2QICA

Crystal structure of the ing1 phd finger in complex with a histone h3k4me3 peptide
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
51
structure length
51
Chain Sequence
EPTYCLCNQVSYGEMIGCDNDECPIEWFHFSCVGLNHKPKGKWYCPKCRGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Histone H3K4me3 binding is required for the DNA repair and apoptotic activities of ING1 tumor suppressor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Antitumor protein, apoptosis
molecule keywords Inhibitor of growth protein 1
total genus 8
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 2007-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2qicA00
3N9OA 2M85A 3HCUA 1WFKA 2ZETC 1X4UA 2CSZA 2H0DB 1VD4A 2FUUA 5B76A 4YABA 2KGIA 2ECGA 2KWNA 3KV5A 3M62A 5B77A 2MT5A 4I7DA 2G43A 2LGLA 2FUIA 1WEVA 4C9ZA 5J3XA 4LKAA 1G25A 2KFTA 3LQIA 2EODA 2Y43A 1WEOA 1MM2A 2PUYA 3O34A 1WEEA 4AVXA 2YURA 3RPGB 2G6QA 5LCWB 4N3WA 3ZVZB 2ECVA 2YQMA 1WEUA 3IHPA 2CSYA 4YC9A 3C6WA 2MUMA 5C13A 2RI7A 3O37A 2YW8A 4QF3A 2HDPA 2VJFA 4MSXA 3U5MA 3PUQA 2EGPA 2VP7A 2QIZA 4UP5A 2ECIA 4V3KC 5FERA 5H1VA 2YU4A 4PPEA 5LKXA 4R8PK 2KREA 4I7BA 3EB5A 5AIUA 3L1XA 4NN2A 4GNGA 4WA6A 1WGMA 3KV6A 5G0FA 1LDKC 5H1TA 3HTKC 5B8DA 3GV4A 2M6MA 1JOCA 4PTBA 1Z60A 2YT5A 2L80A 4GB0A 3ASLA 2CT2A 5D1KB 2LXHC 2YHOA 3M63A 2YREA 2VNFA 1HYJA 5KH3A 2YUCA 3LQHA 5G05B 4YBMA 2MNZA 4LK9A 1BORA 2CKLB 3ZNIA 2F6JA 3SOXA 4AP4A 2LQ6A 4ZUXU 1V87A 2M1RA 2KWOA 3U5OA 3N9NA 1WILA 1ZBDB 2LV9A 3LRQA 4YBSA 3FL2A 4AYCA 3LQJA 4YATA 1T1HA 3M99A 2ECJA 3T6RA 4V3LC 1LDJB 3HCTA 4FJCA 4S3OB 3DQVR 3PHDA 4WZ0A 4B86C 4UP0A 1WEWA 5TABA 2IDAA 4XI1A 5KH9A 5TRBA 2K4DA 3GL6A 4LADB 2C2LA 1N87A 3QZVA 5G04B 2CKLA 4ZDTA 2JMIA 3L11A 3NG2A 3ZPVE 1RMDA 4F52B 3O7AA 5FB1A 5DINA 2C2VS 1Z6UA 2I50A 2LGGA 4X3GA 4BHWA 1F62A 5EYAF 4QF2A 3ZVYA 5TDWA 2MIQA 1HYIA 2QJ0A 3PURA 5LKUA 5H1UA 5TDRA 2LGVA 1XWHA 2KE1A 3N9LA 2HYED 4CA1A 2VPEA 4I7CA 3T7LA 1WESA 2PNXA 4YAXA 4AYCB 1Z2QA 2VPBA 4R7EA 5KH7A 1E4UA 1WEPA 3SHBA 5LKTA 5FEYA 4B7YC 2KYUA 2ECTA 2JRJA 5TBNA 1MM3A 3U5NA 3DPLR 4GNFA 2KR4A 3RPGC 2VJEA 1VYXA 2MA6A 2MA5A 3ZPV1 2MNYA 2L75A 3MHSA 3SOWA 1WIMA 3RTRB 4Q6FA 2K17A 3VK6A 2Y1NA 1IYMA 3HCSA 4BBQA 3O36A 4L58A 2VJEB 4YBTA 5D1LB 1CHCA 1WEQA 2KWJA 3I2DA 5B78A 2LGKA 3O35A 2JMJA 5B79A 2LDRA 4A4CA 4LLBA 2KWKA 4IC2A 5DKAA 2Y1MA 2XB1A 2ECNA 2LN0A 4GNDA 5C11A 1WENA 3ZTGA 4UI9B 2KIZA 1FBVA 2JMDA 5AITA 4AUQB 4WZ2A 2UZGA 3KQIA 4P5OB 2ECWA 1X4IA 3EB6A 2LRIC 3N9QA 4WZ3B 4S3OC 1X4JA 4W4UA 2F42A 4L7XA 2L43A 2OXQC 2KU3A 2VPGA 4CCGX 5D1MB 2M3HA 4A4BA 4ZQLA 2FSAA 2VJFB 4A49A 2AN6A 3N9MA 3KNVA 2F6NA 2K16A 3MHHA 4MVTA 2XEUA 2D8SA 3N9PA 1WE9A 2MD8C 2YYRA 1WEMA 4O64A 1U6GB 1DVPA 2L5UA 2RSDA 1JM7A 2KGGA 4FK5A 2LXPC 2EA6A 4LJNA 5LKZA 2YSJA 3V43A 3O33A 4N4FA 2G45A 4FIPA 2QICA 3SOUA 4R2YA 3O70A 1K2FA 3ZYQA 2E6RA 2YSMA 2VPDA 2YHNA 2NAAA 5H9MA 4FO9A 3U5PA 4GNEA 5I3LA 2MD7B 2BAYA 4YADA 4TKPB 1FP0A 3C5KA 2H0DA 5JG6A 5B75A 1VFYA 3L1ZB 2K1JA 2L0BA 2DX8A 1JM7B 2E6SA 5FB0A 2YQLA 4IC3A 4A0CD
chains in the Genus database with same CATH superfamily
2D8UA 3N9OA 2M85A 4O62A 3HCUA 1WFKA 2ZETC 1X4UA 4H9DA 2CSZA 3T9KA 2H0DB 1VD4A 2FUUA 5B76A 4YABA 2KGIA 2ECGA 2KWNA 3KV5A 3M62A 5B77A 2MT5A 4I7DA 2G43A 2LGLA 2FUIA 1WEVA 4C9ZA 5J3XA 4LKAA 1G25A 2KFTA 3LQIA 2EODA 2Y43A 3LVQE 1WEOA 1MM2A 2PUYA 3O34A 1WEEA 4AVXA 2YURA 3RPGB 2G6QA 5LCWB 4N3WA 3ZVZB 2ECVA 2YQMA 2EGMA 1WEUA 3IHPA 2CSYA 4YC9A 3C6WA 2MUMA 5C13A 2RI7A 3KDEC 3O37A 2YW8A 4QF3A 2HDPA 2CRRA 2VJFA 4MSXA 2IQJA 3U5MA 3PUQA 2EGPA 2VP7A 2QIZA 2ECIA 4UP5A 4V3KC 5FERA 5H1VA 2YU4A 4PPEA 5LKXA 4R8PK 2KREA 4I7BA 3DWDA 3EB5A 5AIUA 3L1XA 4NN2A 4GNGA 4WA6A 1WGMA 2XOYA 3KV6A 5G0FA 3MDBC 1LDKC 5H1TA 2XP0A 3HTKC 5B8DA 2CSVA 3GV4A 2M6MA 1JOCA 4PTBA 1Z60A 2YT5A 2DJAA 4OGEA 2L80A 4GB0A 3ASLA 2CT2A 5D1KB 2LXHC 2YHOA 3M63A 2YREA 2VNFA 1HYJA 5KH3A 2YUCA 3LQHA 5G05B 4YBMA 2L7PA 2KKXA 3JUEA 2MNZA 4LK9A 1BORA 2CKLB 3ZNIA 2F6JA 3SOXA 4AP4A 5K3QA 2LQ6A 4ZUXU 1V87A 2KKYA 2M1RA 2KWOA 3U5OA 3N9NA 1WILA 1ZBDB 2LV9A 3LRQA 4YBSA 3FL2A 4AYCA 3LQJA 4YATA 1T1HA 3M99A 2ECJA 3T6RA 4V3LC 1LDJB 3HCTA 4FJCA 4S3OB 3DQVR 3PHDA 4WZ0A 4B86C 4UP0A 1WEWA 5TABA 2IDAA 4XI1A 2MKEA 2FD4A 2OWAA 5KH9A 5TRBA 2K4DA 3Q1DA 3GL6A 4LADB 2C2LA 1N87A 3QZVA 5G04B 2CKLA 4ZDTA 2JMIA 3L11A 3FANA 3NG2A 3ZPVE 1RMDA 4F52B 3O7AA 2RR4A 5FB1A 5DINA 2C2VS 1Z6UA 4OGCA 2I50A 2LGGA 4X3GA 4BHWA 1F62A 5EYAF 4QF2A 3ZVYA 5TDWA 2MIQA 1HYIA 2QJ0A 3PURA 5LKUA 5H1UA 2XOZA 5SVXA 3FJUB 5TDRA 2LGVA 1XWHA 2KE1A 3N9LA 2HYED 4CA1A 2VPEA 4I7CA 3T7LA 1DCQA 1WESA 2PNXA 4YAXA 4AYCB 1Z2QA 2VPBA 4R7EA 5KH7A 1E4UA 1WEPA 3SHBA 5LKTA 5SVIB 5FEYA 4B7YC 2KYUA 2ECTA 2E61A 2JRJA 5TBNA 1MM3A 3U5NA 3DPLR 4GNFA 2KR4A 3RPGC 2VJEA 1VYXA 2MA6A 2JM3A 2MA5A 3ZPV1 4Z0RA 3O47A 2MNYA 2L75A 3MHSA 3SOWA 5SVYA 1WIMA 3RTRB 4Q6FA 2K17A 3VK6A 2Y1NA 1IYMA 3HCSA 2P57A 4BBQA 3O36A 4L58A 2VJEB 3LDYA 4YBTA 5D1LB 1CHCA 1WEQA 2KWJA 3I2DA 5B78A 2LGKA 3O35A 2JMJA 4Z0OA 5B79A 2LDRA 4A4CA 3LVRE 4LLBA 3M7KA 2KWKA 4IC2A 5DKAA 2Y1MA 2LAUA 2XB1A 2ECNA 2LN0A 3FAOA 4GNDA 5C11A 3FEHA 1WENA 3ZTGA 4UI9B 3E2DA 2KIZA 1FBVA 2JMDA 5SVIA 5AITA 4AUQB 4WZ2A 2UZGA 4QQ4A 3KQIA 4P5OB 2ECWA 1X4IA 3EB6A 2CRWA 2JUNA 2LRIC 3N9QA 4WZ3B 2CONA 3SUBA 2EXUA 4S3OC 1X4JA 2B0OE 2F42A 4W4UA 4L7XA 2L43A 2OXQC 2KU3A 2VPGA 4CCGX 5D1MB 2M3HA 4A4BA 4ZQLA 2FSAA 2VJFB 4A49A 2AN6A 3N9MA 3KNVA 2F6NA 2K16A 3MHHA 4MVTA 2XEUA 2D8SA 3N9PA 1WE9A 2MD8C 2YYRA 1MBMA 1WEMA 4O64A 4F1PA 1U6GB 1DVPA 2L5UA 2RSDA 2YVRA 1JM7A 2KGGA 4FK5A 2LXPC 2EA6A 4LJNA 2FFWA 3PLWA 5LKZA 2YSJA 3V43A 3O33A 4N4FA 2G45A 4FIPA 2QICA 2M13A 3SOUA 4R2YA 2XOCA 3FM8C 3DDTA 3O70A 1K2FA 3ZYQA 2E6RA 2YSMA 2VPDA 2YHNA 2NAAA 5H9MA 4FO9A 3U5PA 4GNEA 5I3LA 2MD7B 2BAYA 4YADA 4TKPB 1FP0A 3C5KA 2H0DA 3LJUX 3H7HA 5B75A 1VFYA 5JG6A 3L1ZB 2K1JA 2L0BA 2DX8A 2DSMA 1JM7B 2E6SA 5FB0A 2YQLA 4IC3A 4A0CD
chains in the Genus database with same CATH topology
3N9OA 2M85A 3HCUA 1WFKA 2ZETC 1X4UA 2CSZA 2H0DB 1VD4A 2FUUA 5B76A 4YABA 2KGIA 2ECGA 2KWNA 3KV5A 3M62A 5B77A 2MT5A 4I7DA 2G43A 2LGLA 2FUIA 1WEVA 4C9ZA 5J3XA 4LKAA 1G25A 2KFTA 3LQIA 2EODA 2Y43A 1WEOA 1MM2A 2PUYA 3O34A 1WEEA 4AVXA 2YURA 3RPGB 2G6QA 5LCWB 4N3WA 3ZVZB 2ECVA 2YQMA 1WEUA 3IHPA 2CSYA 4YC9A 3C6WA 2MUMA 5C13A 2RI7A 3O37A 2YW8A 4QF3A 2HDPA 2VJFA 4MSXA 3U5MA 3PUQA 2EGPA 2VP7A 2QIZA 4UP5A 2ECIA 4V3KC 5FERA 5H1VA 2YU4A 4PPEA 5LKXA 4R8PK 2KREA 4I7BA 3EB5A 5AIUA 3L1XA 4NN2A 4GNGA 4WA6A 1WGMA 3KV6A 5G0FA 1LDKC 5H1TA 3HTKC 5B8DA 3GV4A 2M6MA 1JOCA 4PTBA 1Z60A 2YT5A 2L80A 4GB0A 3ASLA 2CT2A 5D1KB 2LXHC 2YHOA 3M63A 2YREA 2VNFA 1HYJA 5KH3A 2YUCA 3LQHA 5G05B 4YBMA 2MNZA 4LK9A 1BORA 2CKLB 3ZNIA 2F6JA 3SOXA 4AP4A 2LQ6A 4ZUXU 1V87A 2M1RA 2KWOA 3U5OA 3N9NA 1WILA 1ZBDB 2LV9A 3LRQA 4YBSA 3FL2A 4AYCA 3LQJA 4YATA 1T1HA 3M99A 2ECJA 3T6RA 4V3LC 1LDJB 3HCTA 4FJCA 4S3OB 3DQVR 3PHDA 4WZ0A 4B86C 4UP0A 1WEWA 5TABA 2IDAA 4XI1A 5KH9A 5TRBA 2K4DA 3GL6A 4LADB 2C2LA 1N87A 3QZVA 5G04B 2CKLA 4ZDTA 2JMIA 3L11A 3NG2A 3ZPVE 1RMDA 4F52B 3O7AA 5FB1A 5DINA 2C2VS 1Z6UA 2I50A 2LGGA 4X3GA 4BHWA 1F62A 5EYAF 4QF2A 3ZVYA 5TDWA 2MIQA 1HYIA 2QJ0A 3PURA 5LKUA 5H1UA 5TDRA 2LGVA 1XWHA 2KE1A 3N9LA 2HYED 4CA1A 2VPEA 4I7CA 3T7LA 1WESA 2PNXA 4YAXA 4AYCB 1Z2QA 2VPBA 4R7EA 5KH7A 1E4UA 1WEPA 3SHBA 5LKTA 5FEYA 4B7YC 2KYUA 2ECTA 2JRJA 5TBNA 1MM3A 3U5NA 3DPLR 4GNFA 2KR4A 3RPGC 2VJEA 1VYXA 2MA6A 2MA5A 3ZPV1 2MNYA 2L75A 3MHSA 3SOWA 1WIMA 3RTRB 4Q6FA 2K17A 3VK6A 2Y1NA 1IYMA 3HCSA 4BBQA 3O36A 4L58A 2VJEB 4YBTA 5D1LB 1CHCA 1WEQA 2KWJA 3I2DA 5B78A 2LGKA 3O35A 2JMJA 5B79A 2LDRA 4A4CA 4LLBA 2KWKA 4IC2A 5DKAA 2Y1MA 2XB1A 2ECNA 2LN0A 4GNDA 5C11A 1WENA 3ZTGA 4UI9B 2KIZA 1FBVA 2JMDA 5AITA 4AUQB 4WZ2A 2UZGA 3KQIA 4P5OB 2ECWA 1X4IA 3EB6A 2LRIC 3N9QA 4WZ3B 4S3OC 1X4JA 4W4UA 2F42A 4L7XA 2L43A 2OXQC 2KU3A 2VPGA 4CCGX 5D1MB 2M3HA 4A4BA 4ZQLA 2FSAA 2VJFB 4A49A 2AN6A 3N9MA 3KNVA 2F6NA 2K16A 3MHHA 4MVTA 2XEUA 2D8SA 3N9PA 1WE9A 2MD8C 2YYRA 1WEMA 4O64A 1U6GB 1DVPA 2L5UA 2RSDA 1JM7A 2KGGA 4FK5A 2LXPC 2EA6A 4LJNA 5LKZA 2YSJA 3V43A 3O33A 4N4FA 2G45A 4FIPA 2QICA 3SOUA 4R2YA 3O70A 1K2FA 3ZYQA 2E6RA 2YSMA 2VPDA 2YHNA 2NAAA 5H9MA 4FO9A 3U5PA 4GNEA 5I3LA 2MD7B 2BAYA 4YADA 4TKPB 1FP0A 3C5KA 2H0DA 5JG6A 5B75A 1VFYA 3L1ZB 2K1JA 2L0BA 2DX8A 1JM7B 2E6SA 5FB0A 2YQLA 4IC3A 4A0CD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N9O A;  2M85 A;  3HCU A;  1WFK A;  2ZET C;  1X4U A;  2CSZ A;  2H0D B;  1VD4 A;  2FUU A;  5B76 A;  4YAB A;  2KGI A;  2ECG A;  2KWN A;  3KV5 A;  3M62 A;  5B77 A;  2MT5 A;  4I7D A;  2G43 A;  2LGL A;  2FUI A;  1WEV A;  4C9Z A;  5J3X A;  4LKA A;  1G25 A;  2KFT A;  3LQI A;  2EOD A;  2Y43 A;  1WEO A;  1MM2 A;  2PUY A;  3O34 A;  1WEE A;  4AVX A;  2YUR A;  3RPG B;  2G6Q A;  5LCW B;  4N3W A;  3ZVZ B;  2ECV A;  2YQM A;  1WEU A;  3IHP A;  2CSY A;  4YC9 A;  3C6W A;  2MUM A;  5C13 A;  2RI7 A;  3O37 A;  2YW8 A;  4QF3 A;  2HDP A;  2VJF A;  4MSX A;  3U5M A;  3PUQ A;  2EGP A;  2VP7 A;  2QIZ A;  4UP5 A;  2ECI A;  4V3K C;  5FER A;  5H1V A;  2YU4 A;  4PPE A;  5LKX A;  4R8P K;  2KRE A;  4I7B A;  3EB5 A;  5AIU A;  3L1X A;  4NN2 A;  4GNG A;  4WA6 A;  1WGM A;  3KV6 A;  5G0F A;  1LDK C;  5H1T A;  3HTK C;  5B8D A;  3GV4 A;  2M6M A;  1JOC A;  4PTB A;  1Z60 A;  2YT5 A;  2L80 A;  4GB0 A;  3ASL A;  2CT2 A;  5D1K B;  2LXH C;  2YHO A;  3M63 A;  2YRE A;  2VNF A;  1HYJ A;  5KH3 A;  2YUC A;  3LQH A;  5G05 B;  4YBM A;  2MNZ A;  4LK9 A;  1BOR A;  2CKL B;  3ZNI A;  2F6J A;  3SOX A;  4AP4 A;  2LQ6 A;  4ZUX U;  1V87 A;  2M1R A;  2KWO A;  3U5O A;  3N9N A;  1WIL A;  1ZBD B;  2LV9 A;  3LRQ A;  4YBS A;  3FL2 A;  4AYC A;  3LQJ A;  4YAT A;  1T1H A;  3M99 A;  2ECJ A;  3T6R A;  4V3L C;  1LDJ B;  3HCT A;  4FJC A;  4S3O B;  3DQV R;  3PHD A;  4WZ0 A;  4B86 C;  4UP0 A;  1WEW A;  5TAB A;  2IDA A;  4XI1 A;  5KH9 A;  5TRB A;  2K4D A;  3GL6 A;  4LAD B;  2C2L A;  1N87 A;  3QZV A;  5G04 B;  2CKL A;  4ZDT A;  2JMI A;  3L11 A;  3NG2 A;  3ZPV E;  1RMD A;  4F52 B;  3O7A A;  5FB1 A;  5DIN A;  2C2V S;  1Z6U A;  2I50 A;  2LGG A;  4X3G A;  4BHW A;  1F62 A;  5EYA F;  4QF2 A;  3ZVY A;  5TDW A;  2MIQ A;  1HYI A;  2QJ0 A;  3PUR A;  5LKU A;  5H1U A;  5TDR A;  2LGV A;  1XWH A;  2KE1 A;  3N9L A;  2HYE D;  4CA1 A;  2VPE A;  4I7C A;  3T7L A;  1WES A;  2PNX A;  4YAX A;  4AYC B;  1Z2Q A;  2VPB A;  4R7E A;  5KH7 A;  1E4U A;  1WEP A;  3SHB A;  5LKT A;  5FEY A;  4B7Y C;  2KYU A;  2ECT A;  2JRJ A;  5TBN A;  1MM3 A;  3U5N A;  3DPL R;  4GNF A;  2KR4 A;  3RPG C;  2VJE A;  1VYX A;  2MA6 A;  2MA5 A;  3ZPV 1;  2MNY A;  2L75 A;  3MHS A;  3SOW A;  1WIM A;  3RTR B;  4Q6F A;  2K17 A;  3VK6 A;  2Y1N A;  1IYM A;  3HCS A;  4BBQ A;  3O36 A;  4L58 A;  2VJE B;  4YBT A;  5D1L B;  1CHC A;  1WEQ A;  2KWJ A;  3I2D A;  5B78 A;  2LGK A;  3O35 A;  2JMJ A;  5B79 A;  2LDR A;  4A4C A;  4LLB A;  2KWK A;  4IC2 A;  5DKA A;  2Y1M A;  2XB1 A;  2ECN A;  2LN0 A;  4GND A;  5C11 A;  1WEN A;  3ZTG A;  4UI9 B;  2KIZ A;  1FBV A;  2JMD A;  5AIT A;  4AUQ B;  4WZ2 A;  2UZG A;  3KQI A;  4P5O B;  2ECW A;  1X4I A;  3EB6 A;  2LRI C;  3N9Q A;  4WZ3 B;  4S3O C;  1X4J A;  4W4U A;  2F42 A;  4L7X A;  2L43 A;  2OXQ C;  2KU3 A;  2VPG A;  4CCG X;  5D1M B;  2M3H A;  4A4B A;  4ZQL A;  2FSA A;  2VJF B;  4A49 A;  2AN6 A;  3N9M A;  3KNV A;  2F6N A;  2K16 A;  3MHH A;  4MVT A;  2XEU A;  2D8S A;  3N9P A;  1WE9 A;  2MD8 C;  2YYR A;  1WEM A;  4O64 A;  1U6G B;  1DVP A;  2L5U A;  2RSD A;  1JM7 A;  2KGG A;  4FK5 A;  2LXP C;  2EA6 A;  4LJN A;  5LKZ A;  2YSJ A;  3V43 A;  3O33 A;  4N4F A;  2G45 A;  4FIP A;  2QIC A;  3SOU A;  4R2Y A;  3O70 A;  1K2F A;  3ZYQ A;  2E6R A;  2YSM A;  2VPD A;  2YHN A;  2NAA A;  5H9M A;  4FO9 A;  3U5P A;  4GNE A;  5I3L A;  2MD7 B;  2BAY A;  4YAD A;  4TKP B;  1FP0 A;  3C5K A;  2H0D A;  5JG6 A;  5B75 A;  1VFY A;  3L1Z B;  2K1J A;  2L0B A;  2DX8 A;  1JM7 B;  2E6S A;  5FB0 A;  2YQL A;  4IC3 A;  4A0C D; 
#chains in the Genus database with same CATH topology
 2D8U A;  3N9O A;  2M85 A;  4O62 A;  3HCU A;  1WFK A;  2ZET C;  1X4U A;  4H9D A;  2CSZ A;  3T9K A;  2H0D B;  1VD4 A;  2FUU A;  5B76 A;  4YAB A;  2KGI A;  2ECG A;  2KWN A;  3KV5 A;  3M62 A;  5B77 A;  2MT5 A;  4I7D A;  2G43 A;  2LGL A;  2FUI A;  1WEV A;  4C9Z A;  5J3X A;  4LKA A;  1G25 A;  2KFT A;  3LQI A;  2EOD A;  2Y43 A;  3LVQ E;  1WEO A;  1MM2 A;  2PUY A;  3O34 A;  1WEE A;  4AVX A;  2YUR A;  3RPG B;  2G6Q A;  5LCW B;  4N3W A;  3ZVZ B;  2ECV A;  2YQM A;  2EGM A;  1WEU A;  3IHP A;  2CSY A;  4YC9 A;  3C6W A;  2MUM A;  5C13 A;  2RI7 A;  3KDE C;  3O37 A;  2YW8 A;  4QF3 A;  2HDP A;  2CRR A;  2VJF A;  4MSX A;  2IQJ A;  3U5M A;  3PUQ A;  2EGP A;  2VP7 A;  2QIZ A;  2ECI A;  4UP5 A;  4V3K C;  5FER A;  5H1V A;  2YU4 A;  4PPE A;  5LKX A;  4R8P K;  2KRE A;  4I7B A;  3DWD A;  3EB5 A;  5AIU A;  3L1X A;  4NN2 A;  4GNG A;  4WA6 A;  1WGM A;  2XOY A;  3KV6 A;  5G0F A;  3MDB C;  1LDK C;  5H1T A;  2XP0 A;  3HTK C;  5B8D A;  2CSV A;  3GV4 A;  2M6M A;  1JOC A;  4PTB A;  1Z60 A;  2YT5 A;  2DJA A;  4OGE A;  2L80 A;  4GB0 A;  3ASL A;  2CT2 A;  5D1K B;  2LXH C;  2YHO A;  3M63 A;  2YRE A;  2VNF A;  1HYJ A;  5KH3 A;  2YUC A;  3LQH A;  5G05 B;  4YBM A;  2L7P A;  2KKX A;  3JUE A;  2MNZ A;  4LK9 A;  1BOR A;  2CKL B;  3ZNI A;  2F6J A;  3SOX A;  4AP4 A;  5K3Q A;  2LQ6 A;  4ZUX U;  1V87 A;  2KKY A;  2M1R A;  2KWO A;  3U5O A;  3N9N A;  1WIL A;  1ZBD B;  2LV9 A;  3LRQ A;  4YBS A;  3FL2 A;  4AYC A;  3LQJ A;  4YAT A;  1T1H A;  3M99 A;  2ECJ A;  3T6R A;  4V3L C;  1LDJ B;  3HCT A;  4FJC A;  4S3O B;  3DQV R;  3PHD A;  4WZ0 A;  4B86 C;  4UP0 A;  1WEW A;  5TAB A;  2IDA A;  4XI1 A;  2MKE A;  2FD4 A;  2OWA A;  5KH9 A;  5TRB A;  2K4D A;  3Q1D A;  3GL6 A;  4LAD B;  2C2L A;  1N87 A;  3QZV A;  5G04 B;  2CKL A;  4ZDT A;  2JMI A;  3L11 A;  3FAN A;  3NG2 A;  3ZPV E;  1RMD A;  4F52 B;  3O7A A;  2RR4 A;  5FB1 A;  5DIN A;  2C2V S;  1Z6U A;  4OGC A;  2I50 A;  2LGG A;  4X3G A;  4BHW A;  1F62 A;  5EYA F;  4QF2 A;  3ZVY A;  5TDW A;  2MIQ A;  1HYI A;  2QJ0 A;  3PUR A;  5LKU A;  5H1U A;  2XOZ A;  5SVX A;  3FJU B;  5TDR A;  2LGV A;  1XWH A;  2KE1 A;  3N9L A;  2HYE D;  4CA1 A;  2VPE A;  4I7C A;  3T7L A;  1DCQ A;  1WES A;  2PNX A;  4YAX A;  4AYC B;  1Z2Q A;  2VPB A;  4R7E A;  5KH7 A;  1E4U A;  1WEP A;  3SHB A;  5LKT A;  5SVI B;  5FEY A;  4B7Y C;  2KYU A;  2ECT A;  2E61 A;  2JRJ A;  5TBN A;  1MM3 A;  3U5N A;  3DPL R;  4GNF A;  2KR4 A;  3RPG C;  2VJE A;  1VYX A;  2MA6 A;  2JM3 A;  2MA5 A;  3ZPV 1;  4Z0R A;  3O47 A;  2MNY A;  2L75 A;  3MHS A;  3SOW A;  5SVY A;  1WIM A;  3RTR B;  4Q6F A;  2K17 A;  3VK6 A;  2Y1N A;  1IYM A;  3HCS A;  2P57 A;  4BBQ A;  3O36 A;  4L58 A;  2VJE B;  3LDY A;  4YBT A;  5D1L B;  1CHC A;  1WEQ A;  2KWJ A;  3I2D A;  5B78 A;  2LGK A;  3O35 A;  2JMJ A;  4Z0O A;  5B79 A;  2LDR A;  4A4C A;  3LVR E;  4LLB A;  3M7K A;  2KWK A;  4IC2 A;  5DKA A;  2Y1M A;  2LAU A;  2XB1 A;  2ECN A;  2LN0 A;  3FAO A;  4GND A;  5C11 A;  3FEH A;  1WEN A;  3ZTG A;  4UI9 B;  3E2D A;  2KIZ A;  1FBV A;  2JMD A;  5SVI A;  5AIT A;  4AUQ B;  4WZ2 A;  2UZG A;  4QQ4 A;  3KQI A;  4P5O B;  2ECW A;  1X4I A;  3EB6 A;  2CRW A;  2JUN A;  2LRI C;  3N9Q A;  4WZ3 B;  2CON A;  3SUB A;  2EXU A;  4S3O C;  1X4J A;  2B0O E;  2F42 A;  4W4U A;  4L7X A;  2L43 A;  2OXQ C;  2KU3 A;  2VPG A;  4CCG X;  5D1M B;  2M3H A;  4A4B A;  4ZQL A;  2FSA A;  2VJF B;  4A49 A;  2AN6 A;  3N9M A;  3KNV A;  2F6N A;  2K16 A;  3MHH A;  4MVT A;  2XEU A;  2D8S A;  3N9P A;  1WE9 A;  2MD8 C;  2YYR A;  1MBM A;  1WEM A;  4O64 A;  4F1P A;  1U6G B;  1DVP A;  2L5U A;  2RSD A;  2YVR A;  1JM7 A;  2KGG A;  4FK5 A;  2LXP C;  2EA6 A;  4LJN A;  2FFW A;  3PLW A;  5LKZ A;  2YSJ A;  3V43 A;  3O33 A;  4N4F A;  2G45 A;  4FIP A;  2QIC A;  2M13 A;  3SOU A;  4R2Y A;  2XOC A;  3FM8 C;  3DDT A;  3O70 A;  1K2F A;  3ZYQ A;  2E6R A;  2YSM A;  2VPD A;  2YHN A;  2NAA A;  5H9M A;  4FO9 A;  3U5P A;  4GNE A;  5I3L A;  2MD7 B;  2BAY A;  4YAD A;  4TKP B;  1FP0 A;  3C5K A;  2H0D A;  3LJU X;  3H7H A;  5B75 A;  1VFY A;  5JG6 A;  3L1Z B;  2K1J A;  2L0B A;  2DX8 A;  2DSM A;  1JM7 B;  2E6S A;  5FB0 A;  2YQL A;  4IC3 A;  4A0C D; 
#chains in the Genus database with same CATH homology
 3N9O A;  2M85 A;  3HCU A;  1WFK A;  2ZET C;  1X4U A;  2CSZ A;  2H0D B;  1VD4 A;  2FUU A;  5B76 A;  4YAB A;  2KGI A;  2ECG A;  2KWN A;  3KV5 A;  3M62 A;  5B77 A;  2MT5 A;  4I7D A;  2G43 A;  2LGL A;  2FUI A;  1WEV A;  4C9Z A;  5J3X A;  4LKA A;  1G25 A;  2KFT A;  3LQI A;  2EOD A;  2Y43 A;  1WEO A;  1MM2 A;  2PUY A;  3O34 A;  1WEE A;  4AVX A;  2YUR A;  3RPG B;  2G6Q A;  5LCW B;  4N3W A;  3ZVZ B;  2ECV A;  2YQM A;  1WEU A;  3IHP A;  2CSY A;  4YC9 A;  3C6W A;  2MUM A;  5C13 A;  2RI7 A;  3O37 A;  2YW8 A;  4QF3 A;  2HDP A;  2VJF A;  4MSX A;  3U5M A;  3PUQ A;  2EGP A;  2VP7 A;  2QIZ A;  4UP5 A;  2ECI A;  4V3K C;  5FER A;  5H1V A;  2YU4 A;  4PPE A;  5LKX A;  4R8P K;  2KRE A;  4I7B A;  3EB5 A;  5AIU A;  3L1X A;  4NN2 A;  4GNG A;  4WA6 A;  1WGM A;  3KV6 A;  5G0F A;  1LDK C;  5H1T A;  3HTK C;  5B8D A;  3GV4 A;  2M6M A;  1JOC A;  4PTB A;  1Z60 A;  2YT5 A;  2L80 A;  4GB0 A;  3ASL A;  2CT2 A;  5D1K B;  2LXH C;  2YHO A;  3M63 A;  2YRE A;  2VNF A;  1HYJ A;  5KH3 A;  2YUC A;  3LQH A;  5G05 B;  4YBM A;  2MNZ A;  4LK9 A;  1BOR A;  2CKL B;  3ZNI A;  2F6J A;  3SOX A;  4AP4 A;  2LQ6 A;  4ZUX U;  1V87 A;  2M1R A;  2KWO A;  3U5O A;  3N9N A;  1WIL A;  1ZBD B;  2LV9 A;  3LRQ A;  4YBS A;  3FL2 A;  4AYC A;  3LQJ A;  4YAT A;  1T1H A;  3M99 A;  2ECJ A;  3T6R A;  4V3L C;  1LDJ B;  3HCT A;  4FJC A;  4S3O B;  3DQV R;  3PHD A;  4WZ0 A;  4B86 C;  4UP0 A;  1WEW A;  5TAB A;  2IDA A;  4XI1 A;  5KH9 A;  5TRB A;  2K4D A;  3GL6 A;  4LAD B;  2C2L A;  1N87 A;  3QZV A;  5G04 B;  2CKL A;  4ZDT A;  2JMI A;  3L11 A;  3NG2 A;  3ZPV E;  1RMD A;  4F52 B;  3O7A A;  5FB1 A;  5DIN A;  2C2V S;  1Z6U A;  2I50 A;  2LGG A;  4X3G A;  4BHW A;  1F62 A;  5EYA F;  4QF2 A;  3ZVY A;  5TDW A;  2MIQ A;  1HYI A;  2QJ0 A;  3PUR A;  5LKU A;  5H1U A;  5TDR A;  2LGV A;  1XWH A;  2KE1 A;  3N9L A;  2HYE D;  4CA1 A;  2VPE A;  4I7C A;  3T7L A;  1WES A;  2PNX A;  4YAX A;  4AYC B;  1Z2Q A;  2VPB A;  4R7E A;  5KH7 A;  1E4U A;  1WEP A;  3SHB A;  5LKT A;  5FEY A;  4B7Y C;  2KYU A;  2ECT A;  2JRJ A;  5TBN A;  1MM3 A;  3U5N A;  3DPL R;  4GNF A;  2KR4 A;  3RPG C;  2VJE A;  1VYX A;  2MA6 A;  2MA5 A;  3ZPV 1;  2MNY A;  2L75 A;  3MHS A;  3SOW A;  1WIM A;  3RTR B;  4Q6F A;  2K17 A;  3VK6 A;  2Y1N A;  1IYM A;  3HCS A;  4BBQ A;  3O36 A;  4L58 A;  2VJE B;  4YBT A;  5D1L B;  1CHC A;  1WEQ A;  2KWJ A;  3I2D A;  5B78 A;  2LGK A;  3O35 A;  2JMJ A;  5B79 A;  2LDR A;  4A4C A;  4LLB A;  2KWK A;  4IC2 A;  5DKA A;  2Y1M A;  2XB1 A;  2ECN A;  2LN0 A;  4GND A;  5C11 A;  1WEN A;  3ZTG A;  4UI9 B;  2KIZ A;  1FBV A;  2JMD A;  5AIT A;  4AUQ B;  4WZ2 A;  2UZG A;  3KQI A;  4P5O B;  2ECW A;  1X4I A;  3EB6 A;  2LRI C;  3N9Q A;  4WZ3 B;  4S3O C;  1X4J A;  4W4U A;  2F42 A;  4L7X A;  2L43 A;  2OXQ C;  2KU3 A;  2VPG A;  4CCG X;  5D1M B;  2M3H A;  4A4B A;  4ZQL A;  2FSA A;  2VJF B;  4A49 A;  2AN6 A;  3N9M A;  3KNV A;  2F6N A;  2K16 A;  3MHH A;  4MVT A;  2XEU A;  2D8S A;  3N9P A;  1WE9 A;  2MD8 C;  2YYR A;  1WEM A;  4O64 A;  1U6G B;  1DVP A;  2L5U A;  2RSD A;  1JM7 A;  2KGG A;  4FK5 A;  2LXP C;  2EA6 A;  4LJN A;  5LKZ A;  2YSJ A;  3V43 A;  3O33 A;  4N4F A;  2G45 A;  4FIP A;  2QIC A;  3SOU A;  4R2Y A;  3O70 A;  1K2F A;  3ZYQ A;  2E6R A;  2YSM A;  2VPD A;  2YHN A;  2NAA A;  5H9M A;  4FO9 A;  3U5P A;  4GNE A;  5I3L A;  2MD7 B;  2BAY A;  4YAD A;  4TKP B;  1FP0 A;  3C5K A;  2H0D A;  5JG6 A;  5B75 A;  1VFY A;  3L1Z B;  2K1J A;  2L0B A;  2DX8 A;  1JM7 B;  2E6S A;  5FB0 A;  2YQL A;  4IC3 A;  4A0C D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...