2KWOA

Solution structure of the double phd (plant homeodomain) fingers of human transcriptional protein dpf3b bound to a histone h4 peptide containing n-terminal acetylation at serine 1
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
114
structure length
114
Chain Sequence
GSYCDFCLGGSNMNKKSGRPEELVSCADCGRSGHPTCLQFTLNMTEAVKTYKWQCIECKSCILCGTSENDDQLLFCDDCDRGYHMYCLNPPVAEPPEGSWSCHLCWELLKEKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone peptide
publication title Mechanism and regulation of acetylated histone binding by the tandem PHD finger of DPF3b.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 15
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2010-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2kwoA00
4WZ3B 5LKXA 2VJEB 2NAAA 1U6GB 4BBQA 2EODA 2PUYA 3M63A 3MHSA 2LDRA 3ZNIA 5KH3A 1BORA 2QJ0A 3KV6A 4R7EA 4YBSA 3MHHA 2VJFA 3L1ZB 2RSDA 3C5KA 3NG2A 1MM3A 5LKTA 4N3WA 1K2FA 1WE9A 2KGIA 3ASLA 2QICA 5G04B 2L75A 3M99A 2I50A 4IC3A 4NN2A 2VPGA 3KNVA 1JM7B 1LDJB 2ECTA 2FUUA 4X3GA 5EYAF 3GL6A 4UP0A 5H1UA 2ZETC 2LN0A 2KR4A 3DQVR 3ZPVE 1X4UA 2L0BA 5FEYA 3LRQA 5H9MA 3O35A 4YABA 4V3LC 2LGGA 4GNGA 4N4FA 2JMIA 4A4BA 2MIQA 3ZYQA 2OXQC 4I7DA 4LKAA 1Z6UA 3O36A 2LGKA 2M6MA 2M1RA 5H1TA 4TKPB 2ECGA 2K1JA 2KWNA 1WEOA 2M3HA 3N9PA 1WFKA 3O34A 1T1HA 5LKUA 2KYUA 4AVXA 3LQJA 2FSAA 3U5MA 1HYJA 2YHNA 1FBVA 2FUIA 2KE1A 1VFYA 2MD8C 3RTRB 5B79A 2EGPA 2LGVA 2H0DB 2K16A 4AYCB 2XEUA 2KWKA 2RI7A 3PURA 4S3OC 5C11A 2ECNA 2LV9A 2MNZA 5G0FA 1E4UA 2EA6A 2MA6A 1WILA 4I7BA 4GB0A 4O64A 1XWHA 3IHPA 3SHBA 5TRBA 5JG6A 1WIMA 2AN6A 4S3OB 3KQIA 1HYIA 1LDKC 1Z60A 2CT2A 3HTKC 4L58A 5D1KB 1WESA 3QZVA 5B76A 2L80A 4LLBA 5C13A 1CHCA 4A49A 4QF2A 3PHDA 4YAXA 2F6JA 4GNEA 2MT5A 5D1LB 3SOWA 3M62A 3EB5A 2YT5A 4YBMA 2YUCA 3RPGC 3KV5A 1DVPA 3VK6A 1WEUA 2G6QA 1X4IA 2Y1NA 4W4UA 4ZQLA 5TDRA 2BAYA 2JMJA 2YQMA 3PUQA 1Z2QA 3RPGB 5D1MB 2YYRA 2PNXA 1G25A 2Y1MA 4MVTA 2G43A 2MNYA 2ECWA 1WENA 2E6SA 5H1VA 3ZTGA 1V87A 2K17A 4PTBA 4WA6A 4YATA 2MA5A 3N9NA 2KU3A 2K4DA 5TABA 3T7LA 2KIZA 4LADB 2JRJA 4R2YA 3C6WA 2VJFB 3LQIA 3O37A 4CCGX 4UP5A 2F6NA 4AYCA 3N9QA 4Q6FA 2L43A 4QF3A 1WEPA 3ZVZB 4UI9B 2YURA 3O7AA 1ZBDB 2YSJA 2C2LA 5LCWB 1MM2A 3N9MA 2CKLA 4WZ2A 5B75A 1X4JA 2VJEA 3ZPV1 5B77A 1WEVA 4I7CA 4LJNA 1JOCA 2KWOA 3U5PA 4AP4A 2YW8A 3EB6A 4FIPA 3LQHA 5DKAA 3U5NA 2LRIC 5J3XA 2D8SA 2VNFA 5KH9A 4V3KC 2M85A 1RMDA 4F52B 2DX8A 4BHWA 1JM7A 4YADA 2QIZA 3N9OA 4FK5A 4C9ZA 2JMDA 1WEEA 1WEQA 2MUMA 4AUQB 2VP7A 1WEWA 4WZ0A 4FO9A 3T6RA 2VPDA 2E6RA 4ZDTA 5FB1A 2LGLA 5FERA 2G45A 2YU4A 1F62A 3FL2A 5B8DA 5I3LA 1WEMA 5AITA 2ECJA 1FP0A 2MD7B 2XB1A 4LK9A 5B78A 2ECVA 5DINA 2KGGA 3L1XA 5KH7A 5AIUA 2KREA 1WGMA 2F42A 4GNFA 4R8PK 3GV4A 2YREA 3DPLR 3HCUA 4L7XA 4YBTA 4GNDA 2YQLA 4PPEA 3V43A 2HYED 2H0DA 3ZVYA 2KWJA 4P5OB 1VD4A 3HCTA 3N9LA 5LKZA 2LXHC 5TDWA 2UZGA 2CSYA 2VPEA 2VPBA 4B86C 3SOUA 2KFTA 2ECIA 4IC2A 5G05B 2C2VS 4ZUXU 5TBNA 1VYXA 4A0CD 2HDPA 4YC9A 4XI1A 4FJCA 4MSXA 2L5UA 3O70A 5FB0A 3HCSA 2YHOA 2YSMA 2Y43A 2LQ6A 2IDAA 1N87A 4A4CA 4B7YC 2LXPC 3I2DA 1IYMA 3L11A 3SOXA 3O33A 2CSZA 3U5OA 4CA1A 2CKLB
chains in the Genus database with same CATH superfamily
4WZ3B 5LKXA 2VJEB 3LVQE 2NAAA 1U6GB 4BBQA 2EODA 2PUYA 3M63A 3MHSA 2LDRA 4Z0OA 3ZNIA 5KH3A 1BORA 2QJ0A 3KV6A 4R7EA 4YBSA 3MHHA 2VJFA 3L1ZB 2RSDA 3C5KA 3NG2A 1MM3A 5LKTA 4N3WA 1K2FA 1WE9A 2KGIA 3ASLA 2QICA 5G04B 2L75A 3M99A 2I50A 4IC3A 4NN2A 2VPGA 3KNVA 1JM7B 2FD4A 1LDJB 2ECTA 2FUUA 4X3GA 5EYAF 3GL6A 4UP0A 5H1UA 2ZETC 5SVXA 1MBMA 2LN0A 2CRRA 2KR4A 3DQVR 3ZPVE 1X4UA 2L0BA 5FEYA 3LRQA 5H9MA 3O35A 4YABA 4V3LC 2LGGA 4GNGA 4N4FA 3PLWA 2JMIA 4A4BA 4QQ4A 2MIQA 3ZYQA 2OXQC 4I7DA 4LKAA 1Z6UA 3O36A 2LGKA 2M6MA 2M1RA 5H1TA 3SUBA 4TKPB 2ECGA 2K1JA 2CSVA 2KWNA 1WEOA 2M3HA 3N9PA 1WFKA 3O34A 1T1HA 5LKUA 2XOCA 2KYUA 4AVXA 3LQJA 2FSAA 3U5MA 3H7HA 2YHNA 1HYJA 1FBVA 2FUIA 2KE1A 1VFYA 2MD8C 1DCQA 3RTRB 5B79A 2EGPA 2LGVA 2H0DB 2K16A 4AYCB 2XEUA 2MKEA 5SVYA 2KWKA 2RI7A 3PURA 4S3OC 5C11A 2ECNA 2LV9A 2MNZA 5G0FA 1E4UA 2EA6A 2MA6A 1WILA 4I7BA 3FEHA 4GB0A 4O64A 1XWHA 3IHPA 3SHBA 3MDBC 5TRBA 5JG6A 1WIMA 2AN6A 4S3OB 3FM8C 3KQIA 1HYIA 1LDKC 1Z60A 2CT2A 3HTKC 4L58A 5D1KB 1WESA 3E2DA 3FJUB 3QZVA 5B76A 2L80A 4LLBA 5C13A 1CHCA 2CRWA 2XOYA 4A49A 4QF2A 3PHDA 4YAXA 2F6JA 4GNEA 2LAUA 2MT5A 5D1LB 3SOWA 3M7KA 3M62A 3EB5A 2YT5A 4YBMA 2YUCA 3RPGC 3KV5A 1DVPA 3VK6A 2EGMA 1WEUA 2G6QA 1X4IA 2Y1NA 4W4UA 4ZQLA 5TDRA 2BAYA 2JMJA 2YQMA 3PUQA 1Z2QA 3RPGB 3LDYA 5D1MB 2EXUA 2YYRA 2DJAA 2PNXA 1G25A 2Y1MA 4MVTA 2RR4A 2G43A 2MNYA 5SVIA 2ECWA 1WENA 2E6SA 5H1VA 4Z0RA 3ZTGA 1V87A 3KDEC 2K17A 4PTBA 4WA6A 4YATA 2MA5A 3N9NA 2KU3A 2K4DA 5TABA 3T7LA 2KIZA 4LADB 2JRJA 4R2YA 2JUNA 3C6WA 2VJFB 3LJUX 3LQIA 3O37A 4CCGX 2XOZA 4UP5A 2F6NA 3DWDA 4AYCA 3N9QA 4Q6FA 3LVRE 2L43A 4QF3A 1WEPA 4OGCA 3ZVZB 4UI9B 2YURA 3O7AA 1ZBDB 2YSJA 2C2LA 5LCWB 1MM2A 3N9MA 2CKLA 4WZ2A 5B75A 1X4JA 2VJEA 2KKYA 3ZPV1 5B77A 1WEVA 2DSMA 4I7CA 4LJNA 1JOCA 2KWOA 3U5PA 3DDTA 4AP4A 2YW8A 3EB6A 4FIPA 3LQHA 5DKAA 3U5NA 2LRIC 5J3XA 2XP0A 2D8SA 2VNFA 2FFWA 5KH9A 4V3KC 2M85A 1RMDA 4F52B 2DX8A 4BHWA 1JM7A 5K3QA 4YADA 2QIZA 3N9OA 4FK5A 4C9ZA 2JMDA 1WEEA 1WEQA 2MUMA 4AUQB 2VP7A 1WEWA 2M13A 4WZ0A 4FO9A 3T6RA 2VPDA 2E6RA 4ZDTA 5FB1A 2LGLA 5FERA 2G45A 2YU4A 2YVRA 4OGEA 1F62A 3FL2A 5B8DA 5I3LA 1WEMA 3JUEA 5AITA 2ECJA 2OWAA 4F1PA 1FP0A 2MD7B 2XB1A 4LK9A 5B78A 2ECVA 5DINA 2KGGA 3L1XA 5KH7A 5AIUA 2KREA 1WGMA 2F42A 4GNFA 4R8PK 3GV4A 2YREA 4O62A 3DPLR 3HCUA 2D8UA 4L7XA 4YBTA 4GNDA 3Q1DA 2YQLA 2CONA 4PPEA 3V43A 2HYED 2H0DA 3ZVYA 2KWJA 4P5OB 1VD4A 3HCTA 3N9LA 5LKZA 2LXHC 3O47A 5TDWA 3FAOA 2UZGA 2CSYA 2VPEA 2VPBA 5SVIB 4B86C 3SOUA 2KFTA 2ECIA 4IC2A 3FANA 5G05B 2C2VS 4ZUXU 5TBNA 1VYXA 4A0CD 2HDPA 4YC9A 4XI1A 4FJCA 4MSXA 2L7PA 2L5UA 2KKXA 3O70A 2IQJA 5FB0A 3HCSA 2YHOA 3T9KA 2YSMA 2Y43A 2LQ6A 2E61A 1N87A 2IDAA 4A4CA 4B7YC 2LXPC 2JM3A 3I2DA 2B0OE 1IYMA 3L11A 4H9DA 3SOXA 3O33A 2CSZA 3U5OA 2P57A 4CA1A 2CKLB
chains in the Genus database with same CATH topology
4WZ3B 5LKXA 2VJEB 2NAAA 1U6GB 4BBQA 2EODA 2PUYA 3M63A 3MHSA 2LDRA 3ZNIA 5KH3A 1BORA 2QJ0A 3KV6A 4R7EA 4YBSA 3MHHA 2VJFA 3L1ZB 2RSDA 3C5KA 3NG2A 1MM3A 5LKTA 4N3WA 1K2FA 1WE9A 2KGIA 3ASLA 2QICA 5G04B 2L75A 3M99A 2I50A 4IC3A 4NN2A 2VPGA 3KNVA 1JM7B 1LDJB 2ECTA 2FUUA 4X3GA 5EYAF 3GL6A 4UP0A 5H1UA 2ZETC 2LN0A 2KR4A 3DQVR 3ZPVE 1X4UA 2L0BA 5FEYA 3LRQA 5H9MA 3O35A 4YABA 4V3LC 2LGGA 4GNGA 4N4FA 2JMIA 4A4BA 2MIQA 3ZYQA 2OXQC 4I7DA 4LKAA 1Z6UA 3O36A 2LGKA 2M6MA 2M1RA 5H1TA 4TKPB 2ECGA 2K1JA 2KWNA 1WEOA 2M3HA 3N9PA 1WFKA 3O34A 1T1HA 5LKUA 2KYUA 4AVXA 3LQJA 2FSAA 3U5MA 1HYJA 2YHNA 1FBVA 2FUIA 2KE1A 1VFYA 2MD8C 3RTRB 5B79A 2EGPA 2LGVA 2H0DB 2K16A 4AYCB 2XEUA 2KWKA 2RI7A 3PURA 4S3OC 5C11A 2ECNA 2LV9A 2MNZA 5G0FA 1E4UA 2EA6A 2MA6A 1WILA 4I7BA 4GB0A 4O64A 1XWHA 3IHPA 3SHBA 5TRBA 5JG6A 1WIMA 2AN6A 4S3OB 3KQIA 1HYIA 1LDKC 1Z60A 2CT2A 3HTKC 4L58A 5D1KB 1WESA 3QZVA 5B76A 2L80A 4LLBA 5C13A 1CHCA 4A49A 4QF2A 3PHDA 4YAXA 2F6JA 4GNEA 2MT5A 5D1LB 3SOWA 3M62A 3EB5A 2YT5A 4YBMA 2YUCA 3RPGC 3KV5A 1DVPA 3VK6A 1WEUA 2G6QA 1X4IA 2Y1NA 4W4UA 4ZQLA 5TDRA 2BAYA 2JMJA 2YQMA 3PUQA 1Z2QA 3RPGB 5D1MB 2YYRA 2PNXA 1G25A 2Y1MA 4MVTA 2G43A 2MNYA 2ECWA 1WENA 2E6SA 5H1VA 3ZTGA 1V87A 2K17A 4PTBA 4WA6A 4YATA 2MA5A 3N9NA 2KU3A 2K4DA 5TABA 3T7LA 2KIZA 4LADB 2JRJA 4R2YA 3C6WA 2VJFB 3LQIA 3O37A 4CCGX 4UP5A 2F6NA 4AYCA 3N9QA 4Q6FA 2L43A 4QF3A 1WEPA 3ZVZB 4UI9B 2YURA 3O7AA 1ZBDB 2YSJA 2C2LA 5LCWB 1MM2A 3N9MA 2CKLA 4WZ2A 5B75A 1X4JA 2VJEA 3ZPV1 5B77A 1WEVA 4I7CA 4LJNA 1JOCA 2KWOA 3U5PA 4AP4A 2YW8A 3EB6A 4FIPA 3LQHA 5DKAA 3U5NA 2LRIC 5J3XA 2D8SA 2VNFA 5KH9A 4V3KC 2M85A 1RMDA 4F52B 2DX8A 4BHWA 1JM7A 4YADA 2QIZA 3N9OA 4FK5A 4C9ZA 2JMDA 1WEEA 1WEQA 2MUMA 4AUQB 2VP7A 1WEWA 4WZ0A 4FO9A 3T6RA 2VPDA 2E6RA 4ZDTA 5FB1A 2LGLA 5FERA 2G45A 2YU4A 1F62A 3FL2A 5B8DA 5I3LA 1WEMA 5AITA 2ECJA 1FP0A 2MD7B 2XB1A 4LK9A 5B78A 2ECVA 5DINA 2KGGA 3L1XA 5KH7A 5AIUA 2KREA 1WGMA 2F42A 4GNFA 4R8PK 3GV4A 2YREA 3DPLR 3HCUA 4L7XA 4YBTA 4GNDA 2YQLA 4PPEA 3V43A 2HYED 2H0DA 3ZVYA 2KWJA 4P5OB 1VD4A 3HCTA 3N9LA 5LKZA 2LXHC 5TDWA 2UZGA 2CSYA 2VPEA 2VPBA 4B86C 3SOUA 2KFTA 2ECIA 4IC2A 5G05B 2C2VS 4ZUXU 5TBNA 1VYXA 4A0CD 2HDPA 4YC9A 4XI1A 4FJCA 4MSXA 2L5UA 3O70A 5FB0A 3HCSA 2YHOA 2YSMA 2Y43A 2LQ6A 2IDAA 1N87A 4A4CA 4B7YC 2LXPC 3I2DA 1IYMA 3L11A 3SOXA 3O33A 2CSZA 3U5OA 4CA1A 2CKLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WZ3 B;  5LKX A;  2VJE B;  2NAA A;  1U6G B;  4BBQ A;  2EOD A;  2PUY A;  3M63 A;  3MHS A;  2LDR A;  3ZNI A;  5KH3 A;  1BOR A;  2QJ0 A;  3KV6 A;  4R7E A;  4YBS A;  3MHH A;  2VJF A;  3L1Z B;  2RSD A;  3C5K A;  3NG2 A;  1MM3 A;  5LKT A;  4N3W A;  1K2F A;  1WE9 A;  2KGI A;  3ASL A;  2QIC A;  5G04 B;  2L75 A;  3M99 A;  2I50 A;  4IC3 A;  4NN2 A;  2VPG A;  3KNV A;  1JM7 B;  1LDJ B;  2ECT A;  2FUU A;  4X3G A;  5EYA F;  3GL6 A;  4UP0 A;  5H1U A;  2ZET C;  2LN0 A;  2KR4 A;  3DQV R;  3ZPV E;  1X4U A;  2L0B A;  5FEY A;  3LRQ A;  5H9M A;  3O35 A;  4YAB A;  4V3L C;  2LGG A;  4GNG A;  4N4F A;  2JMI A;  4A4B A;  2MIQ A;  3ZYQ A;  2OXQ C;  4I7D A;  4LKA A;  1Z6U A;  3O36 A;  2LGK A;  2M6M A;  2M1R A;  5H1T A;  4TKP B;  2ECG A;  2K1J A;  2KWN A;  1WEO A;  2M3H A;  3N9P A;  1WFK A;  3O34 A;  1T1H A;  5LKU A;  2KYU A;  4AVX A;  3LQJ A;  2FSA A;  3U5M A;  1HYJ A;  2YHN A;  1FBV A;  2FUI A;  2KE1 A;  1VFY A;  2MD8 C;  3RTR B;  5B79 A;  2EGP A;  2LGV A;  2H0D B;  2K16 A;  4AYC B;  2XEU A;  2KWK A;  2RI7 A;  3PUR A;  4S3O C;  5C11 A;  2ECN A;  2LV9 A;  2MNZ A;  5G0F A;  1E4U A;  2EA6 A;  2MA6 A;  1WIL A;  4I7B A;  4GB0 A;  4O64 A;  1XWH A;  3IHP A;  3SHB A;  5TRB A;  5JG6 A;  1WIM A;  2AN6 A;  4S3O B;  3KQI A;  1HYI A;  1LDK C;  1Z60 A;  2CT2 A;  3HTK C;  4L58 A;  5D1K B;  1WES A;  3QZV A;  5B76 A;  2L80 A;  4LLB A;  5C13 A;  1CHC A;  4A49 A;  4QF2 A;  3PHD A;  4YAX A;  2F6J A;  4GNE A;  2MT5 A;  5D1L B;  3SOW A;  3M62 A;  3EB5 A;  2YT5 A;  4YBM A;  2YUC A;  3RPG C;  3KV5 A;  1DVP A;  3VK6 A;  1WEU A;  2G6Q A;  1X4I A;  2Y1N A;  4W4U A;  4ZQL A;  5TDR A;  2BAY A;  2JMJ A;  2YQM A;  3PUQ A;  1Z2Q A;  3RPG B;  5D1M B;  2YYR A;  2PNX A;  1G25 A;  2Y1M A;  4MVT A;  2G43 A;  2MNY A;  2ECW A;  1WEN A;  2E6S A;  5H1V A;  3ZTG A;  1V87 A;  2K17 A;  4PTB A;  4WA6 A;  4YAT A;  2MA5 A;  3N9N A;  2KU3 A;  2K4D A;  5TAB A;  3T7L A;  2KIZ A;  4LAD B;  2JRJ A;  4R2Y A;  3C6W A;  2VJF B;  3LQI A;  3O37 A;  4CCG X;  4UP5 A;  2F6N A;  4AYC A;  3N9Q A;  4Q6F A;  2L43 A;  4QF3 A;  1WEP A;  3ZVZ B;  4UI9 B;  2YUR A;  3O7A A;  1ZBD B;  2YSJ A;  2C2L A;  5LCW B;  1MM2 A;  3N9M A;  2CKL A;  4WZ2 A;  5B75 A;  1X4J A;  2VJE A;  3ZPV 1;  5B77 A;  1WEV A;  4I7C A;  4LJN A;  1JOC A;  2KWO A;  3U5P A;  4AP4 A;  2YW8 A;  3EB6 A;  4FIP A;  3LQH A;  5DKA A;  3U5N A;  2LRI C;  5J3X A;  2D8S A;  2VNF A;  5KH9 A;  4V3K C;  2M85 A;  1RMD A;  4F52 B;  2DX8 A;  4BHW A;  1JM7 A;  4YAD A;  2QIZ A;  3N9O A;  4FK5 A;  4C9Z A;  2JMD A;  1WEE A;  1WEQ A;  2MUM A;  4AUQ B;  2VP7 A;  1WEW A;  4WZ0 A;  4FO9 A;  3T6R A;  2VPD A;  2E6R A;  4ZDT A;  5FB1 A;  2LGL A;  5FER A;  2G45 A;  2YU4 A;  1F62 A;  3FL2 A;  5B8D A;  5I3L A;  1WEM A;  5AIT A;  2ECJ A;  1FP0 A;  2MD7 B;  2XB1 A;  4LK9 A;  5B78 A;  2ECV A;  5DIN A;  2KGG A;  3L1X A;  5KH7 A;  5AIU A;  2KRE A;  1WGM A;  2F42 A;  4GNF A;  4R8P K;  3GV4 A;  2YRE A;  3DPL R;  3HCU A;  4L7X A;  4YBT A;  4GND A;  2YQL A;  4PPE A;  3V43 A;  2HYE D;  2H0D A;  3ZVY A;  2KWJ A;  4P5O B;  1VD4 A;  3HCT A;  3N9L A;  5LKZ A;  2LXH C;  5TDW A;  2UZG A;  2CSY A;  2VPE A;  2VPB A;  4B86 C;  3SOU A;  2KFT A;  2ECI A;  4IC2 A;  5G05 B;  2C2V S;  4ZUX U;  5TBN A;  1VYX A;  4A0C D;  2HDP A;  4YC9 A;  4XI1 A;  4FJC A;  4MSX A;  2L5U A;  3O70 A;  5FB0 A;  3HCS A;  2YHO A;  2YSM A;  2Y43 A;  2LQ6 A;  2IDA A;  1N87 A;  4A4C A;  4B7Y C;  2LXP C;  3I2D A;  1IYM A;  3L11 A;  3SOX A;  3O33 A;  2CSZ A;  3U5O A;  4CA1 A;  2CKL B; 
#chains in the Genus database with same CATH topology
 4WZ3 B;  5LKX A;  2VJE B;  3LVQ E;  2NAA A;  1U6G B;  4BBQ A;  2EOD A;  2PUY A;  3M63 A;  3MHS A;  2LDR A;  4Z0O A;  3ZNI A;  5KH3 A;  1BOR A;  2QJ0 A;  3KV6 A;  4R7E A;  4YBS A;  3MHH A;  2VJF A;  3L1Z B;  2RSD A;  3C5K A;  3NG2 A;  1MM3 A;  5LKT A;  4N3W A;  1K2F A;  1WE9 A;  2KGI A;  3ASL A;  2QIC A;  5G04 B;  2L75 A;  3M99 A;  2I50 A;  4IC3 A;  4NN2 A;  2VPG A;  3KNV A;  1JM7 B;  2FD4 A;  1LDJ B;  2ECT A;  2FUU A;  4X3G A;  5EYA F;  3GL6 A;  4UP0 A;  5H1U A;  2ZET C;  5SVX A;  1MBM A;  2LN0 A;  2CRR A;  2KR4 A;  3DQV R;  3ZPV E;  1X4U A;  2L0B A;  5FEY A;  3LRQ A;  5H9M A;  3O35 A;  4YAB A;  4V3L C;  2LGG A;  4GNG A;  4N4F A;  3PLW A;  2JMI A;  4A4B A;  4QQ4 A;  2MIQ A;  3ZYQ A;  2OXQ C;  4I7D A;  4LKA A;  1Z6U A;  3O36 A;  2LGK A;  2M6M A;  2M1R A;  5H1T A;  3SUB A;  4TKP B;  2ECG A;  2K1J A;  2CSV A;  2KWN A;  1WEO A;  2M3H A;  3N9P A;  1WFK A;  3O34 A;  1T1H A;  5LKU A;  2XOC A;  2KYU A;  4AVX A;  3LQJ A;  2FSA A;  3U5M A;  3H7H A;  2YHN A;  1HYJ A;  1FBV A;  2FUI A;  2KE1 A;  1VFY A;  2MD8 C;  1DCQ A;  3RTR B;  5B79 A;  2EGP A;  2LGV A;  2H0D B;  2K16 A;  4AYC B;  2XEU A;  2MKE A;  5SVY A;  2KWK A;  2RI7 A;  3PUR A;  4S3O C;  5C11 A;  2ECN A;  2LV9 A;  2MNZ A;  5G0F A;  1E4U A;  2EA6 A;  2MA6 A;  1WIL A;  4I7B A;  3FEH A;  4GB0 A;  4O64 A;  1XWH A;  3IHP A;  3SHB A;  3MDB C;  5TRB A;  5JG6 A;  1WIM A;  2AN6 A;  4S3O B;  3FM8 C;  3KQI A;  1HYI A;  1LDK C;  1Z60 A;  2CT2 A;  3HTK C;  4L58 A;  5D1K B;  1WES A;  3E2D A;  3FJU B;  3QZV A;  5B76 A;  2L80 A;  4LLB A;  5C13 A;  1CHC A;  2CRW A;  2XOY A;  4A49 A;  4QF2 A;  3PHD A;  4YAX A;  2F6J A;  4GNE A;  2LAU A;  2MT5 A;  5D1L B;  3SOW A;  3M7K A;  3M62 A;  3EB5 A;  2YT5 A;  4YBM A;  2YUC A;  3RPG C;  3KV5 A;  1DVP A;  3VK6 A;  2EGM A;  1WEU A;  2G6Q A;  1X4I A;  2Y1N A;  4W4U A;  4ZQL A;  5TDR A;  2BAY A;  2JMJ A;  2YQM A;  3PUQ A;  1Z2Q A;  3RPG B;  3LDY A;  5D1M B;  2EXU A;  2YYR A;  2DJA A;  2PNX A;  1G25 A;  2Y1M A;  4MVT A;  2RR4 A;  2G43 A;  2MNY A;  5SVI A;  2ECW A;  1WEN A;  2E6S A;  5H1V A;  4Z0R A;  3ZTG A;  1V87 A;  3KDE C;  2K17 A;  4PTB A;  4WA6 A;  4YAT A;  2MA5 A;  3N9N A;  2KU3 A;  2K4D A;  5TAB A;  3T7L A;  2KIZ A;  4LAD B;  2JRJ A;  4R2Y A;  2JUN A;  3C6W A;  2VJF B;  3LJU X;  3LQI A;  3O37 A;  4CCG X;  2XOZ A;  4UP5 A;  2F6N A;  3DWD A;  4AYC A;  3N9Q A;  4Q6F A;  3LVR E;  2L43 A;  4QF3 A;  1WEP A;  4OGC A;  3ZVZ B;  4UI9 B;  2YUR A;  3O7A A;  1ZBD B;  2YSJ A;  2C2L A;  5LCW B;  1MM2 A;  3N9M A;  2CKL A;  4WZ2 A;  5B75 A;  1X4J A;  2VJE A;  2KKY A;  3ZPV 1;  5B77 A;  1WEV A;  2DSM A;  4I7C A;  4LJN A;  1JOC A;  2KWO A;  3U5P A;  3DDT A;  4AP4 A;  2YW8 A;  3EB6 A;  4FIP A;  3LQH A;  5DKA A;  3U5N A;  2LRI C;  5J3X A;  2XP0 A;  2D8S A;  2VNF A;  2FFW A;  5KH9 A;  4V3K C;  2M85 A;  1RMD A;  4F52 B;  2DX8 A;  4BHW A;  1JM7 A;  5K3Q A;  4YAD A;  2QIZ A;  3N9O A;  4FK5 A;  4C9Z A;  2JMD A;  1WEE A;  1WEQ A;  2MUM A;  4AUQ B;  2VP7 A;  1WEW A;  2M13 A;  4WZ0 A;  4FO9 A;  3T6R A;  2VPD A;  2E6R A;  4ZDT A;  5FB1 A;  2LGL A;  5FER A;  2G45 A;  2YU4 A;  2YVR A;  4OGE A;  1F62 A;  3FL2 A;  5B8D A;  5I3L A;  1WEM A;  3JUE A;  5AIT A;  2ECJ A;  2OWA A;  4F1P A;  1FP0 A;  2MD7 B;  2XB1 A;  4LK9 A;  5B78 A;  2ECV A;  5DIN A;  2KGG A;  3L1X A;  5KH7 A;  5AIU A;  2KRE A;  1WGM A;  2F42 A;  4GNF A;  4R8P K;  3GV4 A;  2YRE A;  4O62 A;  3DPL R;  3HCU A;  2D8U A;  4L7X A;  4YBT A;  4GND A;  3Q1D A;  2YQL A;  2CON A;  4PPE A;  3V43 A;  2HYE D;  2H0D A;  3ZVY A;  2KWJ A;  4P5O B;  1VD4 A;  3HCT A;  3N9L A;  5LKZ A;  2LXH C;  3O47 A;  5TDW A;  3FAO A;  2UZG A;  2CSY A;  2VPE A;  2VPB A;  5SVI B;  4B86 C;  3SOU A;  2KFT A;  2ECI A;  4IC2 A;  3FAN A;  5G05 B;  2C2V S;  4ZUX U;  5TBN A;  1VYX A;  4A0C D;  2HDP A;  4YC9 A;  4XI1 A;  4FJC A;  4MSX A;  2L7P A;  2L5U A;  2KKX A;  3O70 A;  2IQJ A;  5FB0 A;  3HCS A;  2YHO A;  3T9K A;  2YSM A;  2Y43 A;  2LQ6 A;  2E61 A;  1N87 A;  2IDA A;  4A4C A;  4B7Y C;  2LXP C;  2JM3 A;  3I2D A;  2B0O E;  1IYM A;  3L11 A;  4H9D A;  3SOX A;  3O33 A;  2CSZ A;  3U5O A;  2P57 A;  4CA1 A;  2CKL B; 
#chains in the Genus database with same CATH homology
 4WZ3 B;  5LKX A;  2VJE B;  2NAA A;  1U6G B;  4BBQ A;  2EOD A;  2PUY A;  3M63 A;  3MHS A;  2LDR A;  3ZNI A;  5KH3 A;  1BOR A;  2QJ0 A;  3KV6 A;  4R7E A;  4YBS A;  3MHH A;  2VJF A;  3L1Z B;  2RSD A;  3C5K A;  3NG2 A;  1MM3 A;  5LKT A;  4N3W A;  1K2F A;  1WE9 A;  2KGI A;  3ASL A;  2QIC A;  5G04 B;  2L75 A;  3M99 A;  2I50 A;  4IC3 A;  4NN2 A;  2VPG A;  3KNV A;  1JM7 B;  1LDJ B;  2ECT A;  2FUU A;  4X3G A;  5EYA F;  3GL6 A;  4UP0 A;  5H1U A;  2ZET C;  2LN0 A;  2KR4 A;  3DQV R;  3ZPV E;  1X4U A;  2L0B A;  5FEY A;  3LRQ A;  5H9M A;  3O35 A;  4YAB A;  4V3L C;  2LGG A;  4GNG A;  4N4F A;  2JMI A;  4A4B A;  2MIQ A;  3ZYQ A;  2OXQ C;  4I7D A;  4LKA A;  1Z6U A;  3O36 A;  2LGK A;  2M6M A;  2M1R A;  5H1T A;  4TKP B;  2ECG A;  2K1J A;  2KWN A;  1WEO A;  2M3H A;  3N9P A;  1WFK A;  3O34 A;  1T1H A;  5LKU A;  2KYU A;  4AVX A;  3LQJ A;  2FSA A;  3U5M A;  1HYJ A;  2YHN A;  1FBV A;  2FUI A;  2KE1 A;  1VFY A;  2MD8 C;  3RTR B;  5B79 A;  2EGP A;  2LGV A;  2H0D B;  2K16 A;  4AYC B;  2XEU A;  2KWK A;  2RI7 A;  3PUR A;  4S3O C;  5C11 A;  2ECN A;  2LV9 A;  2MNZ A;  5G0F A;  1E4U A;  2EA6 A;  2MA6 A;  1WIL A;  4I7B A;  4GB0 A;  4O64 A;  1XWH A;  3IHP A;  3SHB A;  5TRB A;  5JG6 A;  1WIM A;  2AN6 A;  4S3O B;  3KQI A;  1HYI A;  1LDK C;  1Z60 A;  2CT2 A;  3HTK C;  4L58 A;  5D1K B;  1WES A;  3QZV A;  5B76 A;  2L80 A;  4LLB A;  5C13 A;  1CHC A;  4A49 A;  4QF2 A;  3PHD A;  4YAX A;  2F6J A;  4GNE A;  2MT5 A;  5D1L B;  3SOW A;  3M62 A;  3EB5 A;  2YT5 A;  4YBM A;  2YUC A;  3RPG C;  3KV5 A;  1DVP A;  3VK6 A;  1WEU A;  2G6Q A;  1X4I A;  2Y1N A;  4W4U A;  4ZQL A;  5TDR A;  2BAY A;  2JMJ A;  2YQM A;  3PUQ A;  1Z2Q A;  3RPG B;  5D1M B;  2YYR A;  2PNX A;  1G25 A;  2Y1M A;  4MVT A;  2G43 A;  2MNY A;  2ECW A;  1WEN A;  2E6S A;  5H1V A;  3ZTG A;  1V87 A;  2K17 A;  4PTB A;  4WA6 A;  4YAT A;  2MA5 A;  3N9N A;  2KU3 A;  2K4D A;  5TAB A;  3T7L A;  2KIZ A;  4LAD B;  2JRJ A;  4R2Y A;  3C6W A;  2VJF B;  3LQI A;  3O37 A;  4CCG X;  4UP5 A;  2F6N A;  4AYC A;  3N9Q A;  4Q6F A;  2L43 A;  4QF3 A;  1WEP A;  3ZVZ B;  4UI9 B;  2YUR A;  3O7A A;  1ZBD B;  2YSJ A;  2C2L A;  5LCW B;  1MM2 A;  3N9M A;  2CKL A;  4WZ2 A;  5B75 A;  1X4J A;  2VJE A;  3ZPV 1;  5B77 A;  1WEV A;  4I7C A;  4LJN A;  1JOC A;  2KWO A;  3U5P A;  4AP4 A;  2YW8 A;  3EB6 A;  4FIP A;  3LQH A;  5DKA A;  3U5N A;  2LRI C;  5J3X A;  2D8S A;  2VNF A;  5KH9 A;  4V3K C;  2M85 A;  1RMD A;  4F52 B;  2DX8 A;  4BHW A;  1JM7 A;  4YAD A;  2QIZ A;  3N9O A;  4FK5 A;  4C9Z A;  2JMD A;  1WEE A;  1WEQ A;  2MUM A;  4AUQ B;  2VP7 A;  1WEW A;  4WZ0 A;  4FO9 A;  3T6R A;  2VPD A;  2E6R A;  4ZDT A;  5FB1 A;  2LGL A;  5FER A;  2G45 A;  2YU4 A;  1F62 A;  3FL2 A;  5B8D A;  5I3L A;  1WEM A;  5AIT A;  2ECJ A;  1FP0 A;  2MD7 B;  2XB1 A;  4LK9 A;  5B78 A;  2ECV A;  5DIN A;  2KGG A;  3L1X A;  5KH7 A;  5AIU A;  2KRE A;  1WGM A;  2F42 A;  4GNF A;  4R8P K;  3GV4 A;  2YRE A;  3DPL R;  3HCU A;  4L7X A;  4YBT A;  4GND A;  2YQL A;  4PPE A;  3V43 A;  2HYE D;  2H0D A;  3ZVY A;  2KWJ A;  4P5O B;  1VD4 A;  3HCT A;  3N9L A;  5LKZ A;  2LXH C;  5TDW A;  2UZG A;  2CSY A;  2VPE A;  2VPB A;  4B86 C;  3SOU A;  2KFT A;  2ECI A;  4IC2 A;  5G05 B;  2C2V S;  4ZUX U;  5TBN A;  1VYX A;  4A0C D;  2HDP A;  4YC9 A;  4XI1 A;  4FJC A;  4MSX A;  2L5U A;  3O70 A;  5FB0 A;  3HCS A;  2YHO A;  2YSM A;  2Y43 A;  2LQ6 A;  2IDA A;  1N87 A;  4A4C A;  4B7Y C;  2LXP C;  3I2D A;  1IYM A;  3L11 A;  3SOX A;  3O33 A;  2CSZ A;  3U5O A;  4CA1 A;  2CKL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...