4WZ2A

Crystal structure of u-box 2 of lubx / legu2 / lpp2887 from legionella pneumophila str. paris, ile175met mutant
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
75
structure length
75
Chain Sequence
TEIPDIFLCPISKTLIKTPVITAQGKVYDQEALSNFLIATGNKDETGKKLSMDDVVVFDELYQQIKVYNFYRKRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular Characterization of LubX: Functional Divergence of the U-Box Fold by Legionella pneumophila.
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase LubX
total genus 18
structure length 75
sequence length 75
chains with identical sequence B, C
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2014-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04564 U-box U-box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4wz2A00
4YADA 2UZGA 3GV4A 5B78A 4R7EA 4FIPA 3C6WA 4AP4A 1FBVA 3LQJA 4LKAA 2L43A 2HYED 1RMDA 2LGLA 4AUQB 3T6RA 2QIZA 2F6NA 2ECJA 4GB0A 4R8PK 2AN6A 2VNFA 3RPGB 1WEEA 1FP0A 2Y1MA 3O70A 4AVXA 2E6SA 5C13A 5FERA 1WE9A 3DQVR 2C2VS 2FUUA 5LKUA 2L5UA 2PNXA 3LRQA 3HCSA 5EYAF 4L58A 1WEWA 3L1ZB 4AYCB 5AIUA 3N9LA 3VK6A 2YHOA 4GNEA 5J3XA 2D8SA 2H0DB 2FSAA 4V3KC 4XI1A 2ECTA 5H1VA 5FB1A 4ZUXU 2JMIA 3L1XA 2YREA 2K1JA 2M3HA 5D1LB 3I2DA 1WEPA 3KV5A 3L11A 4N4FA 2JMDA 4PTBA 1HYIA 4YBSA 2VPEA 2ECIA 1G25A 3MHSA 2L80A 1T1HA 5KH7A 4FO9A 5TRBA 4A4BA 3N9NA 1WENA 4I7BA 3ZTGA 1X4JA 5G04B 3PURA 2XEUA 2G6QA 4R2YA 3ZVZB 3O33A 5D1KB 3N9OA 4QF3A 2NAAA 2ECWA 5B75A 4LLBA 3M99A 1WFKA 3N9MA 2C2LA 3ZYQA 2KU3A 4PPEA 4TKPB 2LN0A 2VJFB 4MSXA 2Y43A 4L7XA 2F6JA 2G43A 4WA6A 3SOXA 3O34A 2LV9A 4C9ZA 1LDKC 2K4DA 2KIZA 2VP7A 3PHDA 2CSYA 3SHBA 2VJFA 4UP5A 2LQ6A 3KNVA 4B7YC 2YYRA 4FK5A 1ZBDB 4YABA 3N9PA 2YW8A 3HTKC 1VD4A 5LCWB 2E6RA 2ECGA 1X4UA 2KE1A 1WEMA 2YSMA 4LADB 3O7AA 2L0BA 2MUMA 4IC3A 2KGIA 2H0DA 2YUCA 2ECNA 5G05B 2YHNA 5KH3A 3HCTA 2CKLB 4CCGX 1N87A 3ZPV1 2LDRA 3NG2A 1X4IA 2JRJA 1WEUA 4YBTA 2EGPA 2ECVA 4A49A 4MVTA 4FJCA 4CA1A 5KH9A 3HCUA 2VPGA 4S3OB 1XWHA 5G0FA 3EB6A 2RI7A 4YAXA 4A0CD 4B86C 4I7CA 2OXQC 5TDWA 2YQMA 2HDPA 2M6MA 2LXHC 3U5OA 5FEYA 4LK9A 2CSZA 2M85A 1Z60A 4WZ3B 3O37A 2LXPC 5DKAA 2EODA 1IYMA 2QICA 5B77A 3QZVA 2PUYA 1HYJA 2QJ0A 3O36A 5B76A 4A4CA 3MHHA 2YSJA 5TBNA 3ZPVE 5H9MA 4AYCA 4N3WA 2YT5A 3RTRB 5LKZA 5TDRA 2VJEA 4P5OB 2LGVA 3KV6A 3C5KA 2MA5A 2LRIC 2RSDA 2MNZA 4WZ0A 4Q6FA 3U5NA 1Z6UA 3ZVYA 2MIQA 3PUQA 1K2FA 4ZDTA 2F42A 2ZETC 5JG6A 2FUIA 5D1MB 1WIMA 4GNFA 2M1RA 4IC2A 1BORA 2KWKA 3M62A 3U5PA 4UP0A 2KWOA 4F52B 3KQIA 1WEQA 2XB1A 2K16A 2KWNA 5H1UA 2YQLA 4GNGA 2CKLA 2DX8A 5AITA 4QF2A 2KFTA 1WESA 3LQIA 1WILA 4UI9B 5TABA 2K17A 1V87A 3DPLR 3SOWA 2YURA 1JM7B 2MT5A 3GL6A 2KREA 2CT2A 1WGMA 3SOUA 1MM3A 4X3GA 3T7LA 2KGGA 2MNYA 1VYXA 4V3LC 4ZQLA 3EB5A 3V43A 2JMJA 2MA6A 4O64A 2KYUA 2VPDA 4NN2A 1U6GB 2YU4A 2G45A 4YATA 5DINA 4WZ2A 3ASLA 4W4UA 1Z2QA 5B8DA 1JOCA 1F62A 2I50A 5LKTA 2MD7B 4S3OC 3M63A 3N9QA 4I7DA 1LDJB 5C11A 3IHPA 5I3LA 1VFYA 4YBMA 5H1TA 2EA6A 2LGKA 1E4UA 2KWJA 4LJNA 4GNDA 5B79A 1JM7A 3U5MA 3O35A 1MM2A 5FB0A 4BBQA 1WEOA 2KR4A 3LQHA 3FL2A 1DVPA 1WEVA 4YC9A 4BHWA 2Y1NA 2LGGA 2MD8C 2VJEB 3ZNIA 1CHCA 3RPGC 2L75A 2BAYA 2VPBA 5LKXA 2IDAA
chains in the Genus database with same CATH superfamily
4YADA 2UZGA 4O62A 3GV4A 5B78A 4R7EA 4FIPA 3C6WA 4AP4A 2DSMA 2D8UA 1FBVA 3LQJA 4LKAA 2L43A 2HYED 4OGCA 2FD4A 1RMDA 2LGLA 3FM8C 4AUQB 3T6RA 2QIZA 2F6NA 2M13A 2XOZA 2ECJA 4GB0A 4R8PK 2AN6A 2VNFA 3RPGB 1WEEA 1FP0A 2Y1MA 3O70A 4Z0OA 4AVXA 2E6SA 5C13A 5FERA 1WE9A 3DQVR 2CSVA 2JUNA 2C2VS 2FUUA 5LKUA 2L5UA 2FFWA 2PNXA 3LRQA 3HCSA 5EYAF 2IQJA 4L58A 1WEWA 3L1ZB 4AYCB 5AIUA 3N9LA 3VK6A 2YHOA 3LDYA 4GNEA 5J3XA 2D8SA 2H0DB 4Z0RA 2P57A 2XOCA 2FSAA 4V3KC 3DWDA 4XI1A 2ECTA 3LVQE 5H1VA 5FB1A 4ZUXU 2JMIA 3L1XA 2YREA 2K1JA 2M3HA 5D1LB 3I2DA 1WEPA 3Q1DA 2LAUA 3KV5A 3L11A 2B0OE 2JMDA 4N4FA 4PTBA 1HYIA 4YBSA 2VPEA 5SVXA 2ECIA 1G25A 3FJUB 3MHSA 2L80A 1T1HA 5KH7A 3M7KA 4FO9A 5TRBA 4A4BA 3N9NA 1WENA 4I7BA 3ZTGA 1X4JA 5G04B 3PURA 2XEUA 2G6QA 4R2YA 3ZVZB 4F1PA 3O33A 5D1KB 3N9OA 4QF3A 2NAAA 2ECWA 5B75A 2CONA 4LLBA 3M99A 1WFKA 3N9MA 2C2LA 3ZYQA 2KU3A 4PPEA 4TKPB 2LN0A 2VJFB 4MSXA 2Y43A 4L7XA 2F6JA 5SVIB 2G43A 4WA6A 3SOXA 3O34A 3T9KA 2KKYA 2LV9A 4C9ZA 1LDKC 2K4DA 2KIZA 2VP7A 3PHDA 2CSYA 3SHBA 2VJFA 4UP5A 2LQ6A 3KNVA 4B7YC 2YYRA 4FK5A 1ZBDB 3N9PA 4YABA 2YW8A 3HTKC 1VD4A 5LCWB 2E6RA 2ECGA 1X4UA 2RR4A 3H7HA 3MDBC 2KE1A 2JM3A 1WEMA 2YSMA 4LADB 3O7AA 2L0BA 2MUMA 4IC3A 2KGIA 2H0DA 2YUCA 2ECNA 4H9DA 5G05B 2YHNA 5KH3A 3HCTA 2CKLB 4CCGX 1N87A 1DCQA 3ZPV1 2LDRA 3NG2A 1X4IA 2JRJA 2CRRA 1WEUA 4YBTA 2EGPA 2ECVA 4QQ4A 4A49A 4MVTA 3LJUX 4FJCA 5KH9A 4CA1A 3HCUA 2VPGA 4S3OB 1XWHA 5G0FA 3EB6A 3E2DA 2RI7A 4YAXA 4A0CD 4B86C 4I7CA 2OXQC 5TDWA 2YQMA 2HDPA 2M6MA 1MBMA 2LXHC 3U5OA 5FEYA 4LK9A 2CSZA 2M85A 1Z60A 4WZ3B 3O37A 2LXPC 5DKAA 2EODA 1IYMA 2QICA 5B77A 3QZVA 2PUYA 1HYJA 2QJ0A 3O36A 5B76A 3MHHA 3FANA 4A4CA 2YSJA 5TBNA 2MKEA 3ZPVE 5H9MA 4AYCA 4N3WA 2DJAA 2YT5A 3RTRB 5LKZA 5TDRA 2VJEA 4P5OB 2LGVA 3KV6A 3C5KA 2MA5A 2LRIC 2XOYA 2RSDA 2MNZA 4WZ0A 4Q6FA 3U5NA 3SUBA 1Z6UA 3ZVYA 2L7PA 2MIQA 3PUQA 1K2FA 4ZDTA 3FAOA 2F42A 2ZETC 5JG6A 2FUIA 5D1MB 1WIMA 4GNFA 2M1RA 3PLWA 4IC2A 2EXUA 3DDTA 1BORA 2KWKA 3M62A 5SVYA 3U5PA 4UP0A 2KWOA 4F52B 3KQIA 1WEQA 2XB1A 2K16A 2KWNA 5H1UA 2YQLA 4GNGA 2CKLA 2DX8A 5AITA 4QF2A 2KFTA 2E61A 1WESA 3O47A 3LQIA 1WILA 4UI9B 5TABA 2K17A 1V87A 3DPLR 3SOWA 2YURA 1JM7B 2MT5A 3GL6A 2KREA 2CT2A 1WGMA 3SOUA 3LVRE 1MM3A 4X3GA 3T7LA 2EGMA 2KGGA 2MNYA 2OWAA 3FEHA 1VYXA 4V3LC 4ZQLA 3EB5A 3V43A 2JMJA 2MA6A 4O64A 5SVIA 2KYUA 2VPDA 2YVRA 4NN2A 1U6GB 2YU4A 2G45A 4YATA 5DINA 4WZ2A 3ASLA 4W4UA 5K3QA 2CRWA 1Z2QA 5B8DA 1JOCA 1F62A 2I50A 5LKTA 2MD7B 4S3OC 3M63A 3N9QA 4I7DA 3JUEA 1LDJB 5C11A 3IHPA 3KDEC 5I3LA 1VFYA 4YBMA 5H1TA 2EA6A 2LGKA 1E4UA 2KWJA 4LJNA 4GNDA 5B79A 1JM7A 3U5MA 3O35A 1MM2A 5FB0A 4OGEA 4BBQA 2KKXA 1WEOA 2KR4A 3LQHA 3FL2A 2XP0A 1DVPA 1WEVA 4YC9A 4BHWA 2Y1NA 2LGGA 2MD8C 2VJEB 3ZNIA 1CHCA 3RPGC 2L75A 2BAYA 2VPBA 5LKXA 2IDAA
chains in the Genus database with same CATH topology
4YADA 2UZGA 3GV4A 5B78A 4R7EA 4FIPA 3C6WA 4AP4A 1FBVA 3LQJA 4LKAA 2L43A 2HYED 1RMDA 2LGLA 4AUQB 3T6RA 2QIZA 2F6NA 2ECJA 4GB0A 4R8PK 2AN6A 2VNFA 3RPGB 1WEEA 1FP0A 2Y1MA 3O70A 4AVXA 2E6SA 5C13A 5FERA 1WE9A 3DQVR 2C2VS 2FUUA 5LKUA 2L5UA 2PNXA 3LRQA 3HCSA 5EYAF 4L58A 1WEWA 3L1ZB 4AYCB 5AIUA 3N9LA 3VK6A 2YHOA 4GNEA 5J3XA 2D8SA 2H0DB 2FSAA 4V3KC 4XI1A 2ECTA 5H1VA 5FB1A 4ZUXU 2JMIA 3L1XA 2YREA 2K1JA 2M3HA 5D1LB 3I2DA 1WEPA 3KV5A 3L11A 4N4FA 2JMDA 4PTBA 1HYIA 4YBSA 2VPEA 2ECIA 1G25A 3MHSA 2L80A 1T1HA 5KH7A 4FO9A 5TRBA 4A4BA 3N9NA 1WENA 4I7BA 3ZTGA 1X4JA 5G04B 3PURA 2XEUA 2G6QA 4R2YA 3ZVZB 3O33A 5D1KB 3N9OA 4QF3A 2NAAA 2ECWA 5B75A 4LLBA 3M99A 1WFKA 3N9MA 2C2LA 3ZYQA 2KU3A 4PPEA 4TKPB 2LN0A 2VJFB 4MSXA 2Y43A 4L7XA 2F6JA 2G43A 4WA6A 3SOXA 3O34A 2LV9A 4C9ZA 1LDKC 2K4DA 2KIZA 2VP7A 3PHDA 2CSYA 3SHBA 2VJFA 4UP5A 2LQ6A 3KNVA 4B7YC 2YYRA 4FK5A 1ZBDB 4YABA 3N9PA 2YW8A 3HTKC 1VD4A 5LCWB 2E6RA 2ECGA 1X4UA 2KE1A 1WEMA 2YSMA 4LADB 3O7AA 2L0BA 2MUMA 4IC3A 2KGIA 2H0DA 2YUCA 2ECNA 5G05B 2YHNA 5KH3A 3HCTA 2CKLB 4CCGX 1N87A 3ZPV1 2LDRA 3NG2A 1X4IA 2JRJA 1WEUA 4YBTA 2EGPA 2ECVA 4A49A 4MVTA 4FJCA 4CA1A 5KH9A 3HCUA 2VPGA 4S3OB 1XWHA 5G0FA 3EB6A 2RI7A 4YAXA 4A0CD 4B86C 4I7CA 2OXQC 5TDWA 2YQMA 2HDPA 2M6MA 2LXHC 3U5OA 5FEYA 4LK9A 2CSZA 2M85A 1Z60A 4WZ3B 3O37A 2LXPC 5DKAA 2EODA 1IYMA 2QICA 5B77A 3QZVA 2PUYA 1HYJA 2QJ0A 3O36A 5B76A 4A4CA 3MHHA 2YSJA 5TBNA 3ZPVE 5H9MA 4AYCA 4N3WA 2YT5A 3RTRB 5LKZA 5TDRA 2VJEA 4P5OB 2LGVA 3KV6A 3C5KA 2MA5A 2LRIC 2RSDA 2MNZA 4WZ0A 4Q6FA 3U5NA 1Z6UA 3ZVYA 2MIQA 3PUQA 1K2FA 4ZDTA 2F42A 2ZETC 5JG6A 2FUIA 5D1MB 1WIMA 4GNFA 2M1RA 4IC2A 1BORA 2KWKA 3M62A 3U5PA 4UP0A 2KWOA 4F52B 3KQIA 1WEQA 2XB1A 2K16A 2KWNA 5H1UA 2YQLA 4GNGA 2CKLA 2DX8A 5AITA 4QF2A 2KFTA 1WESA 3LQIA 1WILA 4UI9B 5TABA 2K17A 1V87A 3DPLR 3SOWA 2YURA 1JM7B 2MT5A 3GL6A 2KREA 2CT2A 1WGMA 3SOUA 1MM3A 4X3GA 3T7LA 2KGGA 2MNYA 1VYXA 4V3LC 4ZQLA 3EB5A 3V43A 2JMJA 2MA6A 4O64A 2KYUA 2VPDA 4NN2A 1U6GB 2YU4A 2G45A 4YATA 5DINA 4WZ2A 3ASLA 4W4UA 1Z2QA 5B8DA 1JOCA 1F62A 2I50A 5LKTA 2MD7B 4S3OC 3M63A 3N9QA 4I7DA 1LDJB 5C11A 3IHPA 5I3LA 1VFYA 4YBMA 5H1TA 2EA6A 2LGKA 1E4UA 2KWJA 4LJNA 4GNDA 5B79A 1JM7A 3U5MA 3O35A 1MM2A 5FB0A 4BBQA 1WEOA 2KR4A 3LQHA 3FL2A 1DVPA 1WEVA 4YC9A 4BHWA 2Y1NA 2LGGA 2MD8C 2VJEB 3ZNIA 1CHCA 3RPGC 2L75A 2BAYA 2VPBA 5LKXA 2IDAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YAD A;  2UZG A;  3GV4 A;  5B78 A;  4R7E A;  4FIP A;  3C6W A;  4AP4 A;  1FBV A;  3LQJ A;  4LKA A;  2L43 A;  2HYE D;  1RMD A;  2LGL A;  4AUQ B;  3T6R A;  2QIZ A;  2F6N A;  2ECJ A;  4GB0 A;  4R8P K;  2AN6 A;  2VNF A;  3RPG B;  1WEE A;  1FP0 A;  2Y1M A;  3O70 A;  4AVX A;  2E6S A;  5C13 A;  5FER A;  1WE9 A;  3DQV R;  2C2V S;  2FUU A;  5LKU A;  2L5U A;  2PNX A;  3LRQ A;  3HCS A;  5EYA F;  4L58 A;  1WEW A;  3L1Z B;  4AYC B;  5AIU A;  3N9L A;  3VK6 A;  2YHO A;  4GNE A;  5J3X A;  2D8S A;  2H0D B;  2FSA A;  4V3K C;  4XI1 A;  2ECT A;  5H1V A;  5FB1 A;  4ZUX U;  2JMI A;  3L1X A;  2YRE A;  2K1J A;  2M3H A;  5D1L B;  3I2D A;  1WEP A;  3KV5 A;  3L11 A;  4N4F A;  2JMD A;  4PTB A;  1HYI A;  4YBS A;  2VPE A;  2ECI A;  1G25 A;  3MHS A;  2L80 A;  1T1H A;  5KH7 A;  4FO9 A;  5TRB A;  4A4B A;  3N9N A;  1WEN A;  4I7B A;  3ZTG A;  1X4J A;  5G04 B;  3PUR A;  2XEU A;  2G6Q A;  4R2Y A;  3ZVZ B;  3O33 A;  5D1K B;  3N9O A;  4QF3 A;  2NAA A;  2ECW A;  5B75 A;  4LLB A;  3M99 A;  1WFK A;  3N9M A;  2C2L A;  3ZYQ A;  2KU3 A;  4PPE A;  4TKP B;  2LN0 A;  2VJF B;  4MSX A;  2Y43 A;  4L7X A;  2F6J A;  2G43 A;  4WA6 A;  3SOX A;  3O34 A;  2LV9 A;  4C9Z A;  1LDK C;  2K4D A;  2KIZ A;  2VP7 A;  3PHD A;  2CSY A;  3SHB A;  2VJF A;  4UP5 A;  2LQ6 A;  3KNV A;  4B7Y C;  2YYR A;  4FK5 A;  1ZBD B;  4YAB A;  3N9P A;  2YW8 A;  3HTK C;  1VD4 A;  5LCW B;  2E6R A;  2ECG A;  1X4U A;  2KE1 A;  1WEM A;  2YSM A;  4LAD B;  3O7A A;  2L0B A;  2MUM A;  4IC3 A;  2KGI A;  2H0D A;  2YUC A;  2ECN A;  5G05 B;  2YHN A;  5KH3 A;  3HCT A;  2CKL B;  4CCG X;  1N87 A;  3ZPV 1;  2LDR A;  3NG2 A;  1X4I A;  2JRJ A;  1WEU A;  4YBT A;  2EGP A;  2ECV A;  4A49 A;  4MVT A;  4FJC A;  4CA1 A;  5KH9 A;  3HCU A;  2VPG A;  4S3O B;  1XWH A;  5G0F A;  3EB6 A;  2RI7 A;  4YAX A;  4A0C D;  4B86 C;  4I7C A;  2OXQ C;  5TDW A;  2YQM A;  2HDP A;  2M6M A;  2LXH C;  3U5O A;  5FEY A;  4LK9 A;  2CSZ A;  2M85 A;  1Z60 A;  4WZ3 B;  3O37 A;  2LXP C;  5DKA A;  2EOD A;  1IYM A;  2QIC A;  5B77 A;  3QZV A;  2PUY A;  1HYJ A;  2QJ0 A;  3O36 A;  5B76 A;  4A4C A;  3MHH A;  2YSJ A;  5TBN A;  3ZPV E;  5H9M A;  4AYC A;  4N3W A;  2YT5 A;  3RTR B;  5LKZ A;  5TDR A;  2VJE A;  4P5O B;  2LGV A;  3KV6 A;  3C5K A;  2MA5 A;  2LRI C;  2RSD A;  2MNZ A;  4WZ0 A;  4Q6F A;  3U5N A;  1Z6U A;  3ZVY A;  2MIQ A;  3PUQ A;  1K2F A;  4ZDT A;  2F42 A;  2ZET C;  5JG6 A;  2FUI A;  5D1M B;  1WIM A;  4GNF A;  2M1R A;  4IC2 A;  1BOR A;  2KWK A;  3M62 A;  3U5P A;  4UP0 A;  2KWO A;  4F52 B;  3KQI A;  1WEQ A;  2XB1 A;  2K16 A;  2KWN A;  5H1U A;  2YQL A;  4GNG A;  2CKL A;  2DX8 A;  5AIT A;  4QF2 A;  2KFT A;  1WES A;  3LQI A;  1WIL A;  4UI9 B;  5TAB A;  2K17 A;  1V87 A;  3DPL R;  3SOW A;  2YUR A;  1JM7 B;  2MT5 A;  3GL6 A;  2KRE A;  2CT2 A;  1WGM A;  3SOU A;  1MM3 A;  4X3G A;  3T7L A;  2KGG A;  2MNY A;  1VYX A;  4V3L C;  4ZQL A;  3EB5 A;  3V43 A;  2JMJ A;  2MA6 A;  4O64 A;  2KYU A;  2VPD A;  4NN2 A;  1U6G B;  2YU4 A;  2G45 A;  4YAT A;  5DIN A;  4WZ2 A;  3ASL A;  4W4U A;  1Z2Q A;  5B8D A;  1JOC A;  1F62 A;  2I50 A;  5LKT A;  2MD7 B;  4S3O C;  3M63 A;  3N9Q A;  4I7D A;  1LDJ B;  5C11 A;  3IHP A;  5I3L A;  1VFY A;  4YBM A;  5H1T A;  2EA6 A;  2LGK A;  1E4U A;  2KWJ A;  4LJN A;  4GND A;  5B79 A;  1JM7 A;  3U5M A;  3O35 A;  1MM2 A;  5FB0 A;  4BBQ A;  1WEO A;  2KR4 A;  3LQH A;  3FL2 A;  1DVP A;  1WEV A;  4YC9 A;  4BHW A;  2Y1N A;  2LGG A;  2MD8 C;  2VJE B;  3ZNI A;  1CHC A;  3RPG C;  2L75 A;  2BAY A;  2VPB A;  5LKX A;  2IDA A; 
#chains in the Genus database with same CATH topology
 4YAD A;  2UZG A;  4O62 A;  3GV4 A;  5B78 A;  4R7E A;  4FIP A;  3C6W A;  4AP4 A;  2DSM A;  2D8U A;  1FBV A;  3LQJ A;  4LKA A;  2L43 A;  2HYE D;  4OGC A;  2FD4 A;  1RMD A;  2LGL A;  3FM8 C;  4AUQ B;  3T6R A;  2QIZ A;  2F6N A;  2M13 A;  2XOZ A;  2ECJ A;  4GB0 A;  4R8P K;  2AN6 A;  2VNF A;  3RPG B;  1WEE A;  1FP0 A;  2Y1M A;  3O70 A;  4Z0O A;  4AVX A;  2E6S A;  5C13 A;  5FER A;  1WE9 A;  3DQV R;  2CSV A;  2JUN A;  2C2V S;  2FUU A;  5LKU A;  2L5U A;  2FFW A;  2PNX A;  3LRQ A;  3HCS A;  5EYA F;  2IQJ A;  4L58 A;  1WEW A;  3L1Z B;  4AYC B;  5AIU A;  3N9L A;  3VK6 A;  2YHO A;  3LDY A;  4GNE A;  5J3X A;  2D8S A;  2H0D B;  4Z0R A;  2P57 A;  2XOC A;  2FSA A;  4V3K C;  3DWD A;  4XI1 A;  2ECT A;  3LVQ E;  5H1V A;  5FB1 A;  4ZUX U;  2JMI A;  3L1X A;  2YRE A;  2K1J A;  2M3H A;  5D1L B;  3I2D A;  1WEP A;  3Q1D A;  2LAU A;  3KV5 A;  3L11 A;  2B0O E;  2JMD A;  4N4F A;  4PTB A;  1HYI A;  4YBS A;  2VPE A;  5SVX A;  2ECI A;  1G25 A;  3FJU B;  3MHS A;  2L80 A;  1T1H A;  5KH7 A;  3M7K A;  4FO9 A;  5TRB A;  4A4B A;  3N9N A;  1WEN A;  4I7B A;  3ZTG A;  1X4J A;  5G04 B;  3PUR A;  2XEU A;  2G6Q A;  4R2Y A;  3ZVZ B;  4F1P A;  3O33 A;  5D1K B;  3N9O A;  4QF3 A;  2NAA A;  2ECW A;  5B75 A;  2CON A;  4LLB A;  3M99 A;  1WFK A;  3N9M A;  2C2L A;  3ZYQ A;  2KU3 A;  4PPE A;  4TKP B;  2LN0 A;  2VJF B;  4MSX A;  2Y43 A;  4L7X A;  2F6J A;  5SVI B;  2G43 A;  4WA6 A;  3SOX A;  3O34 A;  3T9K A;  2KKY A;  2LV9 A;  4C9Z A;  1LDK C;  2K4D A;  2KIZ A;  2VP7 A;  3PHD A;  2CSY A;  3SHB A;  2VJF A;  4UP5 A;  2LQ6 A;  3KNV A;  4B7Y C;  2YYR A;  4FK5 A;  1ZBD B;  3N9P A;  4YAB A;  2YW8 A;  3HTK C;  1VD4 A;  5LCW B;  2E6R A;  2ECG A;  1X4U A;  2RR4 A;  3H7H A;  3MDB C;  2KE1 A;  2JM3 A;  1WEM A;  2YSM A;  4LAD B;  3O7A A;  2L0B A;  2MUM A;  4IC3 A;  2KGI A;  2H0D A;  2YUC A;  2ECN A;  4H9D A;  5G05 B;  2YHN A;  5KH3 A;  3HCT A;  2CKL B;  4CCG X;  1N87 A;  1DCQ A;  3ZPV 1;  2LDR A;  3NG2 A;  1X4I A;  2JRJ A;  2CRR A;  1WEU A;  4YBT A;  2EGP A;  2ECV A;  4QQ4 A;  4A49 A;  4MVT A;  3LJU X;  4FJC A;  5KH9 A;  4CA1 A;  3HCU A;  2VPG A;  4S3O B;  1XWH A;  5G0F A;  3EB6 A;  3E2D A;  2RI7 A;  4YAX A;  4A0C D;  4B86 C;  4I7C A;  2OXQ C;  5TDW A;  2YQM A;  2HDP A;  2M6M A;  1MBM A;  2LXH C;  3U5O A;  5FEY A;  4LK9 A;  2CSZ A;  2M85 A;  1Z60 A;  4WZ3 B;  3O37 A;  2LXP C;  5DKA A;  2EOD A;  1IYM A;  2QIC A;  5B77 A;  3QZV A;  2PUY A;  1HYJ A;  2QJ0 A;  3O36 A;  5B76 A;  3MHH A;  3FAN A;  4A4C A;  2YSJ A;  5TBN A;  2MKE A;  3ZPV E;  5H9M A;  4AYC A;  4N3W A;  2DJA A;  2YT5 A;  3RTR B;  5LKZ A;  5TDR A;  2VJE A;  4P5O B;  2LGV A;  3KV6 A;  3C5K A;  2MA5 A;  2LRI C;  2XOY A;  2RSD A;  2MNZ A;  4WZ0 A;  4Q6F A;  3U5N A;  3SUB A;  1Z6U A;  3ZVY A;  2L7P A;  2MIQ A;  3PUQ A;  1K2F A;  4ZDT A;  3FAO A;  2F42 A;  2ZET C;  5JG6 A;  2FUI A;  5D1M B;  1WIM A;  4GNF A;  2M1R A;  3PLW A;  4IC2 A;  2EXU A;  3DDT A;  1BOR A;  2KWK A;  3M62 A;  5SVY A;  3U5P A;  4UP0 A;  2KWO A;  4F52 B;  3KQI A;  1WEQ A;  2XB1 A;  2K16 A;  2KWN A;  5H1U A;  2YQL A;  4GNG A;  2CKL A;  2DX8 A;  5AIT A;  4QF2 A;  2KFT A;  2E61 A;  1WES A;  3O47 A;  3LQI A;  1WIL A;  4UI9 B;  5TAB A;  2K17 A;  1V87 A;  3DPL R;  3SOW A;  2YUR A;  1JM7 B;  2MT5 A;  3GL6 A;  2KRE A;  2CT2 A;  1WGM A;  3SOU A;  3LVR E;  1MM3 A;  4X3G A;  3T7L A;  2EGM A;  2KGG A;  2MNY A;  2OWA A;  3FEH A;  1VYX A;  4V3L C;  4ZQL A;  3EB5 A;  3V43 A;  2JMJ A;  2MA6 A;  4O64 A;  5SVI A;  2KYU A;  2VPD A;  2YVR A;  4NN2 A;  1U6G B;  2YU4 A;  2G45 A;  4YAT A;  5DIN A;  4WZ2 A;  3ASL A;  4W4U A;  5K3Q A;  2CRW A;  1Z2Q A;  5B8D A;  1JOC A;  1F62 A;  2I50 A;  5LKT A;  2MD7 B;  4S3O C;  3M63 A;  3N9Q A;  4I7D A;  3JUE A;  1LDJ B;  5C11 A;  3IHP A;  3KDE C;  5I3L A;  1VFY A;  4YBM A;  5H1T A;  2EA6 A;  2LGK A;  1E4U A;  2KWJ A;  4LJN A;  4GND A;  5B79 A;  1JM7 A;  3U5M A;  3O35 A;  1MM2 A;  5FB0 A;  4OGE A;  4BBQ A;  2KKX A;  1WEO A;  2KR4 A;  3LQH A;  3FL2 A;  2XP0 A;  1DVP A;  1WEV A;  4YC9 A;  4BHW A;  2Y1N A;  2LGG A;  2MD8 C;  2VJE B;  3ZNI A;  1CHC A;  3RPG C;  2L75 A;  2BAY A;  2VPB A;  5LKX A;  2IDA A; 
#chains in the Genus database with same CATH homology
 4YAD A;  2UZG A;  3GV4 A;  5B78 A;  4R7E A;  4FIP A;  3C6W A;  4AP4 A;  1FBV A;  3LQJ A;  4LKA A;  2L43 A;  2HYE D;  1RMD A;  2LGL A;  4AUQ B;  3T6R A;  2QIZ A;  2F6N A;  2ECJ A;  4GB0 A;  4R8P K;  2AN6 A;  2VNF A;  3RPG B;  1WEE A;  1FP0 A;  2Y1M A;  3O70 A;  4AVX A;  2E6S A;  5C13 A;  5FER A;  1WE9 A;  3DQV R;  2C2V S;  2FUU A;  5LKU A;  2L5U A;  2PNX A;  3LRQ A;  3HCS A;  5EYA F;  4L58 A;  1WEW A;  3L1Z B;  4AYC B;  5AIU A;  3N9L A;  3VK6 A;  2YHO A;  4GNE A;  5J3X A;  2D8S A;  2H0D B;  2FSA A;  4V3K C;  4XI1 A;  2ECT A;  5H1V A;  5FB1 A;  4ZUX U;  2JMI A;  3L1X A;  2YRE A;  2K1J A;  2M3H A;  5D1L B;  3I2D A;  1WEP A;  3KV5 A;  3L11 A;  4N4F A;  2JMD A;  4PTB A;  1HYI A;  4YBS A;  2VPE A;  2ECI A;  1G25 A;  3MHS A;  2L80 A;  1T1H A;  5KH7 A;  4FO9 A;  5TRB A;  4A4B A;  3N9N A;  1WEN A;  4I7B A;  3ZTG A;  1X4J A;  5G04 B;  3PUR A;  2XEU A;  2G6Q A;  4R2Y A;  3ZVZ B;  3O33 A;  5D1K B;  3N9O A;  4QF3 A;  2NAA A;  2ECW A;  5B75 A;  4LLB A;  3M99 A;  1WFK A;  3N9M A;  2C2L A;  3ZYQ A;  2KU3 A;  4PPE A;  4TKP B;  2LN0 A;  2VJF B;  4MSX A;  2Y43 A;  4L7X A;  2F6J A;  2G43 A;  4WA6 A;  3SOX A;  3O34 A;  2LV9 A;  4C9Z A;  1LDK C;  2K4D A;  2KIZ A;  2VP7 A;  3PHD A;  2CSY A;  3SHB A;  2VJF A;  4UP5 A;  2LQ6 A;  3KNV A;  4B7Y C;  2YYR A;  4FK5 A;  1ZBD B;  4YAB A;  3N9P A;  2YW8 A;  3HTK C;  1VD4 A;  5LCW B;  2E6R A;  2ECG A;  1X4U A;  2KE1 A;  1WEM A;  2YSM A;  4LAD B;  3O7A A;  2L0B A;  2MUM A;  4IC3 A;  2KGI A;  2H0D A;  2YUC A;  2ECN A;  5G05 B;  2YHN A;  5KH3 A;  3HCT A;  2CKL B;  4CCG X;  1N87 A;  3ZPV 1;  2LDR A;  3NG2 A;  1X4I A;  2JRJ A;  1WEU A;  4YBT A;  2EGP A;  2ECV A;  4A49 A;  4MVT A;  4FJC A;  4CA1 A;  5KH9 A;  3HCU A;  2VPG A;  4S3O B;  1XWH A;  5G0F A;  3EB6 A;  2RI7 A;  4YAX A;  4A0C D;  4B86 C;  4I7C A;  2OXQ C;  5TDW A;  2YQM A;  2HDP A;  2M6M A;  2LXH C;  3U5O A;  5FEY A;  4LK9 A;  2CSZ A;  2M85 A;  1Z60 A;  4WZ3 B;  3O37 A;  2LXP C;  5DKA A;  2EOD A;  1IYM A;  2QIC A;  5B77 A;  3QZV A;  2PUY A;  1HYJ A;  2QJ0 A;  3O36 A;  5B76 A;  4A4C A;  3MHH A;  2YSJ A;  5TBN A;  3ZPV E;  5H9M A;  4AYC A;  4N3W A;  2YT5 A;  3RTR B;  5LKZ A;  5TDR A;  2VJE A;  4P5O B;  2LGV A;  3KV6 A;  3C5K A;  2MA5 A;  2LRI C;  2RSD A;  2MNZ A;  4WZ0 A;  4Q6F A;  3U5N A;  1Z6U A;  3ZVY A;  2MIQ A;  3PUQ A;  1K2F A;  4ZDT A;  2F42 A;  2ZET C;  5JG6 A;  2FUI A;  5D1M B;  1WIM A;  4GNF A;  2M1R A;  4IC2 A;  1BOR A;  2KWK A;  3M62 A;  3U5P A;  4UP0 A;  2KWO A;  4F52 B;  3KQI A;  1WEQ A;  2XB1 A;  2K16 A;  2KWN A;  5H1U A;  2YQL A;  4GNG A;  2CKL A;  2DX8 A;  5AIT A;  4QF2 A;  2KFT A;  1WES A;  3LQI A;  1WIL A;  4UI9 B;  5TAB A;  2K17 A;  1V87 A;  3DPL R;  3SOW A;  2YUR A;  1JM7 B;  2MT5 A;  3GL6 A;  2KRE A;  2CT2 A;  1WGM A;  3SOU A;  1MM3 A;  4X3G A;  3T7L A;  2KGG A;  2MNY A;  1VYX A;  4V3L C;  4ZQL A;  3EB5 A;  3V43 A;  2JMJ A;  2MA6 A;  4O64 A;  2KYU A;  2VPD A;  4NN2 A;  1U6G B;  2YU4 A;  2G45 A;  4YAT A;  5DIN A;  4WZ2 A;  3ASL A;  4W4U A;  1Z2Q A;  5B8D A;  1JOC A;  1F62 A;  2I50 A;  5LKT A;  2MD7 B;  4S3O C;  3M63 A;  3N9Q A;  4I7D A;  1LDJ B;  5C11 A;  3IHP A;  5I3L A;  1VFY A;  4YBM A;  5H1T A;  2EA6 A;  2LGK A;  1E4U A;  2KWJ A;  4LJN A;  4GND A;  5B79 A;  1JM7 A;  3U5M A;  3O35 A;  1MM2 A;  5FB0 A;  4BBQ A;  1WEO A;  2KR4 A;  3LQH A;  3FL2 A;  1DVP A;  1WEV A;  4YC9 A;  4BHW A;  2Y1N A;  2LGG A;  2MD8 C;  2VJE B;  3ZNI A;  1CHC A;  3RPG C;  2L75 A;  2BAY A;  2VPB A;  5LKX A;  2IDA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...