4WZ2A

Crystal structure of u-box 2 of lubx / legu2 / lpp2887 from legionella pneumophila str. paris, ile175met mutant
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
75
structure length
75
Chain Sequence
TEIPDIFLCPISKTLIKTPVITAQGKVYDQEALSNFLIATGNKDETGKKLSMDDVVVFDELYQQIKVYNFYRKRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase LubX
publication title Molecular Characterization of LubX: Functional Divergence of the U-Box Fold by Legionella pneumophila.
pubmed doi rcsb
source organism Legionella pneumophila
total genus 18
structure length 75
sequence length 75
chains with identical sequence B, C
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2014-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04564 U-box U-box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4wz2A00
1MM3A 3ZNIA 2FSAA 2M3HA 1U6GB 4YC9A 4CCGX 4LADB 2G43A 3O34A 5H1VA 2M85A 3EB6A 4BBQA 5D1LB 4UP0A 1G25A 2LRIC 3C6WA 2G45A 2VPDA 2MUMA 3L1XA 1X4UA 2KU3A 2KIZA 4PPEA 3SHBA 2LV9A 3N9OA 3M99A 3U5NA 3V43A 2ZETC 3C5KA 2YSMA 5EYAF 4A0CD 1BORA 2M1RA 4GNEA 3U5PA 4AP4A 1LDJB 5B77A 2MD8C 5C11A 2KFTA 4GNGA 3NG2A 1T1HA 2LGGA 5G04B 1MM2A 2H0DB 1ZBDB 2YHNA 4YBMA 1DVPA 1JM7B 5I3LA 2XB1A 4LLBA 4YATA 5B75A 3MHSA 2UZGA 3PURA 2PUYA 2KWKA 4W4UA 5TDRA 2CKLB 2LGLA 4IC3A 4AUQB 5FB1A 4L7XA 3PHDA 1X4IA 2L5UA 2VPGA 2MA6A 3KNVA 4WZ3B 4QF3A 2NAAA 5B79A 2ECVA 3HCTA 1WESA 1XWHA 4XI1A 3N9NA 5DKAA 5G0FA 4UI9B 5B76A 3I2DA 4ZDTA 1LDKC 3N9QA 5TRBA 3O37A 2VJFB 4S3OB 2CSZA 3HTKC 2Y1MA 3T7LA 1WE9A 2E6SA 2MD7B 2JMDA 1E4UA 3LQIA 4ZQLA 5FERA 1WEMA 4MVTA 2ECTA 3VK6A 2YUCA 3SOUA 2CT2A 5AITA 2ECWA 2RI7A 2EGPA 1VFYA 2VJEB 3M63A 4AYCB 1N87A 4I7CA 3U5MA 4YBSA 3KV5A 1WEOA 4B86C 3LQHA 3N9PA 2YURA 1WEEA 4AVXA 1VD4A 5DINA 4L58A 3LRQA 1WEUA 2F6NA 3L1ZB 2KYUA 2H0DA 2HDPA 2OXQC 2ECJA 2KGGA 2K17A 1WEWA 2Y1NA 4A4BA 1WFKA 3QZVA 5KH9A 1WILA 4CA1A 1JM7A 3LQJA 2LGKA 4I7DA 1FBVA 2QJ0A 5TBNA 1JOCA 2ECGA 4GB0A 4Q6FA 2QIZA 2YSJA 4YBTA 3T6RA 3HCUA 4NN2A 4FK5A 1X4JA 2CKLA 2LGVA 3IHPA 5LKXA 2KWOA 4R8PK 2LXHC 2YREA 1IYMA 2YQMA 3ASLA 3O7AA 1HYJA 1WGMA 5AIUA 2YU4A 1WEQA 2KE1A 4IC2A 3ZPV1 4O64A 2VJFA 3DQVR 5LKTA 1Z6UA 5H9MA 4GNFA 4TKPB 2BAYA 1K2FA 4N4FA 3U5OA 5J3XA 4V3KC 2YYRA 5LKZA 4N3WA 3N9LA 3L11A 4FJCA 1Z2QA 1F62A 1FP0A 4F52B 4BHWA 2YQLA 2FUUA 2VPBA 2MIQA 2Y43A 3GL6A 2LDRA 4S3OC 1RMDA 3DPLR 5D1MB 3KV6A 2F6JA 2KWNA 2LXPC 2VJEA 2L75A 4YADA 3SOWA 4C9ZA 4AYCA 2JRJA 4R2YA 5FB0A 3MHHA 4ZUXU 2KREA 2IDAA 2LN0A 2QICA 3PUQA 4WA6A 2C2LA 2L43A 3M62A 2EODA 2HYED 2VP7A 4YABA 2ECIA 4QF2A 4PTBA 2ECNA 3EB5A 4WZ2A 4MSXA 5KH3A 2YHOA 4LK9A 5FEYA 5LKUA 3KQIA 2I50A 3GV4A 5JG6A 3ZVZB 2E6RA 4P5OB 2LQ6A 2XEUA 2DX8A 4LKAA 2KR4A 2VPEA 5TDWA 2JMIA 2MNYA 2L80A 3O35A 3RPGB 3ZYQA 5G05B 5B78A 4R7EA 2MA5A 1Z60A 5H1TA 3N9MA 2JMJA 5TABA 3RTRB 2YW8A 4UP5A 2EA6A 2KGIA 2KWJA 3HCSA 1VYXA 2PNXA 4X3GA 3ZTGA 2MNZA 2CSYA 4FIPA 1WEVA 2K1JA 3RPGC 1V87A 2MT5A 4GNDA 4B7YC 3SOXA 2K16A 5LCWB 4FO9A 2L0BA 1WEPA 3O70A 4I7BA 5C13A 5B8DA 2K4DA 1WENA 1WIMA 2RSDA 2D8SA 3ZPVE 2F42A 5KH7A 3FL2A 2G6QA 4V3LC 2C2VS 4A4CA 5D1KB 2YT5A 1HYIA 2FUIA 3ZVYA 4WZ0A 1CHCA 3O36A 4A49A 2M6MA 3O33A 5H1UA 2VNFA 4LJNA 4YAXA 2AN6A
chains in the Genus database with same CATH superfamily
1MM3A 3ZNIA 2FSAA 2M3HA 1U6GB 4YC9A 4CCGX 4LADB 2G43A 3O34A 5SVIB 4O62A 5H1VA 2M85A 3EB6A 4BBQA 5D1LB 4UP0A 1G25A 2LRIC 3C6WA 2G45A 2VPDA 2MUMA 2RR4A 3L1XA 1X4UA 2KU3A 2KIZA 4PPEA 3SHBA 2LV9A 3N9OA 3M99A 3U5NA 3O47A 3V43A 2ZETC 3C5KA 2MKEA 2YSMA 5EYAF 4A0CD 1BORA 2M1RA 4GNEA 3U5PA 4AP4A 3DWDA 2JUNA 1LDJB 5B77A 2MD8C 5C11A 2KFTA 3FEHA 4GNGA 3NG2A 1T1HA 2LGGA 5G04B 2P57A 1MM2A 2H0DB 1ZBDB 2YHNA 4YBMA 1DVPA 1JM7B 2IQJA 5I3LA 4F1PA 2DJAA 2XB1A 4LLBA 4YATA 5B75A 3PLWA 3MHSA 2UZGA 3PURA 2PUYA 2KWKA 4W4UA 5TDRA 2CKLB 2LGLA 4IC3A 4AUQB 5FB1A 4L7XA 3PHDA 1X4IA 2L5UA 2VPGA 2D8UA 2MA6A 3KNVA 4WZ3B 4QF3A 2NAAA 5B79A 2ECVA 3HCTA 1WESA 2EXUA 1XWHA 2OWAA 4XI1A 3N9NA 5DKAA 5G0FA 4OGCA 4UI9B 5B76A 3I2DA 4ZDTA 1LDKC 3N9QA 5TRBA 3O37A 2CRRA 2VJFB 4S3OB 2CSZA 3HTKC 2CRWA 3FANA 2Y1MA 3T7LA 1WE9A 2E6SA 2MD7B 2JMDA 1E4UA 2B0OE 3LQIA 4ZQLA 5FERA 1WEMA 4MVTA 2ECTA 3LVRE 3VK6A 2YUCA 2FFWA 3SOUA 2CT2A 5SVIA 5AITA 2ECWA 2RI7A 2EGPA 1VFYA 2VJEB 2L7PA 3M63A 4AYCB 1N87A 4I7CA 3U5MA 4YBSA 3KV5A 1WEOA 4B86C 4Z0OA 3LQHA 3N9PA 2YURA 1WEEA 4AVXA 2M13A 1VD4A 5DINA 4L58A 3LRQA 1WEUA 2F6NA 3L1ZB 2KYUA 2H0DA 2FD4A 2HDPA 2OXQC 2ECJA 2KGGA 2K17A 1WEWA 2Y1NA 4A4BA 1WFKA 3QZVA 1WILA 4H9DA 5KH9A 4CA1A 1JM7A 3LQJA 2LGKA 4I7DA 1FBVA 2QJ0A 5TBNA 1JOCA 2ECGA 4GB0A 4Q6FA 2QIZA 2XOCA 2YSJA 4YBTA 3T6RA 3HCUA 4NN2A 4FK5A 1X4JA 2CKLA 2LGVA 3IHPA 5LKXA 2KWOA 4R8PK 3FM8C 2LXHC 2YREA 1IYMA 2YQMA 2YVRA 3ASLA 3O7AA 2DSMA 1HYJA 1WGMA 5AIUA 2YU4A 1WEQA 2KE1A 4IC2A 3ZPV1 3LJUX 2JM3A 3KDEC 3LVQE 3FJUB 4O64A 2VJFA 3DQVR 5LKTA 1Z6UA 5H9MA 3E2DA 4GNFA 4TKPB 3M7KA 2BAYA 1K2FA 4N4FA 3U5OA 3Q1DA 5J3XA 4V3KC 2YYRA 5LKZA 4N3WA 3N9LA 3L11A 4FJCA 1Z2QA 1F62A 2KKXA 1FP0A 4F52B 4BHWA 2YQLA 2FUUA 2VPBA 2MIQA 3LDYA 4OGEA 2Y43A 3GL6A 2LDRA 4S3OC 1RMDA 3DPLR 5D1MB 3KV6A 2F6JA 2KWNA 2LXPC 2VJEA 2L75A 4YADA 3SOWA 4C9ZA 4AYCA 2LAUA 2JRJA 2XOYA 4R2YA 3H7HA 5FB0A 3MHHA 2EGMA 4ZUXU 2KREA 2IDAA 2LN0A 2QICA 5SVXA 3PUQA 4WA6A 2C2LA 2L43A 3M62A 2EODA 2HYED 2VP7A 4YABA 4QF2A 2ECIA 4PTBA 2ECNA 3EB5A 4WZ2A 5K3QA 4MSXA 5KH3A 2YHOA 4LK9A 3FAOA 5FEYA 5LKUA 3KQIA 2I50A 3GV4A 2E61A 5JG6A 4QQ4A 3ZVZB 2E6RA 4P5OB 2LQ6A 2XEUA 2DX8A 4LKAA 2KR4A 2XOZA 2XP0A 2VPEA 5TDWA 2JMIA 2MNYA 5SVYA 2L80A 3O35A 2KKYA 3MDBC 3RPGB 3ZYQA 5G05B 3SUBA 5B78A 1MBMA 4R7EA 2MA5A 1Z60A 5H1TA 3N9MA 2JMJA 5TABA 3RTRB 2YW8A 4UP5A 2EA6A 2KGIA 2KWJA 3HCSA 1VYXA 2PNXA 4X3GA 3ZTGA 2MNZA 2CSYA 4FIPA 1DCQA 1WEVA 2K1JA 3RPGC 1V87A 2MT5A 4GNDA 4B7YC 3SOXA 2K16A 4Z0RA 5LCWB 3DDTA 4FO9A 2L0BA 1WEPA 3O70A 2CSVA 4I7BA 5C13A 5B8DA 2K4DA 1WENA 1WIMA 2RSDA 2D8SA 3ZPVE 2F42A 3JUEA 5KH7A 3FL2A 2G6QA 4V3LC 2C2VS 4A4CA 5D1KB 2YT5A 1HYIA 2FUIA 3ZVYA 4WZ0A 1CHCA 3O36A 3T9KA 4A49A 2M6MA 3O33A 5H1UA 2VNFA 4LJNA 4YAXA 2CONA 2AN6A
chains in the Genus database with same CATH topology
1MM3A 3ZNIA 2FSAA 2M3HA 1U6GB 4YC9A 4CCGX 4LADB 2G43A 3O34A 5H1VA 2M85A 3EB6A 4BBQA 5D1LB 4UP0A 1G25A 2LRIC 3C6WA 2G45A 2VPDA 2MUMA 3L1XA 1X4UA 2KU3A 2KIZA 4PPEA 3SHBA 2LV9A 3N9OA 3M99A 3U5NA 3V43A 2ZETC 3C5KA 2YSMA 5EYAF 4A0CD 1BORA 2M1RA 4GNEA 3U5PA 4AP4A 1LDJB 5B77A 2MD8C 5C11A 2KFTA 4GNGA 3NG2A 1T1HA 2LGGA 5G04B 1MM2A 2H0DB 1ZBDB 2YHNA 4YBMA 1DVPA 1JM7B 5I3LA 2XB1A 4LLBA 4YATA 5B75A 3MHSA 2UZGA 3PURA 2PUYA 2KWKA 4W4UA 5TDRA 2CKLB 2LGLA 4IC3A 4AUQB 5FB1A 4L7XA 3PHDA 1X4IA 2L5UA 2VPGA 2MA6A 3KNVA 4WZ3B 4QF3A 2NAAA 5B79A 2ECVA 3HCTA 1WESA 1XWHA 4XI1A 3N9NA 5DKAA 5G0FA 4UI9B 5B76A 3I2DA 4ZDTA 1LDKC 3N9QA 5TRBA 3O37A 2VJFB 4S3OB 2CSZA 3HTKC 2Y1MA 3T7LA 1WE9A 2E6SA 2MD7B 2JMDA 1E4UA 3LQIA 4ZQLA 5FERA 1WEMA 4MVTA 2ECTA 3VK6A 2YUCA 3SOUA 2CT2A 5AITA 2ECWA 2RI7A 2EGPA 1VFYA 2VJEB 3M63A 4AYCB 1N87A 4I7CA 3U5MA 4YBSA 3KV5A 1WEOA 4B86C 3LQHA 3N9PA 2YURA 1WEEA 4AVXA 1VD4A 5DINA 4L58A 3LRQA 1WEUA 2F6NA 3L1ZB 2KYUA 2H0DA 2HDPA 2OXQC 2ECJA 2KGGA 2K17A 1WEWA 2Y1NA 4A4BA 1WFKA 3QZVA 5KH9A 1WILA 4CA1A 1JM7A 3LQJA 2LGKA 4I7DA 1FBVA 2QJ0A 5TBNA 1JOCA 2ECGA 4GB0A 4Q6FA 2QIZA 2YSJA 4YBTA 3T6RA 3HCUA 4NN2A 4FK5A 1X4JA 2CKLA 2LGVA 3IHPA 5LKXA 2KWOA 4R8PK 2LXHC 2YREA 1IYMA 2YQMA 3ASLA 3O7AA 1HYJA 1WGMA 5AIUA 2YU4A 1WEQA 2KE1A 4IC2A 3ZPV1 4O64A 2VJFA 3DQVR 5LKTA 1Z6UA 5H9MA 4GNFA 4TKPB 2BAYA 1K2FA 4N4FA 3U5OA 5J3XA 4V3KC 2YYRA 5LKZA 4N3WA 3N9LA 3L11A 4FJCA 1Z2QA 1F62A 1FP0A 4F52B 4BHWA 2YQLA 2FUUA 2VPBA 2MIQA 2Y43A 3GL6A 2LDRA 4S3OC 1RMDA 3DPLR 5D1MB 3KV6A 2F6JA 2KWNA 2LXPC 2VJEA 2L75A 4YADA 3SOWA 4C9ZA 4AYCA 2JRJA 4R2YA 5FB0A 3MHHA 4ZUXU 2KREA 2IDAA 2LN0A 2QICA 3PUQA 4WA6A 2C2LA 2L43A 3M62A 2EODA 2HYED 2VP7A 4YABA 2ECIA 4QF2A 4PTBA 2ECNA 3EB5A 4WZ2A 4MSXA 5KH3A 2YHOA 4LK9A 5FEYA 5LKUA 3KQIA 2I50A 3GV4A 5JG6A 3ZVZB 2E6RA 4P5OB 2LQ6A 2XEUA 2DX8A 4LKAA 2KR4A 2VPEA 5TDWA 2JMIA 2MNYA 2L80A 3O35A 3RPGB 3ZYQA 5G05B 5B78A 4R7EA 2MA5A 1Z60A 5H1TA 3N9MA 2JMJA 5TABA 3RTRB 2YW8A 4UP5A 2EA6A 2KGIA 2KWJA 3HCSA 1VYXA 2PNXA 4X3GA 3ZTGA 2MNZA 2CSYA 4FIPA 1WEVA 2K1JA 3RPGC 1V87A 2MT5A 4GNDA 4B7YC 3SOXA 2K16A 5LCWB 4FO9A 2L0BA 1WEPA 3O70A 4I7BA 5C13A 5B8DA 2K4DA 1WENA 1WIMA 2RSDA 2D8SA 3ZPVE 2F42A 5KH7A 3FL2A 2G6QA 4V3LC 2C2VS 4A4CA 5D1KB 2YT5A 1HYIA 2FUIA 3ZVYA 4WZ0A 1CHCA 3O36A 4A49A 2M6MA 3O33A 5H1UA 2VNFA 4LJNA 4YAXA 2AN6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MM3 A;  3ZNI A;  2FSA A;  2M3H A;  1U6G B;  4YC9 A;  4CCG X;  4LAD B;  2G43 A;  3O34 A;  5H1V A;  2M85 A;  3EB6 A;  4BBQ A;  5D1L B;  4UP0 A;  1G25 A;  2LRI C;  3C6W A;  2G45 A;  2VPD A;  2MUM A;  3L1X A;  1X4U A;  2KU3 A;  2KIZ A;  4PPE A;  3SHB A;  2LV9 A;  3N9O A;  3M99 A;  3U5N A;  3V43 A;  2ZET C;  3C5K A;  2YSM A;  5EYA F;  4A0C D;  1BOR A;  2M1R A;  4GNE A;  3U5P A;  4AP4 A;  1LDJ B;  5B77 A;  2MD8 C;  5C11 A;  2KFT A;  4GNG A;  3NG2 A;  1T1H A;  2LGG A;  5G04 B;  1MM2 A;  2H0D B;  1ZBD B;  2YHN A;  4YBM A;  1DVP A;  1JM7 B;  5I3L A;  2XB1 A;  4LLB A;  4YAT A;  5B75 A;  3MHS A;  2UZG A;  3PUR A;  2PUY A;  2KWK A;  4W4U A;  5TDR A;  2CKL B;  2LGL A;  4IC3 A;  4AUQ B;  5FB1 A;  4L7X A;  3PHD A;  1X4I A;  2L5U A;  2VPG A;  2MA6 A;  3KNV A;  4WZ3 B;  4QF3 A;  2NAA A;  5B79 A;  2ECV A;  3HCT A;  1WES A;  1XWH A;  4XI1 A;  3N9N A;  5DKA A;  5G0F A;  4UI9 B;  5B76 A;  3I2D A;  4ZDT A;  1LDK C;  3N9Q A;  5TRB A;  3O37 A;  2VJF B;  4S3O B;  2CSZ A;  3HTK C;  2Y1M A;  3T7L A;  1WE9 A;  2E6S A;  2MD7 B;  2JMD A;  1E4U A;  3LQI A;  4ZQL A;  5FER A;  1WEM A;  4MVT A;  2ECT A;  3VK6 A;  2YUC A;  3SOU A;  2CT2 A;  5AIT A;  2ECW A;  2RI7 A;  2EGP A;  1VFY A;  2VJE B;  3M63 A;  4AYC B;  1N87 A;  4I7C A;  3U5M A;  4YBS A;  3KV5 A;  1WEO A;  4B86 C;  3LQH A;  3N9P A;  2YUR A;  1WEE A;  4AVX A;  1VD4 A;  5DIN A;  4L58 A;  3LRQ A;  1WEU A;  2F6N A;  3L1Z B;  2KYU A;  2H0D A;  2HDP A;  2OXQ C;  2ECJ A;  2KGG A;  2K17 A;  1WEW A;  2Y1N A;  4A4B A;  1WFK A;  3QZV A;  5KH9 A;  1WIL A;  4CA1 A;  1JM7 A;  3LQJ A;  2LGK A;  4I7D A;  1FBV A;  2QJ0 A;  5TBN A;  1JOC A;  2ECG A;  4GB0 A;  4Q6F A;  2QIZ A;  2YSJ A;  4YBT A;  3T6R A;  3HCU A;  4NN2 A;  4FK5 A;  1X4J A;  2CKL A;  2LGV A;  3IHP A;  5LKX A;  2KWO A;  4R8P K;  2LXH C;  2YRE A;  1IYM A;  2YQM A;  3ASL A;  3O7A A;  1HYJ A;  1WGM A;  5AIU A;  2YU4 A;  1WEQ A;  2KE1 A;  4IC2 A;  3ZPV 1;  4O64 A;  2VJF A;  3DQV R;  5LKT A;  1Z6U A;  5H9M A;  4GNF A;  4TKP B;  2BAY A;  1K2F A;  4N4F A;  3U5O A;  5J3X A;  4V3K C;  2YYR A;  5LKZ A;  4N3W A;  3N9L A;  3L11 A;  4FJC A;  1Z2Q A;  1F62 A;  1FP0 A;  4F52 B;  4BHW A;  2YQL A;  2FUU A;  2VPB A;  2MIQ A;  2Y43 A;  3GL6 A;  2LDR A;  4S3O C;  1RMD A;  3DPL R;  5D1M B;  3KV6 A;  2F6J A;  2KWN A;  2LXP C;  2VJE A;  2L75 A;  4YAD A;  3SOW A;  4C9Z A;  4AYC A;  2JRJ A;  4R2Y A;  5FB0 A;  3MHH A;  4ZUX U;  2KRE A;  2IDA A;  2LN0 A;  2QIC A;  3PUQ A;  4WA6 A;  2C2L A;  2L43 A;  3M62 A;  2EOD A;  2HYE D;  2VP7 A;  4YAB A;  2ECI A;  4QF2 A;  4PTB A;  2ECN A;  3EB5 A;  4WZ2 A;  4MSX A;  5KH3 A;  2YHO A;  4LK9 A;  5FEY A;  5LKU A;  3KQI A;  2I50 A;  3GV4 A;  5JG6 A;  3ZVZ B;  2E6R A;  4P5O B;  2LQ6 A;  2XEU A;  2DX8 A;  4LKA A;  2KR4 A;  2VPE A;  5TDW A;  2JMI A;  2MNY A;  2L80 A;  3O35 A;  3RPG B;  3ZYQ A;  5G05 B;  5B78 A;  4R7E A;  2MA5 A;  1Z60 A;  5H1T A;  3N9M A;  2JMJ A;  5TAB A;  3RTR B;  2YW8 A;  4UP5 A;  2EA6 A;  2KGI A;  2KWJ A;  3HCS A;  1VYX A;  2PNX A;  4X3G A;  3ZTG A;  2MNZ A;  2CSY A;  4FIP A;  1WEV A;  2K1J A;  3RPG C;  1V87 A;  2MT5 A;  4GND A;  4B7Y C;  3SOX A;  2K16 A;  5LCW B;  4FO9 A;  2L0B A;  1WEP A;  3O70 A;  4I7B A;  5C13 A;  5B8D A;  2K4D A;  1WEN A;  1WIM A;  2RSD A;  2D8S A;  3ZPV E;  2F42 A;  5KH7 A;  3FL2 A;  2G6Q A;  4V3L C;  2C2V S;  4A4C A;  5D1K B;  2YT5 A;  1HYI A;  2FUI A;  3ZVY A;  4WZ0 A;  1CHC A;  3O36 A;  4A49 A;  2M6M A;  3O33 A;  5H1U A;  2VNF A;  4LJN A;  4YAX A;  2AN6 A; 
#chains in the Genus database with same CATH topology
 1MM3 A;  3ZNI A;  2FSA A;  2M3H A;  1U6G B;  4YC9 A;  4CCG X;  4LAD B;  2G43 A;  3O34 A;  5SVI B;  4O62 A;  5H1V A;  2M85 A;  3EB6 A;  4BBQ A;  5D1L B;  4UP0 A;  1G25 A;  2LRI C;  3C6W A;  2G45 A;  2VPD A;  2MUM A;  2RR4 A;  3L1X A;  1X4U A;  2KU3 A;  2KIZ A;  4PPE A;  3SHB A;  2LV9 A;  3N9O A;  3M99 A;  3U5N A;  3O47 A;  3V43 A;  2ZET C;  3C5K A;  2MKE A;  2YSM A;  5EYA F;  4A0C D;  1BOR A;  2M1R A;  4GNE A;  3U5P A;  4AP4 A;  3DWD A;  2JUN A;  1LDJ B;  5B77 A;  2MD8 C;  5C11 A;  2KFT A;  3FEH A;  4GNG A;  3NG2 A;  1T1H A;  2LGG A;  5G04 B;  2P57 A;  1MM2 A;  2H0D B;  1ZBD B;  2YHN A;  4YBM A;  1DVP A;  1JM7 B;  2IQJ A;  5I3L A;  4F1P A;  2DJA A;  2XB1 A;  4LLB A;  4YAT A;  5B75 A;  3PLW A;  3MHS A;  2UZG A;  3PUR A;  2PUY A;  2KWK A;  4W4U A;  5TDR A;  2CKL B;  2LGL A;  4IC3 A;  4AUQ B;  5FB1 A;  4L7X A;  3PHD A;  1X4I A;  2L5U A;  2VPG A;  2D8U A;  2MA6 A;  3KNV A;  4WZ3 B;  4QF3 A;  2NAA A;  5B79 A;  2ECV A;  3HCT A;  1WES A;  2EXU A;  1XWH A;  2OWA A;  4XI1 A;  3N9N A;  5DKA A;  5G0F A;  4OGC A;  4UI9 B;  5B76 A;  3I2D A;  4ZDT A;  1LDK C;  3N9Q A;  5TRB A;  3O37 A;  2CRR A;  2VJF B;  4S3O B;  2CSZ A;  3HTK C;  2CRW A;  3FAN A;  2Y1M A;  3T7L A;  1WE9 A;  2E6S A;  2MD7 B;  2JMD A;  1E4U A;  2B0O E;  3LQI A;  4ZQL A;  5FER A;  1WEM A;  4MVT A;  2ECT A;  3LVR E;  3VK6 A;  2YUC A;  2FFW A;  3SOU A;  2CT2 A;  5SVI A;  5AIT A;  2ECW A;  2RI7 A;  2EGP A;  1VFY A;  2VJE B;  2L7P A;  3M63 A;  4AYC B;  1N87 A;  4I7C A;  3U5M A;  4YBS A;  3KV5 A;  1WEO A;  4B86 C;  4Z0O A;  3LQH A;  3N9P A;  2YUR A;  1WEE A;  4AVX A;  2M13 A;  1VD4 A;  5DIN A;  4L58 A;  3LRQ A;  1WEU A;  2F6N A;  3L1Z B;  2KYU A;  2H0D A;  2FD4 A;  2HDP A;  2OXQ C;  2ECJ A;  2KGG A;  2K17 A;  1WEW A;  2Y1N A;  4A4B A;  1WFK A;  3QZV A;  1WIL A;  4H9D A;  5KH9 A;  4CA1 A;  1JM7 A;  3LQJ A;  2LGK A;  4I7D A;  1FBV A;  2QJ0 A;  5TBN A;  1JOC A;  2ECG A;  4GB0 A;  4Q6F A;  2QIZ A;  2XOC A;  2YSJ A;  4YBT A;  3T6R A;  3HCU A;  4NN2 A;  4FK5 A;  1X4J A;  2CKL A;  2LGV A;  3IHP A;  5LKX A;  2KWO A;  4R8P K;  3FM8 C;  2LXH C;  2YRE A;  1IYM A;  2YQM A;  2YVR A;  3ASL A;  3O7A A;  2DSM A;  1HYJ A;  1WGM A;  5AIU A;  2YU4 A;  1WEQ A;  2KE1 A;  4IC2 A;  3ZPV 1;  3LJU X;  2JM3 A;  3KDE C;  3LVQ E;  3FJU B;  4O64 A;  2VJF A;  3DQV R;  5LKT A;  1Z6U A;  5H9M A;  3E2D A;  4GNF A;  4TKP B;  3M7K A;  2BAY A;  1K2F A;  4N4F A;  3U5O A;  3Q1D A;  5J3X A;  4V3K C;  2YYR A;  5LKZ A;  4N3W A;  3N9L A;  3L11 A;  4FJC A;  1Z2Q A;  1F62 A;  2KKX A;  1FP0 A;  4F52 B;  4BHW A;  2YQL A;  2FUU A;  2VPB A;  2MIQ A;  3LDY A;  4OGE A;  2Y43 A;  3GL6 A;  2LDR A;  4S3O C;  1RMD A;  3DPL R;  5D1M B;  3KV6 A;  2F6J A;  2KWN A;  2LXP C;  2VJE A;  2L75 A;  4YAD A;  3SOW A;  4C9Z A;  4AYC A;  2LAU A;  2JRJ A;  2XOY A;  4R2Y A;  3H7H A;  5FB0 A;  3MHH A;  2EGM A;  4ZUX U;  2KRE A;  2IDA A;  2LN0 A;  2QIC A;  5SVX A;  3PUQ A;  4WA6 A;  2C2L A;  2L43 A;  3M62 A;  2EOD A;  2HYE D;  2VP7 A;  4YAB A;  4QF2 A;  2ECI A;  4PTB A;  2ECN A;  3EB5 A;  4WZ2 A;  5K3Q A;  4MSX A;  5KH3 A;  2YHO A;  4LK9 A;  3FAO A;  5FEY A;  5LKU A;  3KQI A;  2I50 A;  3GV4 A;  2E61 A;  5JG6 A;  4QQ4 A;  3ZVZ B;  2E6R A;  4P5O B;  2LQ6 A;  2XEU A;  2DX8 A;  4LKA A;  2KR4 A;  2XOZ A;  2XP0 A;  2VPE A;  5TDW A;  2JMI A;  2MNY A;  5SVY A;  2L80 A;  3O35 A;  2KKY A;  3MDB C;  3RPG B;  3ZYQ A;  5G05 B;  3SUB A;  5B78 A;  1MBM A;  4R7E A;  2MA5 A;  1Z60 A;  5H1T A;  3N9M A;  2JMJ A;  5TAB A;  3RTR B;  2YW8 A;  4UP5 A;  2EA6 A;  2KGI A;  2KWJ A;  3HCS A;  1VYX A;  2PNX A;  4X3G A;  3ZTG A;  2MNZ A;  2CSY A;  4FIP A;  1DCQ A;  1WEV A;  2K1J A;  3RPG C;  1V87 A;  2MT5 A;  4GND A;  4B7Y C;  3SOX A;  2K16 A;  4Z0R A;  5LCW B;  3DDT A;  4FO9 A;  2L0B A;  1WEP A;  3O70 A;  2CSV A;  4I7B A;  5C13 A;  5B8D A;  2K4D A;  1WEN A;  1WIM A;  2RSD A;  2D8S A;  3ZPV E;  2F42 A;  3JUE A;  5KH7 A;  3FL2 A;  2G6Q A;  4V3L C;  2C2V S;  4A4C A;  5D1K B;  2YT5 A;  1HYI A;  2FUI A;  3ZVY A;  4WZ0 A;  1CHC A;  3O36 A;  3T9K A;  4A49 A;  2M6M A;  3O33 A;  5H1U A;  2VNF A;  4LJN A;  4YAX A;  2CON A;  2AN6 A; 
#chains in the Genus database with same CATH homology
 1MM3 A;  3ZNI A;  2FSA A;  2M3H A;  1U6G B;  4YC9 A;  4CCG X;  4LAD B;  2G43 A;  3O34 A;  5H1V A;  2M85 A;  3EB6 A;  4BBQ A;  5D1L B;  4UP0 A;  1G25 A;  2LRI C;  3C6W A;  2G45 A;  2VPD A;  2MUM A;  3L1X A;  1X4U A;  2KU3 A;  2KIZ A;  4PPE A;  3SHB A;  2LV9 A;  3N9O A;  3M99 A;  3U5N A;  3V43 A;  2ZET C;  3C5K A;  2YSM A;  5EYA F;  4A0C D;  1BOR A;  2M1R A;  4GNE A;  3U5P A;  4AP4 A;  1LDJ B;  5B77 A;  2MD8 C;  5C11 A;  2KFT A;  4GNG A;  3NG2 A;  1T1H A;  2LGG A;  5G04 B;  1MM2 A;  2H0D B;  1ZBD B;  2YHN A;  4YBM A;  1DVP A;  1JM7 B;  5I3L A;  2XB1 A;  4LLB A;  4YAT A;  5B75 A;  3MHS A;  2UZG A;  3PUR A;  2PUY A;  2KWK A;  4W4U A;  5TDR A;  2CKL B;  2LGL A;  4IC3 A;  4AUQ B;  5FB1 A;  4L7X A;  3PHD A;  1X4I A;  2L5U A;  2VPG A;  2MA6 A;  3KNV A;  4WZ3 B;  4QF3 A;  2NAA A;  5B79 A;  2ECV A;  3HCT A;  1WES A;  1XWH A;  4XI1 A;  3N9N A;  5DKA A;  5G0F A;  4UI9 B;  5B76 A;  3I2D A;  4ZDT A;  1LDK C;  3N9Q A;  5TRB A;  3O37 A;  2VJF B;  4S3O B;  2CSZ A;  3HTK C;  2Y1M A;  3T7L A;  1WE9 A;  2E6S A;  2MD7 B;  2JMD A;  1E4U A;  3LQI A;  4ZQL A;  5FER A;  1WEM A;  4MVT A;  2ECT A;  3VK6 A;  2YUC A;  3SOU A;  2CT2 A;  5AIT A;  2ECW A;  2RI7 A;  2EGP A;  1VFY A;  2VJE B;  3M63 A;  4AYC B;  1N87 A;  4I7C A;  3U5M A;  4YBS A;  3KV5 A;  1WEO A;  4B86 C;  3LQH A;  3N9P A;  2YUR A;  1WEE A;  4AVX A;  1VD4 A;  5DIN A;  4L58 A;  3LRQ A;  1WEU A;  2F6N A;  3L1Z B;  2KYU A;  2H0D A;  2HDP A;  2OXQ C;  2ECJ A;  2KGG A;  2K17 A;  1WEW A;  2Y1N A;  4A4B A;  1WFK A;  3QZV A;  5KH9 A;  1WIL A;  4CA1 A;  1JM7 A;  3LQJ A;  2LGK A;  4I7D A;  1FBV A;  2QJ0 A;  5TBN A;  1JOC A;  2ECG A;  4GB0 A;  4Q6F A;  2QIZ A;  2YSJ A;  4YBT A;  3T6R A;  3HCU A;  4NN2 A;  4FK5 A;  1X4J A;  2CKL A;  2LGV A;  3IHP A;  5LKX A;  2KWO A;  4R8P K;  2LXH C;  2YRE A;  1IYM A;  2YQM A;  3ASL A;  3O7A A;  1HYJ A;  1WGM A;  5AIU A;  2YU4 A;  1WEQ A;  2KE1 A;  4IC2 A;  3ZPV 1;  4O64 A;  2VJF A;  3DQV R;  5LKT A;  1Z6U A;  5H9M A;  4GNF A;  4TKP B;  2BAY A;  1K2F A;  4N4F A;  3U5O A;  5J3X A;  4V3K C;  2YYR A;  5LKZ A;  4N3W A;  3N9L A;  3L11 A;  4FJC A;  1Z2Q A;  1F62 A;  1FP0 A;  4F52 B;  4BHW A;  2YQL A;  2FUU A;  2VPB A;  2MIQ A;  2Y43 A;  3GL6 A;  2LDR A;  4S3O C;  1RMD A;  3DPL R;  5D1M B;  3KV6 A;  2F6J A;  2KWN A;  2LXP C;  2VJE A;  2L75 A;  4YAD A;  3SOW A;  4C9Z A;  4AYC A;  2JRJ A;  4R2Y A;  5FB0 A;  3MHH A;  4ZUX U;  2KRE A;  2IDA A;  2LN0 A;  2QIC A;  3PUQ A;  4WA6 A;  2C2L A;  2L43 A;  3M62 A;  2EOD A;  2HYE D;  2VP7 A;  4YAB A;  2ECI A;  4QF2 A;  4PTB A;  2ECN A;  3EB5 A;  4WZ2 A;  4MSX A;  5KH3 A;  2YHO A;  4LK9 A;  5FEY A;  5LKU A;  3KQI A;  2I50 A;  3GV4 A;  5JG6 A;  3ZVZ B;  2E6R A;  4P5O B;  2LQ6 A;  2XEU A;  2DX8 A;  4LKA A;  2KR4 A;  2VPE A;  5TDW A;  2JMI A;  2MNY A;  2L80 A;  3O35 A;  3RPG B;  3ZYQ A;  5G05 B;  5B78 A;  4R7E A;  2MA5 A;  1Z60 A;  5H1T A;  3N9M A;  2JMJ A;  5TAB A;  3RTR B;  2YW8 A;  4UP5 A;  2EA6 A;  2KGI A;  2KWJ A;  3HCS A;  1VYX A;  2PNX A;  4X3G A;  3ZTG A;  2MNZ A;  2CSY A;  4FIP A;  1WEV A;  2K1J A;  3RPG C;  1V87 A;  2MT5 A;  4GND A;  4B7Y C;  3SOX A;  2K16 A;  5LCW B;  4FO9 A;  2L0B A;  1WEP A;  3O70 A;  4I7B A;  5C13 A;  5B8D A;  2K4D A;  1WEN A;  1WIM A;  2RSD A;  2D8S A;  3ZPV E;  2F42 A;  5KH7 A;  3FL2 A;  2G6Q A;  4V3L C;  2C2V S;  4A4C A;  5D1K B;  2YT5 A;  1HYI A;  2FUI A;  3ZVY A;  4WZ0 A;  1CHC A;  3O36 A;  4A49 A;  2M6M A;  3O33 A;  5H1U A;  2VNF A;  4LJN A;  4YAX A;  2AN6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...