  2LRI C;  4S3O B;  4WA6 A;  1WE9 A;  3N9O A;  4CA1 A;  5I3L A;  3SOU A;  1K2F A;  2YQL A;  3N9N A;  4YBS A;  4V3L C;  1G25 A;  5JG6 A;  2KE1 A;  2MD7 B;  3KNV A;  1LDJ B;  3MHS A;  2KFT A;  4GND A;  5G0F A;  2I50 A;  4AVX A;  4FIP A;  3L1X A;  2VNF A;  2L0B A;  2LDR A;  2KWK A;  4B7Y C;  2MNZ A;  3ZPV 1;  3U5P A;  2MIQ A;  1VYX A;  4YBT A;  2ECJ A;  2NAA A;  3EB5 A;  4AP4 A;  2KRE A;  5LCW B;  5C11 A;  3NG2 A;  2L80 A;  1WEV A;  2YW8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...