4WZ2A

Crystal structure of u-box 2 of lubx / legu2 / lpp2887 from legionella pneumophila str. paris, ile175met mutant
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
75
structure length
75
Chain Sequence
b'TEIPDIFLCPISKTLIKTPVITAQGKVYDQEALSNFLIATGNKDETGKKLSMDDVVVFDELYQQIKVYNFYRKRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase LubX
publication title Molecular Characterization of LubX: Functional Divergence of the U-Box Fold by Legionella pneumophila.
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Ligase
total genus 18
structure length 75
sequence length 75
chains with identical sequence B, C
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2014-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04564 U-box U-box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4wz2A00
4IC3A 3M63A 4YBMA 2HDPA 3LQIA 3PUQA 4B86C 2LGLA 2F42A 2UZGA 2AN6A 4GNFA 2VJFA 2VJFB 4BHWA 2YT5A 2I50A 1WILA 4YBTA 1N87A 1WEOA 1VFYA 1JM7A 1JM7B 2Y43A 2LV9A 5H1UA 1G25A 2ECVA 1LDJB 2L5UA 3HTKC 3O37A 3RPGB 2YQLA 2C2LA 3N9NA 4MSXA 5H1TA 4GNEA 1WEMA 2F6JA 4WZ3B 2ZETC 2LGVA 1T1HA 2YURA 5KH7A 2YU4A 2MNZA 3VK6A 2VPBA 2G6QA 5D1MB 4FIPA 5FEYA 2VPGA 3HCTA 2QICA 2E6SA 5DINA 3L1XA 4N4FA 1BORA 1HYIA 3C6WA 1U6GB 3EB5A 2RI7A 5G04B 4CCGX 2EGPA 3RTRB 2KR4A 3N9QA 2Y1MA 5AIUA 1V87A 5KH3A 2YREA 1VYXA 4S3OB 4ZQLA 2OXQC 4W4UA 5FB0A 2JMJA 1WEPA 5D1LB 4YBSA 2VNFA 2K17A 2KU3A 3I2DA 4LADB 1JOCA 5FERA 2M1RA 1HYJA 5B78A 4L58A 2LDRA 2YQMA 1FBVA 4UI9B 4S3OC 2L0BA 1WIMA 5LKTA 3PURA 3KV5A 2MD8C 4I7DA 4AVXA 3KNVA 4XI1A 3ZPVE 2FSAA 2VP7A 2YW8A 3ZYQA 2K1JA 5TDWA 1WESA 2MNYA 4N3WA 2YHOA 3ZTGA 2YSMA 2M85A 3DPLR 1X4JA 2G43A 4AYCA 4AYCB 5DKAA 3LQJA 1X4UA 3O36A 2ECWA 2YUCA 2MA5A 2EA6A 3LQHA 4ZUXU 1WEVA 5LKXA 2KE1A 2JMIA 2JMDA 5TRBA 2LXPC 5KH9A 4LKAA 3SOWA 4GB0A 4LK9A 3ZVYA 4Q6FA 1WEQA 2YYRA 3SOXA 2LXHC 4QF3A 1WEEA 4R8PK 3ZPV1 2XB1A 4P5OB 5JG6A 3EB6A 4BBQA 1Z60A 4YC9A 4FK5A 4R2YA 3ZNIA 5AITA 1WGMA 2C2VS 3N9PA 3N9LA 4LLBA 4FO9A 4PTBA 5H1VA 4QF2A 1WENA 4I7BA 5LKUA 2KWNA 4A4BA 5J3XA 2LQ6A 2EODA 3V43A 2CSZA 4O64A 1F62A 1ZBDB 4YAXA 2L43A 3FL2A 2HYED 3O33A 2KYUA 3SOUA 2K16A 5C13A 5B79A 2ECTA 2E6RA 4V3KC 5FB1A 5TABA 1Z2QA 2XEUA 4WZ0A 2NAAA 1K2FA 3ZVZB 3IHPA 3KQIA 2CKLA 2VJEA 2VJEB 3MHHA 1MM3A 2ECGA 2RSDA 2G45A 2L80A 4A49A 3GV4A 1FP0A 2JRJA 3T7LA 3O70A 3U5OA 4AP4A 3SHBA 3KV6A 3U5PA 2BAYA 2PUYA 3N9MA 2M3HA 2ECIA 1IYMA 4GNGA 4R7EA 2K4DA 4TKPB 5D1KB 5C11A 2MD7B 2LRIC 3O35A 2DX8A 4UP0A 3M62A 4GNDA 5B75A 5LKZA 1CHCA 4I7CA 4C9ZA 1XWHA 2CT2A 4A0CD 2KFTA 2ECJA 3GL6A 2Y1NA 3C5KA 4LJNA 2FUUA 4UP5A 1DVPA 4F52B 4IC2A 3HCUA 3U5NA 4X3GA 1Z6UA 2KGGA 4CA1A 2YSJA 2MIQA 2F6NA 2MUMA 4B7YC 5EYAF 5H9MA 1LDKC 4WZ2A 2QIZA 5B76A 2M6MA 4MVTA 3U5MA 4YATA 4FJCA 2CSYA 3O34A 1WEUA 2PNXA 3N9OA 5LCWB 3MHSA 3RPGC 2KREA 4WA6A 2H0DA 2H0DB 4AUQB 5TDRA 4YADA 2IDAA 1MM2A 4A4CA 1RMDA 2FUIA 5B8DA 2QJ0A 4YABA 4V3LC 1WEWA 2KWOA 2MT5A 2CKLB 5I3LA 2L75A 3LRQA 5G05B 5TBNA 2KGIA 5B77A 4NN2A 3O7AA 2YHNA 3QZVA 3L11A 3ASLA 1VD4A 2ECNA 2KIZA 1E4UA 3DQVR 1WFKA 2LGKA 1WE9A 5G0FA 2KWKA 3PHDA 2VPDA 1X4IA 2D8SA 2LGGA 3HCSA 4PPEA 3T6RA 3M99A 2LN0A 4L7XA 3L1ZB 2MA6A 3NG2A 2KWJA 4ZDTA 2VPEA
chains in the Genus database with same CATH superfamily
4IC3A 3M63A 4YBMA 2HDPA 3LQIA 3PUQA 4B86C 2LGLA 2F42A 2UZGA 2AN6A 4GNFA 2VJFA 2VJFB 2CRRA 4BHWA 2YT5A 2I50A 1WILA 4YBTA 1N87A 1WEOA 1VFYA 1JM7A 1JM7B 4QQ4A 2Y43A 2LV9A 5H1UA 2MKEA 1G25A 2ECVA 1LDJB 2L5UA 3HTKC 3O37A 3RPGB 2YQLA 2C2LA 3N9NA 4MSXA 5H1TA 4GNEA 1WEMA 2F6JA 4WZ3B 2ZETC 2LGVA 1T1HA 2KKYA 2YURA 5KH7A 2YU4A 2MNZA 3VK6A 2VPBA 4OGEA 2G6QA 5D1MB 4FIPA 5FEYA 2VPGA 3HCTA 2QICA 2E6SA 5DINA 3L1XA 4N4FA 1BORA 1HYIA 2XP0A 3C6WA 1U6GB 3EB5A 2RI7A 5G04B 4CCGX 2EGPA 3RTRB 2KR4A 3N9QA 2KKXA 2Y1MA 5AIUA 1V87A 5KH3A 2JUNA 3E2DA 2YREA 1VYXA 2M13A 4S3OB 4ZQLA 2OXQC 4W4UA 5FB0A 2JMJA 1WEPA 5D1LB 4YBSA 2DSMA 2VNFA 2K17A 2KU3A 3I2DA 4LADB 1JOCA 5FERA 2M1RA 1HYJA 5B78A 4L58A 2LDRA 2YQMA 1FBVA 4UI9B 5K3QA 4S3OC 2CSVA 2L0BA 1WIMA 5LKTA 3PURA 3KV5A 2MD8C 2LAUA 4I7DA 4AVXA 3KNVA 3O47A 3T9KA 4XI1A 2XOCA 3ZPVE 2FSAA 2VP7A 2YW8A 3ZYQA 2K1JA 3PLWA 5TDWA 1WESA 2MNYA 4N3WA 2YHOA 3ZTGA 2YSMA 2M85A 3DPLR 1X4JA 2G43A 4AYCA 4AYCB 3LQJA 5DKAA 1X4UA 3O36A 2ECWA 2YUCA 2MA5A 2EA6A 3LQHA 4ZUXU 1WEVA 5LKXA 4O62A 2KE1A 2JMIA 2JMDA 5TRBA 2RR4A 2LXPC 5KH9A 4LKAA 3SOWA 4GB0A 4LK9A 3ZVYA 4Q6FA 2FFWA 1WEQA 2YYRA 3FEHA 3SOXA 2LXHC 4QF3A 1WEEA 4R8PK 3ZPV1 3LDYA 2XB1A 4P5OB 5JG6A 3EB6A 4BBQA 1Z60A 4YC9A 4FK5A 4R2YA 3ZNIA 5AITA 1WGMA 2C2VS 3N9PA 2EGMA 3N9LA 4LLBA 5SVIA 4FO9A 3FAOA 4PTBA 5H1VA 4QF2A 1WENA 3H7HA 3DWDA 4I7BA 5LKUA 2KWNA 4A4BA 2B0OE 5J3XA 2LQ6A 2EODA 3V43A 5SVXA 2CSZA 4O64A 1F62A 1ZBDB 4YAXA 2L43A 2CRWA 3FL2A 2HYED 3O33A 2KYUA 3SOUA 2K16A 5C13A 2D8UA 5B79A 2ECTA 2E6RA 4V3KC 5FB1A 5TABA 1Z2QA 2P57A 2XEUA 3SUBA 3LJUX 4WZ0A 2NAAA 1K2FA 3ZVZB 3IHPA 2XOYA 3KQIA 2CKLA 3JUEA 4Z0OA 3DDTA 2VJEA 2VJEB 3MHHA 1MM3A 2ECGA 2RSDA 2L7PA 2G45A 2L80A 4A49A 3GV4A 1FP0A 2JRJA 3T7LA 3O70A 3U5OA 4AP4A 3SHBA 3KV6A 3U5PA 2BAYA 2JM3A 2PUYA 3N9MA 2DJAA 2M3HA 5SVYA 2ECIA 1IYMA 4GNGA 4R7EA 2IQJA 2K4DA 4TKPB 5D1KB 5C11A 2MD7B 2LRIC 3O35A 2DX8A 4UP0A 3M62A 4GNDA 5B75A 5LKZA 1CHCA 4I7CA 4C9ZA 2XOZA 1XWHA 2CT2A 4A0CD 2CONA 2KFTA 2ECJA 3GL6A 2Y1NA 3C5KA 4LJNA 2FUUA 4UP5A 1DVPA 4F52B 4IC2A 3HCUA 3KDEC 3U5NA 4X3GA 1Z6UA 3LVRE 2KGGA 4CA1A 2YSJA 2MIQA 5SVIB 2F6NA 2MUMA 1MBMA 2YVRA 3FJUB 4B7YC 2EXUA 5EYAF 5H9MA 1LDKC 4WZ2A 2QIZA 5B76A 2M6MA 4MVTA 3U5MA 4YATA 4FJCA 2OWAA 2CSYA 3O34A 1WEUA 2PNXA 3N9OA 3LVQE 5LCWB 3MHSA 3RPGC 2KREA 4WA6A 2H0DA 2H0DB 4AUQB 5TDRA 4YADA 4F1PA 2IDAA 1MM2A 4A4CA 1RMDA 2FUIA 5B8DA 2QJ0A 4YABA 2E61A 3M7KA 4V3LC 1WEWA 2KWOA 2MT5A 2FD4A 3Q1DA 2CKLB 3FANA 5I3LA 2L75A 3LRQA 5G05B 5TBNA 2KGIA 5B77A 4NN2A 3O7AA 2YHNA 3QZVA 4OGCA 1DCQA 3L11A 3ASLA 1VD4A 2ECNA 4H9DA 4Z0RA 2KIZA 1E4UA 3DQVR 1WFKA 2LGKA 3FM8C 1WE9A 5G0FA 2KWKA 3PHDA 2VPDA 1X4IA 2D8SA 2LGGA 3HCSA 4PPEA 3T6RA 3M99A 2LN0A 4L7XA 3L1ZB 2MA6A 3NG2A 2KWJA 4ZDTA 2VPEA 3MDBC
chains in the Genus database with same CATH topology
4IC3A 3M63A 4YBMA 2HDPA 3LQIA 3PUQA 4B86C 2LGLA 2F42A 2UZGA 2AN6A 4GNFA 2VJFA 2VJFB 4BHWA 2YT5A 2I50A 1WILA 4YBTA 1N87A 1WEOA 1VFYA 1JM7A 1JM7B 2Y43A 2LV9A 5H1UA 1G25A 2ECVA 1LDJB 2L5UA 3HTKC 3O37A 3RPGB 2YQLA 2C2LA 3N9NA 4MSXA 5H1TA 4GNEA 1WEMA 2F6JA 4WZ3B 2ZETC 2LGVA 1T1HA 2YURA 5KH7A 2YU4A 2MNZA 3VK6A 2VPBA 2G6QA 5D1MB 4FIPA 5FEYA 2VPGA 3HCTA 2QICA 2E6SA 5DINA 3L1XA 4N4FA 1BORA 1HYIA 3C6WA 1U6GB 3EB5A 2RI7A 5G04B 4CCGX 2EGPA 3RTRB 2KR4A 3N9QA 2Y1MA 5AIUA 1V87A 5KH3A 2YREA 1VYXA 4S3OB 4ZQLA 2OXQC 4W4UA 5FB0A 2JMJA 1WEPA 5D1LB 4YBSA 2VNFA 2K17A 2KU3A 3I2DA 4LADB 1JOCA 5FERA 2M1RA 1HYJA 5B78A 4L58A 2LDRA 2YQMA 1FBVA 4UI9B 4S3OC 2L0BA 1WIMA 5LKTA 3PURA 3KV5A 2MD8C 4I7DA 4AVXA 3KNVA 4XI1A 3ZPVE 2FSAA 2VP7A 2YW8A 3ZYQA 2K1JA 5TDWA 1WESA 2MNYA 4N3WA 2YHOA 3ZTGA 2YSMA 2M85A 3DPLR 1X4JA 2G43A 4AYCA 4AYCB 5DKAA 3LQJA 1X4UA 3O36A 2ECWA 2YUCA 2MA5A 2EA6A 3LQHA 4ZUXU 1WEVA 5LKXA 2KE1A 2JMIA 2JMDA 5TRBA 2LXPC 5KH9A 4LKAA 3SOWA 4GB0A 4LK9A 3ZVYA 4Q6FA 1WEQA 2YYRA 3SOXA 2LXHC 4QF3A 1WEEA 4R8PK 3ZPV1 2XB1A 4P5OB 5JG6A 3EB6A 4BBQA 1Z60A 4YC9A 4FK5A 4R2YA 3ZNIA 5AITA 1WGMA 2C2VS 3N9PA 3N9LA 4LLBA 4FO9A 4PTBA 5H1VA 4QF2A 1WENA 4I7BA 5LKUA 2KWNA 4A4BA 5J3XA 2LQ6A 2EODA 3V43A 2CSZA 4O64A 1F62A 1ZBDB 4YAXA 2L43A 3FL2A 2HYED 3O33A 2KYUA 3SOUA 2K16A 5C13A 5B79A 2ECTA 2E6RA 4V3KC 5FB1A 5TABA 1Z2QA 2XEUA 4WZ0A 2NAAA 1K2FA 3ZVZB 3IHPA 3KQIA 2CKLA 2VJEA 2VJEB 3MHHA 1MM3A 2ECGA 2RSDA 2G45A 2L80A 4A49A 3GV4A 1FP0A 2JRJA 3T7LA 3O70A 3U5OA 4AP4A 3SHBA 3KV6A 3U5PA 2BAYA 2PUYA 3N9MA 2M3HA 2ECIA 1IYMA 4GNGA 4R7EA 2K4DA 4TKPB 5D1KB 5C11A 2MD7B 2LRIC 3O35A 2DX8A 4UP0A 3M62A 4GNDA 5B75A 5LKZA 1CHCA 4I7CA 4C9ZA 1XWHA 2CT2A 4A0CD 2KFTA 2ECJA 3GL6A 2Y1NA 3C5KA 4LJNA 2FUUA 4UP5A 1DVPA 4F52B 4IC2A 3HCUA 3U5NA 4X3GA 1Z6UA 2KGGA 4CA1A 2YSJA 2MIQA 2F6NA 2MUMA 4B7YC 5EYAF 5H9MA 1LDKC 4WZ2A 2QIZA 5B76A 2M6MA 4MVTA 3U5MA 4YATA 4FJCA 2CSYA 3O34A 1WEUA 2PNXA 3N9OA 5LCWB 3MHSA 3RPGC 2KREA 4WA6A 2H0DA 2H0DB 4AUQB 5TDRA 4YADA 2IDAA 1MM2A 4A4CA 1RMDA 2FUIA 5B8DA 2QJ0A 4YABA 4V3LC 1WEWA 2KWOA 2MT5A 2CKLB 5I3LA 2L75A 3LRQA 5G05B 5TBNA 2KGIA 5B77A 4NN2A 3O7AA 2YHNA 3QZVA 3L11A 3ASLA 1VD4A 2ECNA 2KIZA 1E4UA 3DQVR 1WFKA 2LGKA 1WE9A 5G0FA 2KWKA 3PHDA 2VPDA 1X4IA 2D8SA 2LGGA 3HCSA 4PPEA 3T6RA 3M99A 2LN0A 4L7XA 3L1ZB 2MA6A 3NG2A 2KWJA 4ZDTA 2VPEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IC3 A;  3M63 A;  4YBM A;  2HDP A;  3LQI A;  3PUQ A;  4B86 C;  2LGL A;  2F42 A;  2UZG A;  2AN6 A;  4GNF A;  2VJF A;  2VJF B;  4BHW A;  2YT5 A;  2I50 A;  1WIL A;  4YBT A;  1N87 A;  1WEO A;  1VFY A;  1JM7 A;  1JM7 B;  2Y43 A;  2LV9 A;  5H1U A;  1G25 A;  2ECV A;  1LDJ B;  2L5U A;  3HTK C;  3O37 A;  3RPG B;  2YQL A;  2C2L A;  3N9N A;  4MSX A;  5H1T A;  4GNE A;  1WEM A;  2F6J A;  4WZ3 B;  2ZET C;  2LGV A;  1T1H A;  2YUR A;  5KH7 A;  2YU4 A;  2MNZ A;  3VK6 A;  2VPB A;  2G6Q A;  5D1M B;  4FIP A;  5FEY A;  2VPG A;  3HCT A;  2QIC A;  2E6S A;  5DIN A;  3L1X A;  4N4F A;  1BOR A;  1HYI A;  3C6W A;  1U6G B;  3EB5 A;  2RI7 A;  5G04 B;  4CCG X;  2EGP A;  3RTR B;  2KR4 A;  3N9Q A;  2Y1M A;  5AIU A;  1V87 A;  5KH3 A;  2YRE A;  1VYX A;  4S3O B;  4ZQL A;  2OXQ C;  4W4U A;  5FB0 A;  2JMJ A;  1WEP A;  5D1L B;  4YBS A;  2VNF A;  2K17 A;  2KU3 A;  3I2D A;  4LAD B;  1JOC A;  5FER A;  2M1R A;  1HYJ A;  5B78 A;  4L58 A;  2LDR A;  2YQM A;  1FBV A;  4UI9 B;  4S3O C;  2L0B A;  1WIM A;  5LKT A;  3PUR A;  3KV5 A;  2MD8 C;  4I7D A;  4AVX A;  3KNV A;  4XI1 A;  3ZPV E;  2FSA A;  2VP7 A;  2YW8 A;  3ZYQ A;  2K1J A;  5TDW A;  1WES A;  2MNY A;  4N3W A;  2YHO A;  3ZTG A;  2YSM A;  2M85 A;  3DPL R;  1X4J A;  2G43 A;  4AYC A;  4AYC B;  5DKA A;  3LQJ A;  1X4U A;  3O36 A;  2ECW A;  2YUC A;  2MA5 A;  2EA6 A;  3LQH A;  4ZUX U;  1WEV A;  5LKX A;  2KE1 A;  2JMI A;  2JMD A;  5TRB A;  2LXP C;  5KH9 A;  4LKA A;  3SOW A;  4GB0 A;  4LK9 A;  3ZVY A;  4Q6F A;  1WEQ A;  2YYR A;  3SOX A;  2LXH C;  4QF3 A;  1WEE A;  4R8P K;  3ZPV 1;  2XB1 A;  4P5O B;  5JG6 A;  3EB6 A;  4BBQ A;  1Z60 A;  4YC9 A;  4FK5 A;  4R2Y A;  3ZNI A;  5AIT A;  1WGM A;  2C2V S;  3N9P A;  3N9L A;  4LLB A;  4FO9 A;  4PTB A;  5H1V A;  4QF2 A;  1WEN A;  4I7B A;  5LKU A;  2KWN A;  4A4B A;  5J3X A;  2LQ6 A;  2EOD A;  3V43 A;  2CSZ A;  4O64 A;  1F62 A;  1ZBD B;  4YAX A;  2L43 A;  3FL2 A;  2HYE D;  3O33 A;  2KYU A;  3SOU A;  2K16 A;  5C13 A;  5B79 A;  2ECT A;  2E6R A;  4V3K C;  5FB1 A;  5TAB A;  1Z2Q A;  2XEU A;  4WZ0 A;  2NAA A;  1K2F A;  3ZVZ B;  3IHP A;  3KQI A;  2CKL A;  2VJE A;  2VJE B;  3MHH A;  1MM3 A;  2ECG A;  2RSD A;  2G45 A;  2L80 A;  4A49 A;  3GV4 A;  1FP0 A;  2JRJ A;  3T7L A;  3O70 A;  3U5O A;  4AP4 A;  3SHB A;  3KV6 A;  3U5P A;  2BAY A;  2PUY A;  3N9M A;  2M3H A;  2ECI A;  1IYM A;  4GNG A;  4R7E A;  2K4D A;  4TKP B;  5D1K B;  5C11 A;  2MD7 B;  2LRI C;  3O35 A;  2DX8 A;  4UP0 A;  3M62 A;  4GND A;  5B75 A;  5LKZ A;  1CHC A;  4I7C A;  4C9Z A;  1XWH A;  2CT2 A;  4A0C D;  2KFT A;  2ECJ A;  3GL6 A;  2Y1N A;  3C5K A;  4LJN A;  2FUU A;  4UP5 A;  1DVP A;  4F52 B;  4IC2 A;  3HCU A;  3U5N A;  4X3G A;  1Z6U A;  2KGG A;  4CA1 A;  2YSJ A;  2MIQ A;  2F6N A;  2MUM A;  4B7Y C;  5EYA F;  5H9M A;  1LDK C;  4WZ2 A;  2QIZ A;  5B76 A;  2M6M A;  4MVT A;  3U5M A;  4YAT A;  4FJC A;  2CSY A;  3O34 A;  1WEU A;  2PNX A;  3N9O A;  5LCW B;  3MHS A;  3RPG C;  2KRE A;  4WA6 A;  2H0D A;  2H0D B;  4AUQ B;  5TDR A;  4YAD A;  2IDA A;  1MM2 A;  4A4C A;  1RMD A;  2FUI A;  5B8D A;  2QJ0 A;  4YAB A;  4V3L C;  1WEW A;  2KWO A;  2MT5 A;  2CKL B;  5I3L A;  2L75 A;  3LRQ A;  5G05 B;  5TBN A;  2KGI A;  5B77 A;  4NN2 A;  3O7A A;  2YHN A;  3QZV A;  3L11 A;  3ASL A;  1VD4 A;  2ECN A;  2KIZ A;  1E4U A;  3DQV R;  1WFK A;  2LGK A;  1WE9 A;  5G0F A;  2KWK A;  3PHD A;  2VPD A;  1X4I A;  2D8S A;  2LGG A;  3HCS A;  4PPE A;  3T6R A;  3M99 A;  2LN0 A;  4L7X A;  3L1Z B;  2MA6 A;  3NG2 A;  2KWJ A;  4ZDT A;  2VPE A; 
#chains in the Genus database with same CATH topology
 4IC3 A;  3M63 A;  4YBM A;  2HDP A;  3LQI A;  3PUQ A;  4B86 C;  2LGL A;  2F42 A;  2UZG A;  2AN6 A;  4GNF A;  2VJF A;  2VJF B;  2CRR A;  4BHW A;  2YT5 A;  2I50 A;  1WIL A;  4YBT A;  1N87 A;  1WEO A;  1VFY A;  1JM7 A;  1JM7 B;  4QQ4 A;  2Y43 A;  2LV9 A;  5H1U A;  2MKE A;  1G25 A;  2ECV A;  1LDJ B;  2L5U A;  3HTK C;  3O37 A;  3RPG B;  2YQL A;  2C2L A;  3N9N A;  4MSX A;  5H1T A;  4GNE A;  1WEM A;  2F6J A;  4WZ3 B;  2ZET C;  2LGV A;  1T1H A;  2KKY A;  2YUR A;  5KH7 A;  2YU4 A;  2MNZ A;  3VK6 A;  2VPB A;  4OGE A;  2G6Q A;  5D1M B;  4FIP A;  5FEY A;  2VPG A;  3HCT A;  2QIC A;  2E6S A;  5DIN A;  3L1X A;  4N4F A;  1BOR A;  1HYI A;  2XP0 A;  3C6W A;  1U6G B;  3EB5 A;  2RI7 A;  5G04 B;  4CCG X;  2EGP A;  3RTR B;  2KR4 A;  3N9Q A;  2KKX A;  2Y1M A;  5AIU A;  1V87 A;  5KH3 A;  2JUN A;  3E2D A;  2YRE A;  1VYX A;  2M13 A;  4S3O B;  4ZQL A;  2OXQ C;  4W4U A;  5FB0 A;  2JMJ A;  1WEP A;  5D1L B;  4YBS A;  2DSM A;  2VNF A;  2K17 A;  2KU3 A;  3I2D A;  4LAD B;  1JOC A;  5FER A;  2M1R A;  1HYJ A;  5B78 A;  4L58 A;  2LDR A;  2YQM A;  1FBV A;  4UI9 B;  5K3Q A;  4S3O C;  2CSV A;  2L0B A;  1WIM A;  5LKT A;  3PUR A;  3KV5 A;  2MD8 C;  2LAU A;  4I7D A;  4AVX A;  3KNV A;  3O47 A;  3T9K A;  4XI1 A;  2XOC A;  3ZPV E;  2FSA A;  2VP7 A;  2YW8 A;  3ZYQ A;  2K1J A;  3PLW A;  5TDW A;  1WES A;  2MNY A;  4N3W A;  2YHO A;  3ZTG A;  2YSM A;  2M85 A;  3DPL R;  1X4J A;  2G43 A;  4AYC A;  4AYC B;  3LQJ A;  5DKA A;  1X4U A;  3O36 A;  2ECW A;  2YUC A;  2MA5 A;  2EA6 A;  3LQH A;  4ZUX U;  1WEV A;  5LKX A;  4O62 A;  2KE1 A;  2JMI A;  2JMD A;  5TRB A;  2RR4 A;  2LXP C;  5KH9 A;  4LKA A;  3SOW A;  4GB0 A;  4LK9 A;  3ZVY A;  4Q6F A;  2FFW A;  1WEQ A;  2YYR A;  3FEH A;  3SOX A;  2LXH C;  4QF3 A;  1WEE A;  4R8P K;  3ZPV 1;  3LDY A;  2XB1 A;  4P5O B;  5JG6 A;  3EB6 A;  4BBQ A;  1Z60 A;  4YC9 A;  4FK5 A;  4R2Y A;  3ZNI A;  5AIT A;  1WGM A;  2C2V S;  3N9P A;  2EGM A;  3N9L A;  4LLB A;  5SVI A;  4FO9 A;  3FAO A;  4PTB A;  5H1V A;  4QF2 A;  1WEN A;  3H7H A;  3DWD A;  4I7B A;  5LKU A;  2KWN A;  4A4B A;  2B0O E;  5J3X A;  2LQ6 A;  2EOD A;  3V43 A;  5SVX A;  2CSZ A;  4O64 A;  1F62 A;  1ZBD B;  4YAX A;  2L43 A;  2CRW A;  3FL2 A;  2HYE D;  3O33 A;  2KYU A;  3SOU A;  2K16 A;  5C13 A;  2D8U A;  5B79 A;  2ECT A;  2E6R A;  4V3K C;  5FB1 A;  5TAB A;  1Z2Q A;  2P57 A;  2XEU A;  3SUB A;  3LJU X;  4WZ0 A;  2NAA A;  1K2F A;  3ZVZ B;  3IHP A;  2XOY A;  3KQI A;  2CKL A;  3JUE A;  4Z0O A;  3DDT A;  2VJE A;  2VJE B;  3MHH A;  1MM3 A;  2ECG A;  2RSD A;  2L7P A;  2G45 A;  2L80 A;  4A49 A;  3GV4 A;  1FP0 A;  2JRJ A;  3T7L A;  3O70 A;  3U5O A;  4AP4 A;  3SHB A;  3KV6 A;  3U5P A;  2BAY A;  2JM3 A;  2PUY A;  3N9M A;  2DJA A;  2M3H A;  5SVY A;  2ECI A;  1IYM A;  4GNG A;  4R7E A;  2IQJ A;  2K4D A;  4TKP B;  5D1K B;  5C11 A;  2MD7 B;  2LRI C;  3O35 A;  2DX8 A;  4UP0 A;  3M62 A;  4GND A;  5B75 A;  5LKZ A;  1CHC A;  4I7C A;  4C9Z A;  2XOZ A;  1XWH A;  2CT2 A;  4A0C D;  2CON A;  2KFT A;  2ECJ A;  3GL6 A;  2Y1N A;  3C5K A;  4LJN A;  2FUU A;  4UP5 A;  1DVP A;  4F52 B;  4IC2 A;  3HCU A;  3KDE C;  3U5N A;  4X3G A;  1Z6U A;  3LVR E;  2KGG A;  4CA1 A;  2YSJ A;  2MIQ A;  5SVI B;  2F6N A;  2MUM A;  1MBM A;  2YVR A;  3FJU B;  4B7Y C;  2EXU A;  5EYA F;  5H9M A;  1LDK C;  4WZ2 A;  2QIZ A;  5B76 A;  2M6M A;  4MVT A;  3U5M A;  4YAT A;  4FJC A;  2OWA A;  2CSY A;  3O34 A;  1WEU A;  2PNX A;  3N9O A;  3LVQ E;  5LCW B;  3MHS A;  3RPG C;  2KRE A;  4WA6 A;  2H0D A;  2H0D B;  4AUQ B;  5TDR A;  4YAD A;  4F1P A;  2IDA A;  1MM2 A;  4A4C A;  1RMD A;  2FUI A;  5B8D A;  2QJ0 A;  4YAB A;  2E61 A;  3M7K A;  4V3L C;  1WEW A;  2KWO A;  2MT5 A;  2FD4 A;  3Q1D A;  2CKL B;  3FAN A;  5I3L A;  2L75 A;  3LRQ A;  5G05 B;  5TBN A;  2KGI A;  5B77 A;  4NN2 A;  3O7A A;  2YHN A;  3QZV A;  4OGC A;  1DCQ A;  3L11 A;  3ASL A;  1VD4 A;  2ECN A;  4H9D A;  4Z0R A;  2KIZ A;  1E4U A;  3DQV R;  1WFK A;  2LGK A;  3FM8 C;  1WE9 A;  5G0F A;  2KWK A;  3PHD A;  2VPD A;  1X4I A;  2D8S A;  2LGG A;  3HCS A;  4PPE A;  3T6R A;  3M99 A;  2LN0 A;  4L7X A;  3L1Z B;  2MA6 A;  3NG2 A;  2KWJ A;  4ZDT A;  2VPE A;  3MDB C; 
#chains in the Genus database with same CATH homology
 4IC3 A;  3M63 A;  4YBM A;  2HDP A;  3LQI A;  3PUQ A;  4B86 C;  2LGL A;  2F42 A;  2UZG A;  2AN6 A;  4GNF A;  2VJF A;  2VJF B;  4BHW A;  2YT5 A;  2I50 A;  1WIL A;  4YBT A;  1N87 A;  1WEO A;  1VFY A;  1JM7 A;  1JM7 B;  2Y43 A;  2LV9 A;  5H1U A;  1G25 A;  2ECV A;  1LDJ B;  2L5U A;  3HTK C;  3O37 A;  3RPG B;  2YQL A;  2C2L A;  3N9N A;  4MSX A;  5H1T A;  4GNE A;  1WEM A;  2F6J A;  4WZ3 B;  2ZET C;  2LGV A;  1T1H A;  2YUR A;  5KH7 A;  2YU4 A;  2MNZ A;  3VK6 A;  2VPB A;  2G6Q A;  5D1M B;  4FIP A;  5FEY A;  2VPG A;  3HCT A;  2QIC A;  2E6S A;  5DIN A;  3L1X A;  4N4F A;  1BOR A;  1HYI A;  3C6W A;  1U6G B;  3EB5 A;  2RI7 A;  5G04 B;  4CCG X;  2EGP A;  3RTR B;  2KR4 A;  3N9Q A;  2Y1M A;  5AIU A;  1V87 A;  5KH3 A;  2YRE A;  1VYX A;  4S3O B;  4ZQL A;  2OXQ C;  4W4U A;  5FB0 A;  2JMJ A;  1WEP A;  5D1L B;  4YBS A;  2VNF A;  2K17 A;  2KU3 A;  3I2D A;  4LAD B;  1JOC A;  5FER A;  2M1R A;  1HYJ A;  5B78 A;  4L58 A;  2LDR A;  2YQM A;  1FBV A;  4UI9 B;  4S3O C;  2L0B A;  1WIM A;  5LKT A;  3PUR A;  3KV5 A;  2MD8 C;  4I7D A;  4AVX A;  3KNV A;  4XI1 A;  3ZPV E;  2FSA A;  2VP7 A;  2YW8 A;  3ZYQ A;  2K1J A;  5TDW A;  1WES A;  2MNY A;  4N3W A;  2YHO A;  3ZTG A;  2YSM A;  2M85 A;  3DPL R;  1X4J A;  2G43 A;  4AYC A;  4AYC B;  5DKA A;  3LQJ A;  1X4U A;  3O36 A;  2ECW A;  2YUC A;  2MA5 A;  2EA6 A;  3LQH A;  4ZUX U;  1WEV A;  5LKX A;  2KE1 A;  2JMI A;  2JMD A;  5TRB A;  2LXP C;  5KH9 A;  4LKA A;  3SOW A;  4GB0 A;  4LK9 A;  3ZVY A;  4Q6F A;  1WEQ A;  2YYR A;  3SOX A;  2LXH C;  4QF3 A;  1WEE A;  4R8P K;  3ZPV 1;  2XB1 A;  4P5O B;  5JG6 A;  3EB6 A;  4BBQ A;  1Z60 A;  4YC9 A;  4FK5 A;  4R2Y A;  3ZNI A;  5AIT A;  1WGM A;  2C2V S;  3N9P A;  3N9L A;  4LLB A;  4FO9 A;  4PTB A;  5H1V A;  4QF2 A;  1WEN A;  4I7B A;  5LKU A;  2KWN A;  4A4B A;  5J3X A;  2LQ6 A;  2EOD A;  3V43 A;  2CSZ A;  4O64 A;  1F62 A;  1ZBD B;  4YAX A;  2L43 A;  3FL2 A;  2HYE D;  3O33 A;  2KYU A;  3SOU A;  2K16 A;  5C13 A;  5B79 A;  2ECT A;  2E6R A;  4V3K C;  5FB1 A;  5TAB A;  1Z2Q A;  2XEU A;  4WZ0 A;  2NAA A;  1K2F A;  3ZVZ B;  3IHP A;  3KQI A;  2CKL A;  2VJE A;  2VJE B;  3MHH A;  1MM3 A;  2ECG A;  2RSD A;  2G45 A;  2L80 A;  4A49 A;  3GV4 A;  1FP0 A;  2JRJ A;  3T7L A;  3O70 A;  3U5O A;  4AP4 A;  3SHB A;  3KV6 A;  3U5P A;  2BAY A;  2PUY A;  3N9M A;  2M3H A;  2ECI A;  1IYM A;  4GNG A;  4R7E A;  2K4D A;  4TKP B;  5D1K B;  5C11 A;  2MD7 B;  2LRI C;  3O35 A;  2DX8 A;  4UP0 A;  3M62 A;  4GND A;  5B75 A;  5LKZ A;  1CHC A;  4I7C A;  4C9Z A;  1XWH A;  2CT2 A;  4A0C D;  2KFT A;  2ECJ A;  3GL6 A;  2Y1N A;  3C5K A;  4LJN A;  2FUU A;  4UP5 A;  1DVP A;  4F52 B;  4IC2 A;  3HCU A;  3U5N A;  4X3G A;  1Z6U A;  2KGG A;  4CA1 A;  2YSJ A;  2MIQ A;  2F6N A;  2MUM A;  4B7Y C;  5EYA F;  5H9M A;  1LDK C;  4WZ2 A;  2QIZ A;  5B76 A;  2M6M A;  4MVT A;  3U5M A;  4YAT A;  4FJC A;  2CSY A;  3O34 A;  1WEU A;  2PNX A;  3N9O A;  5LCW B;  3MHS A;  3RPG C;  2KRE A;  4WA6 A;  2H0D A;  2H0D B;  4AUQ B;  5TDR A;  4YAD A;  2IDA A;  1MM2 A;  4A4C A;  1RMD A;  2FUI A;  5B8D A;  2QJ0 A;  4YAB A;  4V3L C;  1WEW A;  2KWO A;  2MT5 A;  2CKL B;  5I3L A;  2L75 A;  3LRQ A;  5G05 B;  5TBN A;  2KGI A;  5B77 A;  4NN2 A;  3O7A A;  2YHN A;  3QZV A;  3L11 A;  3ASL A;  1VD4 A;  2ECN A;  2KIZ A;  1E4U A;  3DQV R;  1WFK A;  2LGK A;  1WE9 A;  5G0F A;  2KWK A;  3PHD A;  2VPD A;  1X4I A;  2D8S A;  2LGG A;  3HCS A;  4PPE A;  3T6R A;  3M99 A;  2LN0 A;  4L7X A;  3L1Z B;  2MA6 A;  3NG2 A;  2KWJ A;  4ZDT A;  2VPE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...