4WZ2A

Crystal structure of u-box 2 of lubx / legu2 / lpp2887 from legionella pneumophila str. paris, ile175met mutant
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
75
structure length
75
Chain Sequence
TEIPDIFLCPISKTLIKTPVITAQGKVYDQEALSNFLIATGNKDETGKKLSMDDVVVFDELYQQIKVYNFYRKRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase LubX
publication title Molecular Characterization of LubX: Functional Divergence of the U-Box Fold by Legionella pneumophila.
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Ligase
total genus 18
structure length 75
sequence length 75
chains with identical sequence B, C
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2014-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04564 U-box U-box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4wz2A00
4W4UA 5KH9A 3I2DA 2G43A 2KREA 2YQLA 2DX8A 2OXQC 5D1LB 4C9ZA 2LRIC 4MVTA 2F6JA 3FL2A 3LQHA 2E6SA 4FIPA 2KIZA 3N9MA 1WESA 2ECVA 4UP5A 3O33A 1WIMA 3PHDA 3N9NA 3O34A 5AIUA 2VNFA 4WZ2A 3RPGC 2IDAA 2KWJA 1E4UA 1K2FA 4YAXA 5TDRA 5D1KB 4ZQLA 3O36A 2YW8A 2PUYA 1WEEA 5KH7A 4PPEA 3NG2A 2QJ0A 2LGKA 5J3XA 3KV5A 3L11A 2LQ6A 2XB1A 2ZETC 5JG6A 5AITA 4BBQA 2E6RA 3IHPA 5KH3A 4PTBA 4LJNA 1HYIA 5LKUA 2MD8C 5FB0A 4AVXA 2LGVA 4CA1A 4QF2A 2K17A 3KQIA 2KR4A 4I7CA 4FJCA 2Y1MA 4L7XA 2YHOA 2VJEA 1WEWA 4F52B 2K1JA 2K16A 3L1ZB 5FERA 4AP4A 2FUUA 2YSMA 2RSDA 3PURA 2YSJA 2AN6A 2CKLA 5FB1A 4IC2A 5H1TA 4ZUXU 2JMIA 5TABA 3QZVA 2KGIA 3O7AA 2KWNA 4TKPB 3GV4A 2Y43A 1X4UA 2KFTA 3T6RA 2VJEB 2D8SA 4L58A 1WEQA 3GL6A 4WZ0A 5FEYA 4QF3A 3SOWA 3MHSA 2NAAA 1WE9A 2H0DA 5H9MA 4O64A 2CKLB 1X4IA 4LADB 3M99A 3HCSA 5I3LA 4GNEA 2KYUA 4YATA 4S3OC 5LKTA 2LGGA 3N9OA 3DPLR 2H0DB 1VFYA 2ECWA 4LK9A 1Z60A 2F42A 4LLBA 5D1MB 2G45A 2JMJA 4FK5A 4A4BA 3DQVR 1FBVA 4MSXA 2ECIA 4I7BA 1WEMA 2ECJA 4A49A 4YABA 1XWHA 2VPGA 2KGGA 2I50A 4YBTA 2HDPA 5EYAF 5H1UA 4B86C 3RTRB 4FO9A 5TDWA 3ZNIA 2KWKA 2VP7A 1ZBDB 5DINA 4LKAA 3SOUA 2YYRA 1G25A 2M85A 5B77A 2MT5A 3ZVZB 2MD7B 3O35A 2KU3A 5B76A 3U5OA 5B79A 2QICA 2FSAA 4R2YA 3M63A 4R7EA 2JRJA 2L0BA 3C6WA 2YQMA 4R8PK 4IC3A 5DKAA 2K4DA 1WEOA 4V3KC 4N3WA 2L75A 1RMDA 1WEPA 2VPEA 1VD4A 2RI7A 4CCGX 4YADA 2YHNA 1MM3A 2PNXA 2LDRA 3SHBA 5G0FA 3LQJA 2L5UA 3PUQA 3ZVYA 3N9QA 1DVPA 5LKZA 3ZTGA 3O70A 4AUQB 2ECTA 3M62A 4X3GA 4AYCA 3L1XA 3RPGB 2LXPC 5H1VA 5LCWB 3EB5A 2Y1NA 2EA6A 5TBNA 2M6MA 3HCUA 3T7LA 2HYED 5C11A 5B8DA 2LN0A 4GNGA 1VYXA 1LDJB 2LGLA 5G04B 2M3HA 4B7YC 2CT2A 2XEUA 2JMDA 2VJFA 4ZDTA 1BORA 2CSZA 3U5PA 1WGMA 2G6QA 4WZ3B 4V3LC 2L43A 1WFKA 2KE1A 2YUCA 3U5NA 3LQIA 4BHWA 2MNYA 1CHCA 4GB0A 3VK6A 2VJFB 5B78A 1U6GB 5TRBA 3ZYQA 1JOCA 2YREA 3MHHA 2M1RA 2EGPA 1JM7A 2L80A 2MNZA 3U5MA 3C5KA 4YBMA 2YT5A 4NN2A 1WEUA 1X4JA 1N87A 1FP0A 1WENA 1HYJA 3HCTA 2VPDA 3N9LA 4UP0A 3SOXA 2YURA 2BAYA 2ECGA 2CSYA 2LV9A 2MA6A 4I7DA 4P5OB 2F6NA 2UZGA 4S3OB 2VPBA 5C13A 3KNVA 3N9PA 4Q6FA 4YBSA 1T1HA 3HTKC 1JM7B 1WEVA 5LKXA 2QIZA 3EB6A 4GNFA 4A0CD 3O37A 4YC9A 1Z6UA 3ASLA 2ECNA 4UI9B 1WILA 2FUIA 1LDKC 3KV6A 2YU4A 1F62A 2MA5A 2LXHC 3ZPVE 3ZPV1 5G05B 1V87A 4WA6A 4XI1A 2C2VS 2KWOA 1IYMA 1MM2A 3LRQA 2MIQA 2MUMA 4GNDA 2C2LA 1Z2QA 3V43A 4N4FA 4A4CA 2EODA 4AYCB 5B75A
chains in the Genus database with same CATH superfamily
4OGCA 4W4UA 5KH9A 3I2DA 2G43A 2KREA 2YQLA 2DX8A 2OXQC 2CONA 5D1LB 4C9ZA 2LRIC 4MVTA 2F6JA 3E2DA 3FL2A 3LQHA 2E6SA 5K3QA 3DWDA 4FIPA 2KIZA 2M13A 3N9MA 1WESA 3KDEC 2ECVA 2XOCA 3M7KA 4UP5A 3O33A 4Z0OA 1WIMA 3PHDA 3N9NA 3FJUB 3O34A 5AIUA 2VNFA 4WZ2A 3RPGC 2IDAA 2KWJA 2OWAA 1E4UA 1K2FA 4YAXA 5TDRA 5D1KB 4ZQLA 3O36A 4OGEA 2YW8A 2PUYA 1WEEA 5SVYA 2YVRA 5KH7A 2JUNA 4PPEA 3NG2A 2LAUA 2QJ0A 2LGKA 5J3XA 3KV5A 3L11A 2LQ6A 2XB1A 2P57A 2ZETC 5JG6A 5AITA 4BBQA 2KKYA 2E6RA 3IHPA 5KH3A 4PTBA 4LJNA 1HYIA 3MDBC 5LKUA 2MD8C 5FB0A 4AVXA 2LGVA 4CA1A 4QF2A 2K17A 3KQIA 2KR4A 1DCQA 4I7CA 4FJCA 2Y1MA 4L7XA 2JM3A 2YHOA 2VJEA 1WEWA 4F52B 2K1JA 2K16A 3L1ZB 5FERA 4AP4A 2FUUA 2YSMA 3T9KA 2RSDA 3PURA 2YSJA 2AN6A 3LVRE 2CKLA 2D8UA 5FB1A 4IC2A 2KKXA 5H1TA 4ZUXU 2JMIA 5TABA 3QZVA 2KGIA 3O7AA 2KWNA 3SUBA 4TKPB 3GV4A 5SVIB 2Y43A 1X4UA 2KFTA 3T6RA 2VJEB 2D8SA 4L58A 1WEQA 3GL6A 4WZ0A 5FEYA 4QF3A 3SOWA 3MHSA 2NAAA 1WE9A 2H0DA 5H9MA 4O64A 2CKLB 1X4IA 3DDTA 2DSMA 4LADB 3M99A 3HCSA 5I3LA 4GNEA 2KYUA 4YATA 4S3OC 2EGMA 5LKTA 2CRWA 2LGGA 3N9OA 3DPLR 2H0DB 1VFYA 2XOYA 2ECWA 4LK9A 1Z60A 2F42A 4LLBA 5D1MB 2G45A 2JMJA 4FK5A 1MBMA 4A4BA 3DQVR 1FBVA 4MSXA 2ECIA 4I7BA 1WEMA 2ECJA 4A49A 4YABA 1XWHA 2VPGA 2KGGA 2I50A 4YBTA 2HDPA 5EYAF 5H1UA 4B86C 2CRRA 3RTRB 4FO9A 2FD4A 5TDWA 3ZNIA 2KWKA 2XP0A 2VP7A 1ZBDB 5DINA 4LKAA 3SOUA 2YYRA 1G25A 2M85A 5B77A 2MT5A 3FAOA 3ZVZB 2MD7B 3O35A 2KU3A 5B76A 3U5OA 5B79A 3LVQE 2QICA 2FSAA 4R2YA 3M63A 4R7EA 2JRJA 2L0BA 3C6WA 2YQMA 4R8PK 4IC3A 5DKAA 2K4DA 1WEOA 4V3KC 4N3WA 2L75A 1RMDA 2IQJA 1WEPA 2VPEA 1VD4A 2CSVA 2RI7A 4CCGX 4YADA 2YHNA 1MM3A 2PNXA 2LDRA 3SHBA 5G0FA 4O62A 3LQJA 2L5UA 3PUQA 3ZVYA 3N9QA 1DVPA 5LKZA 3ZTGA 3O70A 4AUQB 2ECTA 3FM8C 3M62A 4X3GA 3FANA 4AYCA 3L1XA 3RPGB 2LXPC 5H1VA 5LCWB 3EB5A 2Y1NA 3LDYA 2EA6A 5TBNA 2L7PA 2M6MA 2MKEA 3HCUA 3T7LA 2HYED 5C11A 5B8DA 2LN0A 4GNGA 1VYXA 1LDJB 2LGLA 5G04B 2M3HA 4B7YC 2CT2A 2XEUA 2JMDA 2RR4A 2VJFA 4ZDTA 4F1PA 1BORA 2CSZA 3U5PA 1WGMA 2G6QA 4WZ3B 4V3LC 2L43A 1WFKA 2KE1A 2YUCA 2DJAA 3U5NA 3LQIA 4BHWA 2MNYA 3O47A 2E61A 1CHCA 4GB0A 3VK6A 2VJFB 5B78A 4Z0RA 1U6GB 5TRBA 3ZYQA 1JOCA 5SVXA 2YREA 3MHHA 2M1RA 2EGPA 1JM7A 2L80A 2MNZA 3U5MA 3C5KA 4YBMA 2YT5A 4NN2A 1WEUA 1X4JA 1N87A 1FP0A 1WENA 1HYJA 3HCTA 2VPDA 2FFWA 3N9LA 3PLWA 4UP0A 2YURA 5SVIA 3SOXA 2BAYA 4QQ4A 2ECGA 2CSYA 2LV9A 2MA6A 4I7DA 4P5OB 2F6NA 2UZGA 4S3OB 3FEHA 2VPBA 2B0OE 5C13A 3KNVA 3N9PA 4Q6FA 4YBSA 1T1HA 3HTKC 1JM7B 1WEVA 5LKXA 2QIZA 4H9DA 3EB6A 4GNFA 4A0CD 3H7HA 3O37A 4YC9A 1Z6UA 3Q1DA 3JUEA 3ASLA 2ECNA 4UI9B 1WILA 1LDKC 2FUIA 3KV6A 2YU4A 1F62A 2MA5A 2LXHC 3ZPVE 3ZPV1 5G05B 1V87A 4WA6A 4XI1A 2C2VS 2KWOA 1IYMA 1MM2A 3LRQA 2MIQA 2MUMA 4GNDA 2C2LA 1Z2QA 3LJUX 3V43A 4N4FA 4A4CA 2EODA 2EXUA 4AYCB 2XOZA 5B75A
chains in the Genus database with same CATH topology
4W4UA 5KH9A 3I2DA 2G43A 2KREA 2YQLA 2DX8A 2OXQC 5D1LB 4C9ZA 2LRIC 4MVTA 2F6JA 3FL2A 3LQHA 2E6SA 4FIPA 2KIZA 3N9MA 1WESA 2ECVA 4UP5A 3O33A 1WIMA 3PHDA 3N9NA 3O34A 5AIUA 2VNFA 4WZ2A 3RPGC 2IDAA 2KWJA 1E4UA 1K2FA 4YAXA 5TDRA 5D1KB 4ZQLA 3O36A 2YW8A 2PUYA 1WEEA 5KH7A 4PPEA 3NG2A 2QJ0A 2LGKA 5J3XA 3KV5A 3L11A 2LQ6A 2XB1A 2ZETC 5JG6A 5AITA 4BBQA 2E6RA 3IHPA 5KH3A 4PTBA 4LJNA 1HYIA 5LKUA 2MD8C 5FB0A 4AVXA 2LGVA 4CA1A 4QF2A 2K17A 3KQIA 2KR4A 4I7CA 4FJCA 2Y1MA 4L7XA 2YHOA 2VJEA 1WEWA 4F52B 2K1JA 2K16A 3L1ZB 5FERA 4AP4A 2FUUA 2YSMA 2RSDA 3PURA 2YSJA 2AN6A 2CKLA 5FB1A 4IC2A 5H1TA 4ZUXU 2JMIA 5TABA 3QZVA 2KGIA 3O7AA 2KWNA 4TKPB 3GV4A 2Y43A 1X4UA 2KFTA 3T6RA 2VJEB 2D8SA 4L58A 1WEQA 3GL6A 4WZ0A 5FEYA 4QF3A 3SOWA 3MHSA 2NAAA 1WE9A 2H0DA 5H9MA 4O64A 2CKLB 1X4IA 4LADB 3M99A 3HCSA 5I3LA 4GNEA 2KYUA 4YATA 4S3OC 5LKTA 2LGGA 3N9OA 3DPLR 2H0DB 1VFYA 2ECWA 4LK9A 1Z60A 2F42A 4LLBA 5D1MB 2G45A 2JMJA 4FK5A 4A4BA 3DQVR 1FBVA 4MSXA 2ECIA 4I7BA 1WEMA 2ECJA 4A49A 4YABA 1XWHA 2VPGA 2KGGA 2I50A 4YBTA 2HDPA 5EYAF 5H1UA 4B86C 3RTRB 4FO9A 5TDWA 3ZNIA 2KWKA 2VP7A 1ZBDB 5DINA 4LKAA 3SOUA 2YYRA 1G25A 2M85A 5B77A 2MT5A 3ZVZB 2MD7B 3O35A 2KU3A 5B76A 3U5OA 5B79A 2QICA 2FSAA 4R2YA 3M63A 4R7EA 2JRJA 2L0BA 3C6WA 2YQMA 4R8PK 4IC3A 5DKAA 2K4DA 1WEOA 4V3KC 4N3WA 2L75A 1RMDA 1WEPA 2VPEA 1VD4A 2RI7A 4CCGX 4YADA 2YHNA 1MM3A 2PNXA 2LDRA 3SHBA 5G0FA 3LQJA 2L5UA 3PUQA 3ZVYA 3N9QA 1DVPA 5LKZA 3ZTGA 3O70A 4AUQB 2ECTA 3M62A 4X3GA 4AYCA 3L1XA 3RPGB 2LXPC 5H1VA 5LCWB 3EB5A 2Y1NA 2EA6A 5TBNA 2M6MA 3HCUA 3T7LA 2HYED 5C11A 5B8DA 2LN0A 4GNGA 1VYXA 1LDJB 2LGLA 5G04B 2M3HA 4B7YC 2CT2A 2XEUA 2JMDA 2VJFA 4ZDTA 1BORA 2CSZA 3U5PA 1WGMA 2G6QA 4WZ3B 4V3LC 2L43A 1WFKA 2KE1A 2YUCA 3U5NA 3LQIA 4BHWA 2MNYA 1CHCA 4GB0A 3VK6A 2VJFB 5B78A 1U6GB 5TRBA 3ZYQA 1JOCA 2YREA 3MHHA 2M1RA 2EGPA 1JM7A 2L80A 2MNZA 3U5MA 3C5KA 4YBMA 2YT5A 4NN2A 1WEUA 1X4JA 1N87A 1FP0A 1WENA 1HYJA 3HCTA 2VPDA 3N9LA 4UP0A 3SOXA 2YURA 2BAYA 2ECGA 2CSYA 2LV9A 2MA6A 4I7DA 4P5OB 2F6NA 2UZGA 4S3OB 2VPBA 5C13A 3KNVA 3N9PA 4Q6FA 4YBSA 1T1HA 3HTKC 1JM7B 1WEVA 5LKXA 2QIZA 3EB6A 4GNFA 4A0CD 3O37A 4YC9A 1Z6UA 3ASLA 2ECNA 4UI9B 1WILA 2FUIA 1LDKC 3KV6A 2YU4A 1F62A 2MA5A 2LXHC 3ZPVE 3ZPV1 5G05B 1V87A 4WA6A 4XI1A 2C2VS 2KWOA 1IYMA 1MM2A 3LRQA 2MIQA 2MUMA 4GNDA 2C2LA 1Z2QA 3V43A 4N4FA 4A4CA 2EODA 4AYCB 5B75A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W4U A;  5KH9 A;  3I2D A;  2G43 A;  2KRE A;  2YQL A;  2DX8 A;  2OXQ C;  5D1L B;  4C9Z A;  2LRI C;  4MVT A;  2F6J A;  3FL2 A;  3LQH A;  2E6S A;  4FIP A;  2KIZ A;  3N9M A;  1WES A;  2ECV A;  4UP5 A;  3O33 A;  1WIM A;  3PHD A;  3N9N A;  3O34 A;  5AIU A;  2VNF A;  4WZ2 A;  3RPG C;  2IDA A;  2KWJ A;  1E4U A;  1K2F A;  4YAX A;  5TDR A;  5D1K B;  4ZQL A;  3O36 A;  2YW8 A;  2PUY A;  1WEE A;  5KH7 A;  4PPE A;  3NG2 A;  2QJ0 A;  2LGK A;  5J3X A;  3KV5 A;  3L11 A;  2LQ6 A;  2XB1 A;  2ZET C;  5JG6 A;  5AIT A;  4BBQ A;  2E6R A;  3IHP A;  5KH3 A;  4PTB A;  4LJN A;  1HYI A;  5LKU A;  2MD8 C;  5FB0 A;  4AVX A;  2LGV A;  4CA1 A;  4QF2 A;  2K17 A;  3KQI A;  2KR4 A;  4I7C A;  4FJC A;  2Y1M A;  4L7X A;  2YHO A;  2VJE A;  1WEW A;  4F52 B;  2K1J A;  2K16 A;  3L1Z B;  5FER A;  4AP4 A;  2FUU A;  2YSM A;  2RSD A;  3PUR A;  2YSJ A;  2AN6 A;  2CKL A;  5FB1 A;  4IC2 A;  5H1T A;  4ZUX U;  2JMI A;  5TAB A;  3QZV A;  2KGI A;  3O7A A;  2KWN A;  4TKP B;  3GV4 A;  2Y43 A;  1X4U A;  2KFT A;  3T6R A;  2VJE B;  2D8S A;  4L58 A;  1WEQ A;  3GL6 A;  4WZ0 A;  5FEY A;  4QF3 A;  3SOW A;  3MHS A;  2NAA A;  1WE9 A;  2H0D A;  5H9M A;  4O64 A;  2CKL B;  1X4I A;  4LAD B;  3M99 A;  3HCS A;  5I3L A;  4GNE A;  2KYU A;  4YAT A;  4S3O C;  5LKT A;  2LGG A;  3N9O A;  3DPL R;  2H0D B;  1VFY A;  2ECW A;  4LK9 A;  1Z60 A;  2F42 A;  4LLB A;  5D1M B;  2G45 A;  2JMJ A;  4FK5 A;  4A4B A;  3DQV R;  1FBV A;  4MSX A;  2ECI A;  4I7B A;  1WEM A;  2ECJ A;  4A49 A;  4YAB A;  1XWH A;  2VPG A;  2KGG A;  2I50 A;  4YBT A;  2HDP A;  5EYA F;  5H1U A;  4B86 C;  3RTR B;  4FO9 A;  5TDW A;  3ZNI A;  2KWK A;  2VP7 A;  1ZBD B;  5DIN A;  4LKA A;  3SOU A;  2YYR A;  1G25 A;  2M85 A;  5B77 A;  2MT5 A;  3ZVZ B;  2MD7 B;  3O35 A;  2KU3 A;  5B76 A;  3U5O A;  5B79 A;  2QIC A;  2FSA A;  4R2Y A;  3M63 A;  4R7E A;  2JRJ A;  2L0B A;  3C6W A;  2YQM A;  4R8P K;  4IC3 A;  5DKA A;  2K4D A;  1WEO A;  4V3K C;  4N3W A;  2L75 A;  1RMD A;  1WEP A;  2VPE A;  1VD4 A;  2RI7 A;  4CCG X;  4YAD A;  2YHN A;  1MM3 A;  2PNX A;  2LDR A;  3SHB A;  5G0F A;  3LQJ A;  2L5U A;  3PUQ A;  3ZVY A;  3N9Q A;  1DVP A;  5LKZ A;  3ZTG A;  3O70 A;  4AUQ B;  2ECT A;  3M62 A;  4X3G A;  4AYC A;  3L1X A;  3RPG B;  2LXP C;  5H1V A;  5LCW B;  3EB5 A;  2Y1N A;  2EA6 A;  5TBN A;  2M6M A;  3HCU A;  3T7L A;  2HYE D;  5C11 A;  5B8D A;  2LN0 A;  4GNG A;  1VYX A;  1LDJ B;  2LGL A;  5G04 B;  2M3H A;  4B7Y C;  2CT2 A;  2XEU A;  2JMD A;  2VJF A;  4ZDT A;  1BOR A;  2CSZ A;  3U5P A;  1WGM A;  2G6Q A;  4WZ3 B;  4V3L C;  2L43 A;  1WFK A;  2KE1 A;  2YUC A;  3U5N A;  3LQI A;  4BHW A;  2MNY A;  1CHC A;  4GB0 A;  3VK6 A;  2VJF B;  5B78 A;  1U6G B;  5TRB A;  3ZYQ A;  1JOC A;  2YRE A;  3MHH A;  2M1R A;  2EGP A;  1JM7 A;  2L80 A;  2MNZ A;  3U5M A;  3C5K A;  4YBM A;  2YT5 A;  4NN2 A;  1WEU A;  1X4J A;  1N87 A;  1FP0 A;  1WEN A;  1HYJ A;  3HCT A;  2VPD A;  3N9L A;  4UP0 A;  3SOX A;  2YUR A;  2BAY A;  2ECG A;  2CSY A;  2LV9 A;  2MA6 A;  4I7D A;  4P5O B;  2F6N A;  2UZG A;  4S3O B;  2VPB A;  5C13 A;  3KNV A;  3N9P A;  4Q6F A;  4YBS A;  1T1H A;  3HTK C;  1JM7 B;  1WEV A;  5LKX A;  2QIZ A;  3EB6 A;  4GNF A;  4A0C D;  3O37 A;  4YC9 A;  1Z6U A;  3ASL A;  2ECN A;  4UI9 B;  1WIL A;  2FUI A;  1LDK C;  3KV6 A;  2YU4 A;  1F62 A;  2MA5 A;  2LXH C;  3ZPV E;  3ZPV 1;  5G05 B;  1V87 A;  4WA6 A;  4XI1 A;  2C2V S;  2KWO A;  1IYM A;  1MM2 A;  3LRQ A;  2MIQ A;  2MUM A;  4GND A;  2C2L A;  1Z2Q A;  3V43 A;  4N4F A;  4A4C A;  2EOD A;  4AYC B;  5B75 A; 
#chains in the Genus database with same CATH topology
 4OGC A;  4W4U A;  5KH9 A;  3I2D A;  2G43 A;  2KRE A;  2YQL A;  2DX8 A;  2OXQ C;  2CON A;  5D1L B;  4C9Z A;  2LRI C;  4MVT A;  2F6J A;  3E2D A;  3FL2 A;  3LQH A;  2E6S A;  5K3Q A;  3DWD A;  4FIP A;  2KIZ A;  2M13 A;  3N9M A;  1WES A;  3KDE C;  2ECV A;  2XOC A;  3M7K A;  4UP5 A;  3O33 A;  4Z0O A;  1WIM A;  3PHD A;  3N9N A;  3FJU B;  3O34 A;  5AIU A;  2VNF A;  4WZ2 A;  3RPG C;  2IDA A;  2KWJ A;  2OWA A;  1E4U A;  1K2F A;  4YAX A;  5TDR A;  5D1K B;  4ZQL A;  3O36 A;  4OGE A;  2YW8 A;  2PUY A;  1WEE A;  5SVY A;  2YVR A;  5KH7 A;  2JUN A;  4PPE A;  3NG2 A;  2LAU A;  2QJ0 A;  2LGK A;  5J3X A;  3KV5 A;  3L11 A;  2LQ6 A;  2XB1 A;  2P57 A;  2ZET C;  5JG6 A;  5AIT A;  4BBQ A;  2KKY A;  2E6R A;  3IHP A;  5KH3 A;  4PTB A;  4LJN A;  1HYI A;  3MDB C;  5LKU A;  2MD8 C;  5FB0 A;  4AVX A;  2LGV A;  4CA1 A;  4QF2 A;  2K17 A;  3KQI A;  2KR4 A;  1DCQ A;  4I7C A;  4FJC A;  2Y1M A;  4L7X A;  2JM3 A;  2YHO A;  2VJE A;  1WEW A;  4F52 B;  2K1J A;  2K16 A;  3L1Z B;  5FER A;  4AP4 A;  2FUU A;  2YSM A;  3T9K A;  2RSD A;  3PUR A;  2YSJ A;  2AN6 A;  3LVR E;  2CKL A;  2D8U A;  5FB1 A;  4IC2 A;  2KKX A;  5H1T A;  4ZUX U;  2JMI A;  5TAB A;  3QZV A;  2KGI A;  3O7A A;  2KWN A;  3SUB A;  4TKP B;  3GV4 A;  5SVI B;  2Y43 A;  1X4U A;  2KFT A;  3T6R A;  2VJE B;  2D8S A;  4L58 A;  1WEQ A;  3GL6 A;  4WZ0 A;  5FEY A;  4QF3 A;  3SOW A;  3MHS A;  2NAA A;  1WE9 A;  2H0D A;  5H9M A;  4O64 A;  2CKL B;  1X4I A;  3DDT A;  2DSM A;  4LAD B;  3M99 A;  3HCS A;  5I3L A;  4GNE A;  2KYU A;  4YAT A;  4S3O C;  2EGM A;  5LKT A;  2CRW A;  2LGG A;  3N9O A;  3DPL R;  2H0D B;  1VFY A;  2XOY A;  2ECW A;  4LK9 A;  1Z60 A;  2F42 A;  4LLB A;  5D1M B;  2G45 A;  2JMJ A;  4FK5 A;  1MBM A;  4A4B A;  3DQV R;  1FBV A;  4MSX A;  2ECI A;  4I7B A;  1WEM A;  2ECJ A;  4A49 A;  4YAB A;  1XWH A;  2VPG A;  2KGG A;  2I50 A;  4YBT A;  2HDP A;  5EYA F;  5H1U A;  4B86 C;  2CRR A;  3RTR B;  4FO9 A;  2FD4 A;  5TDW A;  3ZNI A;  2KWK A;  2XP0 A;  2VP7 A;  1ZBD B;  5DIN A;  4LKA A;  3SOU A;  2YYR A;  1G25 A;  2M85 A;  5B77 A;  2MT5 A;  3FAO A;  3ZVZ B;  2MD7 B;  3O35 A;  2KU3 A;  5B76 A;  3U5O A;  5B79 A;  3LVQ E;  2QIC A;  2FSA A;  4R2Y A;  3M63 A;  4R7E A;  2JRJ A;  2L0B A;  3C6W A;  2YQM A;  4R8P K;  4IC3 A;  5DKA A;  2K4D A;  1WEO A;  4V3K C;  4N3W A;  2L75 A;  1RMD A;  2IQJ A;  1WEP A;  2VPE A;  1VD4 A;  2CSV A;  2RI7 A;  4CCG X;  4YAD A;  2YHN A;  1MM3 A;  2PNX A;  2LDR A;  3SHB A;  5G0F A;  4O62 A;  3LQJ A;  2L5U A;  3PUQ A;  3ZVY A;  3N9Q A;  1DVP A;  5LKZ A;  3ZTG A;  3O70 A;  4AUQ B;  2ECT A;  3FM8 C;  3M62 A;  4X3G A;  3FAN A;  4AYC A;  3L1X A;  3RPG B;  2LXP C;  5H1V A;  5LCW B;  3EB5 A;  2Y1N A;  3LDY A;  2EA6 A;  5TBN A;  2L7P A;  2M6M A;  2MKE A;  3HCU A;  3T7L A;  2HYE D;  5C11 A;  5B8D A;  2LN0 A;  4GNG A;  1VYX A;  1LDJ B;  2LGL A;  5G04 B;  2M3H A;  4B7Y C;  2CT2 A;  2XEU A;  2JMD A;  2RR4 A;  2VJF A;  4ZDT A;  4F1P A;  1BOR A;  2CSZ A;  3U5P A;  1WGM A;  2G6Q A;  4WZ3 B;  4V3L C;  2L43 A;  1WFK A;  2KE1 A;  2YUC A;  2DJA A;  3U5N A;  3LQI A;  4BHW A;  2MNY A;  3O47 A;  2E61 A;  1CHC A;  4GB0 A;  3VK6 A;  2VJF B;  5B78 A;  4Z0R A;  1U6G B;  5TRB A;  3ZYQ A;  1JOC A;  5SVX A;  2YRE A;  3MHH A;  2M1R A;  2EGP A;  1JM7 A;  2L80 A;  2MNZ A;  3U5M A;  3C5K A;  4YBM A;  2YT5 A;  4NN2 A;  1WEU A;  1X4J A;  1N87 A;  1FP0 A;  1WEN A;  1HYJ A;  3HCT A;  2VPD A;  2FFW A;  3N9L A;  3PLW A;  4UP0 A;  2YUR A;  5SVI A;  3SOX A;  2BAY A;  4QQ4 A;  2ECG A;  2CSY A;  2LV9 A;  2MA6 A;  4I7D A;  4P5O B;  2F6N A;  2UZG A;  4S3O B;  3FEH A;  2VPB A;  2B0O E;  5C13 A;  3KNV A;  3N9P A;  4Q6F A;  4YBS A;  1T1H A;  3HTK C;  1JM7 B;  1WEV A;  5LKX A;  2QIZ A;  4H9D A;  3EB6 A;  4GNF A;  4A0C D;  3H7H A;  3O37 A;  4YC9 A;  1Z6U A;  3Q1D A;  3JUE A;  3ASL A;  2ECN A;  4UI9 B;  1WIL A;  1LDK C;  2FUI A;  3KV6 A;  2YU4 A;  1F62 A;  2MA5 A;  2LXH C;  3ZPV E;  3ZPV 1;  5G05 B;  1V87 A;  4WA6 A;  4XI1 A;  2C2V S;  2KWO A;  1IYM A;  1MM2 A;  3LRQ A;  2MIQ A;  2MUM A;  4GND A;  2C2L A;  1Z2Q A;  3LJU X;  3V43 A;  4N4F A;  4A4C A;  2EOD A;  2EXU A;  4AYC B;  2XOZ A;  5B75 A; 
#chains in the Genus database with same CATH homology
 4W4U A;  5KH9 A;  3I2D A;  2G43 A;  2KRE A;  2YQL A;  2DX8 A;  2OXQ C;  5D1L B;  4C9Z A;  2LRI C;  4MVT A;  2F6J A;  3FL2 A;  3LQH A;  2E6S A;  4FIP A;  2KIZ A;  3N9M A;  1WES A;  2ECV A;  4UP5 A;  3O33 A;  1WIM A;  3PHD A;  3N9N A;  3O34 A;  5AIU A;  2VNF A;  4WZ2 A;  3RPG C;  2IDA A;  2KWJ A;  1E4U A;  1K2F A;  4YAX A;  5TDR A;  5D1K B;  4ZQL A;  3O36 A;  2YW8 A;  2PUY A;  1WEE A;  5KH7 A;  4PPE A;  3NG2 A;  2QJ0 A;  2LGK A;  5J3X A;  3KV5 A;  3L11 A;  2LQ6 A;  2XB1 A;  2ZET C;  5JG6 A;  5AIT A;  4BBQ A;  2E6R A;  3IHP A;  5KH3 A;  4PTB A;  4LJN A;  1HYI A;  5LKU A;  2MD8 C;  5FB0 A;  4AVX A;  2LGV A;  4CA1 A;  4QF2 A;  2K17 A;  3KQI A;  2KR4 A;  4I7C A;  4FJC A;  2Y1M A;  4L7X A;  2YHO A;  2VJE A;  1WEW A;  4F52 B;  2K1J A;  2K16 A;  3L1Z B;  5FER A;  4AP4 A;  2FUU A;  2YSM A;  2RSD A;  3PUR A;  2YSJ A;  2AN6 A;  2CKL A;  5FB1 A;  4IC2 A;  5H1T A;  4ZUX U;  2JMI A;  5TAB A;  3QZV A;  2KGI A;  3O7A A;  2KWN A;  4TKP B;  3GV4 A;  2Y43 A;  1X4U A;  2KFT A;  3T6R A;  2VJE B;  2D8S A;  4L58 A;  1WEQ A;  3GL6 A;  4WZ0 A;  5FEY A;  4QF3 A;  3SOW A;  3MHS A;  2NAA A;  1WE9 A;  2H0D A;  5H9M A;  4O64 A;  2CKL B;  1X4I A;  4LAD B;  3M99 A;  3HCS A;  5I3L A;  4GNE A;  2KYU A;  4YAT A;  4S3O C;  5LKT A;  2LGG A;  3N9O A;  3DPL R;  2H0D B;  1VFY A;  2ECW A;  4LK9 A;  1Z60 A;  2F42 A;  4LLB A;  5D1M B;  2G45 A;  2JMJ A;  4FK5 A;  4A4B A;  3DQV R;  1FBV A;  4MSX A;  2ECI A;  4I7B A;  1WEM A;  2ECJ A;  4A49 A;  4YAB A;  1XWH A;  2VPG A;  2KGG A;  2I50 A;  4YBT A;  2HDP A;  5EYA F;  5H1U A;  4B86 C;  3RTR B;  4FO9 A;  5TDW A;  3ZNI A;  2KWK A;  2VP7 A;  1ZBD B;  5DIN A;  4LKA A;  3SOU A;  2YYR A;  1G25 A;  2M85 A;  5B77 A;  2MT5 A;  3ZVZ B;  2MD7 B;  3O35 A;  2KU3 A;  5B76 A;  3U5O A;  5B79 A;  2QIC A;  2FSA A;  4R2Y A;  3M63 A;  4R7E A;  2JRJ A;  2L0B A;  3C6W A;  2YQM A;  4R8P K;  4IC3 A;  5DKA A;  2K4D A;  1WEO A;  4V3K C;  4N3W A;  2L75 A;  1RMD A;  1WEP A;  2VPE A;  1VD4 A;  2RI7 A;  4CCG X;  4YAD A;  2YHN A;  1MM3 A;  2PNX A;  2LDR A;  3SHB A;  5G0F A;  3LQJ A;  2L5U A;  3PUQ A;  3ZVY A;  3N9Q A;  1DVP A;  5LKZ A;  3ZTG A;  3O70 A;  4AUQ B;  2ECT A;  3M62 A;  4X3G A;  4AYC A;  3L1X A;  3RPG B;  2LXP C;  5H1V A;  5LCW B;  3EB5 A;  2Y1N A;  2EA6 A;  5TBN A;  2M6M A;  3HCU A;  3T7L A;  2HYE D;  5C11 A;  5B8D A;  2LN0 A;  4GNG A;  1VYX A;  1LDJ B;  2LGL A;  5G04 B;  2M3H A;  4B7Y C;  2CT2 A;  2XEU A;  2JMD A;  2VJF A;  4ZDT A;  1BOR A;  2CSZ A;  3U5P A;  1WGM A;  2G6Q A;  4WZ3 B;  4V3L C;  2L43 A;  1WFK A;  2KE1 A;  2YUC A;  3U5N A;  3LQI A;  4BHW A;  2MNY A;  1CHC A;  4GB0 A;  3VK6 A;  2VJF B;  5B78 A;  1U6G B;  5TRB A;  3ZYQ A;  1JOC A;  2YRE A;  3MHH A;  2M1R A;  2EGP A;  1JM7 A;  2L80 A;  2MNZ A;  3U5M A;  3C5K A;  4YBM A;  2YT5 A;  4NN2 A;  1WEU A;  1X4J A;  1N87 A;  1FP0 A;  1WEN A;  1HYJ A;  3HCT A;  2VPD A;  3N9L A;  4UP0 A;  3SOX A;  2YUR A;  2BAY A;  2ECG A;  2CSY A;  2LV9 A;  2MA6 A;  4I7D A;  4P5O B;  2F6N A;  2UZG A;  4S3O B;  2VPB A;  5C13 A;  3KNV A;  3N9P A;  4Q6F A;  4YBS A;  1T1H A;  3HTK C;  1JM7 B;  1WEV A;  5LKX A;  2QIZ A;  3EB6 A;  4GNF A;  4A0C D;  3O37 A;  4YC9 A;  1Z6U A;  3ASL A;  2ECN A;  4UI9 B;  1WIL A;  2FUI A;  1LDK C;  3KV6 A;  2YU4 A;  1F62 A;  2MA5 A;  2LXH C;  3ZPV E;  3ZPV 1;  5G05 B;  1V87 A;  4WA6 A;  4XI1 A;  2C2V S;  2KWO A;  1IYM A;  1MM2 A;  3LRQ A;  2MIQ A;  2MUM A;  4GND A;  2C2L A;  1Z2Q A;  3V43 A;  4N4F A;  4A4C A;  2EOD A;  4AYC B;  5B75 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...