2KWOA

Solution structure of the double phd (plant homeodomain) fingers of human transcriptional protein dpf3b bound to a histone h4 peptide containing n-terminal acetylation at serine 1
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
114
structure length
114
Chain Sequence
b'GSYCDFCLGGSNMNKKSGRPEELVSCADCGRSGHPTCLQFTLNMTEAVKTYKWQCIECKSCILCGTSENDDQLLFCDDCDRGYHMYCLNPPVAEPPEGSWSCHLCWELLKEKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone peptide
publication title Mechanism and regulation of acetylated histone binding by the tandem PHD finger of DPF3b.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 15
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2010-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2kwoA00
2ECIA 3KNVA 4Q6FA 2CT2A 1BORA 1JOCA 4F52B 5H1UA 2KYUA 3GV4A 2YSJA 5FB0A 5TDWA 5C11A 2Y1NA 5LKTA 2KGIA 1FP0A 3O37A 5TABA 2HDPA 3PURA 5H1VA 2JMJA 3ASLA 5I3LA 3SOWA 2I50A 5LCWB 2KREA 3T6RA 3PHDA 1WESA 1X4JA 2RSDA 2F6JA 4BBQA 3LQJA 5JG6A 5D1LB 4V3KC 3U5PA 2ZETC 4B86C 1WEQA 1WILA 1WEUA 1VD4A 3ZYQA 3L1XA 2JMDA 4ZQLA 3O70A 4MSXA 2KWKA 3EB6A 4A49A 2C2VS 2MD8C 3QZVA 1HYJA 5B77A 5D1MB 1F62A 1MM2A 2VJEA 4P5OB 2ECGA 2YSMA 2L80A 2HYED 4LKAA 4PTBA 3RPGC 2VJFA 2Y1MA 5D1KB 4V3LC 4WZ0A 2G45A 3HCTA 2ECNA 3RTRB 4XI1A 1U6GB 3NG2A 2VJEB 2LGVA 1K2FA 4AYCA 2VP7A 4A4CA 1WGMA 2VJFB 2EODA 4O64A 2G43A 5FERA 3SOUA 2IDAA 1WEPA 5TRBA 3ZNIA 4GNEA 3ZVYA 4AYCB 4R2YA 5B75A 2E6SA 3O34A 4YBMA 4C9ZA 3I2DA 3ZVZB 2MUMA 4LJNA 5KH7A 5LKXA 5LKUA 2YHNA 2FUIA 1CHCA 2YYRA 4IC2A 2PNXA 4LLBA 2VPGA 1WEOA 3M99A 2KIZA 4YBTA 4R8PK 1T1HA 4QF2A 1G25A 3O7AA 5FEYA 5H1TA 4R7EA 3V43A 3LRQA 3ZPV1 3C6WA 4CA1A 3IHPA 4NN2A 3SHBA 5FB1A 2PUYA 2YU4A 2MNZA 5KH9A 3L11A 4A0CD 3PUQA 2EGPA 3KV6A 3M63A 2CSYA 4L7XA 4AP4A 1DVPA 2BAYA 2KFTA 2VPDA 5B78A 2LXHC 3DPLR 4I7DA 2QIZA 2K17A 2XEUA 2MT5A 5LKZA 5J3XA 2MA5A 2UZGA 2NAAA 4GNDA 2K16A 5TBNA 2K1JA 2L5UA 1WENA 2KWOA 3GL6A 4FO9A 1VFYA 5TDRA 2MNYA 4YABA 1VYXA 2QJ0A 2F42A 4YAXA 2L0BA 2YW8A 1WEVA 3KQIA 2JRJA 4GNGA 5DINA 2G6QA 3N9MA 4YC9A 5G04B 1X4IA 2QICA 2M3HA 2YQLA 4MVTA 4I7BA 4X3GA 5AITA 4AVXA 3LQHA 4S3OB 4WZ3B 2H0DA 1N87A 2MA6A 1X4UA 3ZTGA 3EB5A 2YQMA 3N9LA 1WIMA 5H9MA 4YATA 2FUUA 2H0DB 1WE9A 3L1ZB 2YUCA 3SOXA 5KH3A 4UP5A 3ZPVE 4CCGX 2LV9A 1HYIA 3U5NA 3KV5A 5G05B 4N3WA 2Y43A 2CSZA 2E6RA 2CKLA 1Z2QA 2MD7B 4WA6A 5C13A 2AN6A 1LDKC 2C2LA 1Z6UA 2LGKA 2LDRA 2YREA 4FIPA 5AIUA 5DKAA 4GB0A 4I7CA 1JM7A 3U5OA 2M85A 2CKLB 1WEWA 3C5KA 1MM3A 2ECVA 2OXQC 5B79A 2VNFA 2LGGA 4TKPB 1ZBDB 1RMDA 2KWJA 4ZDTA 2M6MA 3HCUA 1JM7B 2MIQA 3M62A 2L75A 5EYAF 1Z60A 4LADB 3U5MA 2LXPC 4YBSA 4UP0A 4ZUXU 3HTKC 2RI7A 4QF3A 2F6NA 4AUQB 1LDJB 2YURA 1IYMA 4GNFA 4WZ2A 5B8DA 2ECTA 3LQIA 1XWHA 3O36A 2DX8A 2YT5A 4UI9B 4FJCA 4PPEA 2VPBA 1FBVA 2LRIC 3FL2A 4BHWA 3VK6A 2JMIA 4N4FA 3N9NA 3HCSA 2M1RA 2ECWA 5B76A 4S3OC 4YADA 3N9QA 3N9OA 4L58A 2LGLA 4LK9A 1WFKA 2L43A 4A4BA 2K4DA 2KR4A 4IC3A 3RPGB 2KE1A 3O35A 5G0FA 4B7YC 3DQVR 2YHOA 3MHSA 2KWNA 2XB1A 2KU3A 2VPEA 1WEMA 2FSAA 4FK5A 1E4UA 4W4UA 2KGGA 2ECJA 2LN0A 1V87A 1WEEA 3MHHA 2D8SA 2EA6A 3T7LA 3N9PA 3O33A 2LQ6A
chains in the Genus database with same CATH superfamily
2ECIA 3KNVA 4Q6FA 2CT2A 2RR4A 1BORA 3LJUX 1JOCA 4F52B 5H1UA 2KYUA 3GV4A 2YSJA 3FM8C 5FB0A 4OGCA 3LDYA 5TDWA 5C11A 2Y1NA 2EXUA 5LKTA 3H7HA 2KGIA 1FP0A 3O37A 5TABA 2HDPA 3PURA 5H1VA 2JMJA 3ASLA 5I3LA 3SOWA 2I50A 5LCWB 2KREA 3T6RA 3PHDA 1WESA 1X4JA 2RSDA 2F6JA 4BBQA 3LQJA 5JG6A 5D1LB 4V3KC 3U5PA 2ZETC 4B86C 1WEQA 1WILA 1WEUA 1VD4A 3ZYQA 3L1XA 2JMDA 4ZQLA 3O70A 4MSXA 2KWKA 3EB6A 2XOYA 4A49A 2FFWA 2C2VS 2MD8C 3QZVA 1HYJA 2P57A 3DDTA 5B77A 5D1MB 1F62A 1MM2A 2VJEA 4P5OB 4OGEA 2ECGA 2YSMA 2L80A 2HYED 4LKAA 4PTBA 3RPGC 2VJFA 2JM3A 2Y1MA 5D1KB 4V3LC 2YVRA 4WZ0A 2G45A 3HCTA 2ECNA 3RTRB 4XI1A 1U6GB 3NG2A 2VJEB 2LGVA 1K2FA 2CSVA 4AYCA 2VP7A 4A4CA 1WGMA 2VJFB 2EODA 4O64A 2G43A 5FERA 3SOUA 2IDAA 1WEPA 5TRBA 3ZNIA 4GNEA 3LVRE 3ZVYA 4AYCB 4R2YA 5B75A 2E6SA 3O34A 2M13A 4YBMA 4C9ZA 3I2DA 3ZVZB 2MUMA 4LJNA 2LAUA 5KH7A 5LKXA 5LKUA 2YHNA 2FUIA 1CHCA 2XP0A 2YYRA 2PNXA 4LLBA 4IC2A 2VPGA 1WEOA 3M99A 2KIZA 4YBTA 2DJAA 4R8PK 1T1HA 4QF2A 1G25A 3O7AA 5FEYA 5H1TA 4R7EA 3V43A 3E2DA 3LRQA 4Z0RA 3ZPV1 4Z0OA 3C6WA 4CA1A 3IHPA 4NN2A 3DWDA 3SHBA 5FB1A 2PUYA 2YU4A 2CRRA 2MNZA 5KH9A 3L11A 4A0CD 1MBMA 3PUQA 2EGPA 3KV6A 3M63A 2CSYA 4L7XA 4AP4A 1DVPA 2BAYA 2KFTA 2VPDA 3FJUB 3SUBA 5B78A 2LXHC 3DPLR 4I7DA 2QIZA 2K17A 2XEUA 2MT5A 3LVQE 5LKZA 5J3XA 2MA5A 2UZGA 3M7KA 2NAAA 4GNDA 2K16A 5TBNA 2K1JA 2L5UA 1WENA 2KWOA 3FEHA 3GL6A 4FO9A 1VFYA 5TDRA 2MNYA 4YABA 4H9DA 1VYXA 2CONA 4F1PA 2QJ0A 2F42A 4YAXA 2L0BA 2YW8A 1WEVA 3KQIA 2JRJA 4GNGA 5DINA 2G6QA 3N9MA 4YC9A 5G04B 2IQJA 1X4IA 2QICA 2M3HA 3Q1DA 2YQLA 4MVTA 4I7BA 4X3GA 5AITA 4AVXA 3LQHA 3T9KA 4S3OB 4WZ3B 2H0DA 1N87A 2MA6A 2FD4A 1X4UA 3ZTGA 3EB5A 2YQMA 2XOCA 3N9LA 1WIMA 5H9MA 3PLWA 4YATA 2FUUA 2H0DB 1WE9A 3L1ZB 2YUCA 5SVXA 3SOXA 5KH3A 4UP5A 3ZPVE 4CCGX 2LV9A 3KDEC 1HYIA 3U5NA 3KV5A 5G05B 4N3WA 2Y43A 1DCQA 2CSZA 2E6RA 2CKLA 1Z2QA 2MD7B 3O47A 4WA6A 5C13A 2AN6A 1LDKC 2C2LA 1Z6UA 2LGKA 2LDRA 2YREA 2D8UA 4FIPA 5AIUA 5DKAA 4GB0A 4I7CA 1JM7A 3U5OA 2DSMA 2M85A 2CKLB 1WEWA 3C5KA 1MM3A 2ECVA 2OXQC 5B79A 2VNFA 2LGGA 4TKPB 1ZBDB 1RMDA 2KWJA 4ZDTA 3FAOA 2M6MA 3HCUA 1JM7B 2MIQA 3M62A 2L75A 5EYAF 1Z60A 4LADB 3U5MA 2LXPC 2L7PA 4YBSA 4UP0A 4ZUXU 3HTKC 2RI7A 4QF3A 2F6NA 4AUQB 2E61A 1LDJB 4QQ4A 2MKEA 2YURA 1IYMA 4GNFA 2XOZA 4WZ2A 5B8DA 2ECTA 2JUNA 3LQIA 1XWHA 3O36A 2DX8A 2YT5A 4UI9B 2EGMA 3JUEA 4FJCA 4PPEA 2VPBA 5SVIA 1FBVA 2LRIC 3FL2A 4BHWA 3VK6A 2JMIA 4N4FA 3N9NA 3HCSA 2M1RA 5SVYA 2ECWA 5B76A 4S3OC 4YADA 3N9QA 3N9OA 4L58A 2LGLA 4LK9A 1WFKA 2L43A 5SVIB 2K4DA 4A4BA 2KR4A 4IC3A 3RPGB 2KE1A 3O35A 5G0FA 4B7YC 3DQVR 2YHOA 3MHSA 2KWNA 2XB1A 2KU3A 4O62A 2VPEA 1WEMA 2KKYA 2FSAA 4FK5A 1E4UA 3FANA 4W4UA 2KGGA 2ECJA 2LN0A 2OWAA 2B0OE 1V87A 1WEEA 3MDBC 3MHHA 2D8SA 2EA6A 2KKXA 3T7LA 5K3QA 3N9PA 3O33A 2LQ6A 2CRWA
chains in the Genus database with same CATH topology
2ECIA 3KNVA 4Q6FA 2CT2A 1BORA 1JOCA 4F52B 5H1UA 2KYUA 3GV4A 2YSJA 5FB0A 5TDWA 5C11A 2Y1NA 5LKTA 2KGIA 1FP0A 3O37A 5TABA 2HDPA 3PURA 5H1VA 2JMJA 3ASLA 5I3LA 3SOWA 2I50A 5LCWB 2KREA 3T6RA 3PHDA 1WESA 1X4JA 2RSDA 2F6JA 4BBQA 3LQJA 5JG6A 5D1LB 4V3KC 3U5PA 2ZETC 4B86C 1WEQA 1WILA 1WEUA 1VD4A 3ZYQA 3L1XA 2JMDA 4ZQLA 3O70A 4MSXA 2KWKA 3EB6A 4A49A 2C2VS 2MD8C 3QZVA 1HYJA 5B77A 5D1MB 1F62A 1MM2A 2VJEA 4P5OB 2ECGA 2YSMA 2L80A 2HYED 4LKAA 4PTBA 3RPGC 2VJFA 2Y1MA 5D1KB 4V3LC 4WZ0A 2G45A 3HCTA 2ECNA 3RTRB 4XI1A 1U6GB 3NG2A 2VJEB 2LGVA 1K2FA 4AYCA 2VP7A 4A4CA 1WGMA 2VJFB 2EODA 4O64A 2G43A 5FERA 3SOUA 2IDAA 1WEPA 5TRBA 3ZNIA 4GNEA 3ZVYA 4AYCB 4R2YA 5B75A 2E6SA 3O34A 4YBMA 4C9ZA 3I2DA 3ZVZB 2MUMA 4LJNA 5KH7A 5LKXA 5LKUA 2YHNA 2FUIA 1CHCA 2YYRA 4IC2A 2PNXA 4LLBA 2VPGA 1WEOA 3M99A 2KIZA 4YBTA 4R8PK 1T1HA 4QF2A 1G25A 3O7AA 5FEYA 5H1TA 4R7EA 3V43A 3LRQA 3ZPV1 3C6WA 4CA1A 3IHPA 4NN2A 3SHBA 5FB1A 2PUYA 2YU4A 2MNZA 5KH9A 3L11A 4A0CD 3PUQA 2EGPA 3KV6A 3M63A 2CSYA 4L7XA 4AP4A 1DVPA 2BAYA 2KFTA 2VPDA 5B78A 2LXHC 3DPLR 4I7DA 2QIZA 2K17A 2XEUA 2MT5A 5LKZA 5J3XA 2MA5A 2UZGA 2NAAA 4GNDA 2K16A 5TBNA 2K1JA 2L5UA 1WENA 2KWOA 3GL6A 4FO9A 1VFYA 5TDRA 2MNYA 4YABA 1VYXA 2QJ0A 2F42A 4YAXA 2L0BA 2YW8A 1WEVA 3KQIA 2JRJA 4GNGA 5DINA 2G6QA 3N9MA 4YC9A 5G04B 1X4IA 2QICA 2M3HA 2YQLA 4MVTA 4I7BA 4X3GA 5AITA 4AVXA 3LQHA 4S3OB 4WZ3B 2H0DA 1N87A 2MA6A 1X4UA 3ZTGA 3EB5A 2YQMA 3N9LA 1WIMA 5H9MA 4YATA 2FUUA 2H0DB 1WE9A 3L1ZB 2YUCA 3SOXA 5KH3A 4UP5A 3ZPVE 4CCGX 2LV9A 1HYIA 3U5NA 3KV5A 5G05B 4N3WA 2Y43A 2CSZA 2E6RA 2CKLA 1Z2QA 2MD7B 4WA6A 5C13A 2AN6A 1LDKC 2C2LA 1Z6UA 2LGKA 2LDRA 2YREA 4FIPA 5AIUA 5DKAA 4GB0A 4I7CA 1JM7A 3U5OA 2M85A 2CKLB 1WEWA 3C5KA 1MM3A 2ECVA 2OXQC 5B79A 2VNFA 2LGGA 4TKPB 1ZBDB 1RMDA 2KWJA 4ZDTA 2M6MA 3HCUA 1JM7B 2MIQA 3M62A 2L75A 5EYAF 1Z60A 4LADB 3U5MA 2LXPC 4YBSA 4UP0A 4ZUXU 3HTKC 2RI7A 4QF3A 2F6NA 4AUQB 1LDJB 2YURA 1IYMA 4GNFA 4WZ2A 5B8DA 2ECTA 3LQIA 1XWHA 3O36A 2DX8A 2YT5A 4UI9B 4FJCA 4PPEA 2VPBA 1FBVA 2LRIC 3FL2A 4BHWA 3VK6A 2JMIA 4N4FA 3N9NA 3HCSA 2M1RA 2ECWA 5B76A 4S3OC 4YADA 3N9QA 3N9OA 4L58A 2LGLA 4LK9A 1WFKA 2L43A 4A4BA 2K4DA 2KR4A 4IC3A 3RPGB 2KE1A 3O35A 5G0FA 4B7YC 3DQVR 2YHOA 3MHSA 2KWNA 2XB1A 2KU3A 2VPEA 1WEMA 2FSAA 4FK5A 1E4UA 4W4UA 2KGGA 2ECJA 2LN0A 1V87A 1WEEA 3MHHA 2D8SA 2EA6A 3T7LA 3N9PA 3O33A 2LQ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ECI A;  3KNV A;  4Q6F A;  2CT2 A;  1BOR A;  1JOC A;  4F52 B;  5H1U A;  2KYU A;  3GV4 A;  2YSJ A;  5FB0 A;  5TDW A;  5C11 A;  2Y1N A;  5LKT A;  2KGI A;  1FP0 A;  3O37 A;  5TAB A;  2HDP A;  3PUR A;  5H1V A;  2JMJ A;  3ASL A;  5I3L A;  3SOW A;  2I50 A;  5LCW B;  2KRE A;  3T6R A;  3PHD A;  1WES A;  1X4J A;  2RSD A;  2F6J A;  4BBQ A;  3LQJ A;  5JG6 A;  5D1L B;  4V3K C;  3U5P A;  2ZET C;  4B86 C;  1WEQ A;  1WIL A;  1WEU A;  1VD4 A;  3ZYQ A;  3L1X A;  2JMD A;  4ZQL A;  3O70 A;  4MSX A;  2KWK A;  3EB6 A;  4A49 A;  2C2V S;  2MD8 C;  3QZV A;  1HYJ A;  5B77 A;  5D1M B;  1F62 A;  1MM2 A;  2VJE A;  4P5O B;  2ECG A;  2YSM A;  2L80 A;  2HYE D;  4LKA A;  4PTB A;  3RPG C;  2VJF A;  2Y1M A;  5D1K B;  4V3L C;  4WZ0 A;  2G45 A;  3HCT A;  2ECN A;  3RTR B;  4XI1 A;  1U6G B;  3NG2 A;  2VJE B;  2LGV A;  1K2F A;  4AYC A;  2VP7 A;  4A4C A;  1WGM A;  2VJF B;  2EOD A;  4O64 A;  2G43 A;  5FER A;  3SOU A;  2IDA A;  1WEP A;  5TRB A;  3ZNI A;  4GNE A;  3ZVY A;  4AYC B;  4R2Y A;  5B75 A;  2E6S A;  3O34 A;  4YBM A;  4C9Z A;  3I2D A;  3ZVZ B;  2MUM A;  4LJN A;  5KH7 A;  5LKX A;  5LKU A;  2YHN A;  2FUI A;  1CHC A;  2YYR A;  4IC2 A;  2PNX A;  4LLB A;  2VPG A;  1WEO A;  3M99 A;  2KIZ A;  4YBT A;  4R8P K;  1T1H A;  4QF2 A;  1G25 A;  3O7A A;  5FEY A;  5H1T A;  4R7E A;  3V43 A;  3LRQ A;  3ZPV 1;  3C6W A;  4CA1 A;  3IHP A;  4NN2 A;  3SHB A;  5FB1 A;  2PUY A;  2YU4 A;  2MNZ A;  5KH9 A;  3L11 A;  4A0C D;  3PUQ A;  2EGP A;  3KV6 A;  3M63 A;  2CSY A;  4L7X A;  4AP4 A;  1DVP A;  2BAY A;  2KFT A;  2VPD A;  5B78 A;  2LXH C;  3DPL R;  4I7D A;  2QIZ A;  2K17 A;  2XEU A;  2MT5 A;  5LKZ A;  5J3X A;  2MA5 A;  2UZG A;  2NAA A;  4GND A;  2K16 A;  5TBN A;  2K1J A;  2L5U A;  1WEN A;  2KWO A;  3GL6 A;  4FO9 A;  1VFY A;  5TDR A;  2MNY A;  4YAB A;  1VYX A;  2QJ0 A;  2F42 A;  4YAX A;  2L0B A;  2YW8 A;  1WEV A;  3KQI A;  2JRJ A;  4GNG A;  5DIN A;  2G6Q A;  3N9M A;  4YC9 A;  5G04 B;  1X4I A;  2QIC A;  2M3H A;  2YQL A;  4MVT A;  4I7B A;  4X3G A;  5AIT A;  4AVX A;  3LQH A;  4S3O B;  4WZ3 B;  2H0D A;  1N87 A;  2MA6 A;  1X4U A;  3ZTG A;  3EB5 A;  2YQM A;  3N9L A;  1WIM A;  5H9M A;  4YAT A;  2FUU A;  2H0D B;  1WE9 A;  3L1Z B;  2YUC A;  3SOX A;  5KH3 A;  4UP5 A;  3ZPV E;  4CCG X;  2LV9 A;  1HYI A;  3U5N A;  3KV5 A;  5G05 B;  4N3W A;  2Y43 A;  2CSZ A;  2E6R A;  2CKL A;  1Z2Q A;  2MD7 B;  4WA6 A;  5C13 A;  2AN6 A;  1LDK C;  2C2L A;  1Z6U A;  2LGK A;  2LDR A;  2YRE A;  4FIP A;  5AIU A;  5DKA A;  4GB0 A;  4I7C A;  1JM7 A;  3U5O A;  2M85 A;  2CKL B;  1WEW A;  3C5K A;  1MM3 A;  2ECV A;  2OXQ C;  5B79 A;  2VNF A;  2LGG A;  4TKP B;  1ZBD B;  1RMD A;  2KWJ A;  4ZDT A;  2M6M A;  3HCU A;  1JM7 B;  2MIQ A;  3M62 A;  2L75 A;  5EYA F;  1Z60 A;  4LAD B;  3U5M A;  2LXP C;  4YBS A;  4UP0 A;  4ZUX U;  3HTK C;  2RI7 A;  4QF3 A;  2F6N A;  4AUQ B;  1LDJ B;  2YUR A;  1IYM A;  4GNF A;  4WZ2 A;  5B8D A;  2ECT A;  3LQI A;  1XWH A;  3O36 A;  2DX8 A;  2YT5 A;  4UI9 B;  4FJC A;  4PPE A;  2VPB A;  1FBV A;  2LRI C;  3FL2 A;  4BHW A;  3VK6 A;  2JMI A;  4N4F A;  3N9N A;  3HCS A;  2M1R A;  2ECW A;  5B76 A;  4S3O C;  4YAD A;  3N9Q A;  3N9O A;  4L58 A;  2LGL A;  4LK9 A;  1WFK A;  2L43 A;  4A4B A;  2K4D A;  2KR4 A;  4IC3 A;  3RPG B;  2KE1 A;  3O35 A;  5G0F A;  4B7Y C;  3DQV R;  2YHO A;  3MHS A;  2KWN A;  2XB1 A;  2KU3 A;  2VPE A;  1WEM A;  2FSA A;  4FK5 A;  1E4U A;  4W4U A;  2KGG A;  2ECJ A;  2LN0 A;  1V87 A;  1WEE A;  3MHH A;  2D8S A;  2EA6 A;  3T7L A;  3N9P A;  3O33 A;  2LQ6 A; 
#chains in the Genus database with same CATH topology
 2ECI A;  3KNV A;  4Q6F A;  2CT2 A;  2RR4 A;  1BOR A;  3LJU X;  1JOC A;  4F52 B;  5H1U A;  2KYU A;  3GV4 A;  2YSJ A;  3FM8 C;  5FB0 A;  4OGC A;  3LDY A;  5TDW A;  5C11 A;  2Y1N A;  2EXU A;  5LKT A;  3H7H A;  2KGI A;  1FP0 A;  3O37 A;  5TAB A;  2HDP A;  3PUR A;  5H1V A;  2JMJ A;  3ASL A;  5I3L A;  3SOW A;  2I50 A;  5LCW B;  2KRE A;  3T6R A;  3PHD A;  1WES A;  1X4J A;  2RSD A;  2F6J A;  4BBQ A;  3LQJ A;  5JG6 A;  5D1L B;  4V3K C;  3U5P A;  2ZET C;  4B86 C;  1WEQ A;  1WIL A;  1WEU A;  1VD4 A;  3ZYQ A;  3L1X A;  2JMD A;  4ZQL A;  3O70 A;  4MSX A;  2KWK A;  3EB6 A;  2XOY A;  4A49 A;  2FFW A;  2C2V S;  2MD8 C;  3QZV A;  1HYJ A;  2P57 A;  3DDT A;  5B77 A;  5D1M B;  1F62 A;  1MM2 A;  2VJE A;  4P5O B;  4OGE A;  2ECG A;  2YSM A;  2L80 A;  2HYE D;  4LKA A;  4PTB A;  3RPG C;  2VJF A;  2JM3 A;  2Y1M A;  5D1K B;  4V3L C;  2YVR A;  4WZ0 A;  2G45 A;  3HCT A;  2ECN A;  3RTR B;  4XI1 A;  1U6G B;  3NG2 A;  2VJE B;  2LGV A;  1K2F A;  2CSV A;  4AYC A;  2VP7 A;  4A4C A;  1WGM A;  2VJF B;  2EOD A;  4O64 A;  2G43 A;  5FER A;  3SOU A;  2IDA A;  1WEP A;  5TRB A;  3ZNI A;  4GNE A;  3LVR E;  3ZVY A;  4AYC B;  4R2Y A;  5B75 A;  2E6S A;  3O34 A;  2M13 A;  4YBM A;  4C9Z A;  3I2D A;  3ZVZ B;  2MUM A;  4LJN A;  2LAU A;  5KH7 A;  5LKX A;  5LKU A;  2YHN A;  2FUI A;  1CHC A;  2XP0 A;  2YYR A;  2PNX A;  4LLB A;  4IC2 A;  2VPG A;  1WEO A;  3M99 A;  2KIZ A;  4YBT A;  2DJA A;  4R8P K;  1T1H A;  4QF2 A;  1G25 A;  3O7A A;  5FEY A;  5H1T A;  4R7E A;  3V43 A;  3E2D A;  3LRQ A;  4Z0R A;  3ZPV 1;  4Z0O A;  3C6W A;  4CA1 A;  3IHP A;  4NN2 A;  3DWD A;  3SHB A;  5FB1 A;  2PUY A;  2YU4 A;  2CRR A;  2MNZ A;  5KH9 A;  3L11 A;  4A0C D;  1MBM A;  3PUQ A;  2EGP A;  3KV6 A;  3M63 A;  2CSY A;  4L7X A;  4AP4 A;  1DVP A;  2BAY A;  2KFT A;  2VPD A;  3FJU B;  3SUB A;  5B78 A;  2LXH C;  3DPL R;  4I7D A;  2QIZ A;  2K17 A;  2XEU A;  2MT5 A;  3LVQ E;  5LKZ A;  5J3X A;  2MA5 A;  2UZG A;  3M7K A;  2NAA A;  4GND A;  2K16 A;  5TBN A;  2K1J A;  2L5U A;  1WEN A;  2KWO A;  3FEH A;  3GL6 A;  4FO9 A;  1VFY A;  5TDR A;  2MNY A;  4YAB A;  4H9D A;  1VYX A;  2CON A;  4F1P A;  2QJ0 A;  2F42 A;  4YAX A;  2L0B A;  2YW8 A;  1WEV A;  3KQI A;  2JRJ A;  4GNG A;  5DIN A;  2G6Q A;  3N9M A;  4YC9 A;  5G04 B;  2IQJ A;  1X4I A;  2QIC A;  2M3H A;  3Q1D A;  2YQL A;  4MVT A;  4I7B A;  4X3G A;  5AIT A;  4AVX A;  3LQH A;  3T9K A;  4S3O B;  4WZ3 B;  2H0D A;  1N87 A;  2MA6 A;  2FD4 A;  1X4U A;  3ZTG A;  3EB5 A;  2YQM A;  2XOC A;  3N9L A;  1WIM A;  5H9M A;  3PLW A;  4YAT A;  2FUU A;  2H0D B;  1WE9 A;  3L1Z B;  2YUC A;  5SVX A;  3SOX A;  5KH3 A;  4UP5 A;  3ZPV E;  4CCG X;  2LV9 A;  3KDE C;  1HYI A;  3U5N A;  3KV5 A;  5G05 B;  4N3W A;  2Y43 A;  1DCQ A;  2CSZ A;  2E6R A;  2CKL A;  1Z2Q A;  2MD7 B;  3O47 A;  4WA6 A;  5C13 A;  2AN6 A;  1LDK C;  2C2L A;  1Z6U A;  2LGK A;  2LDR A;  2YRE A;  2D8U A;  4FIP A;  5AIU A;  5DKA A;  4GB0 A;  4I7C A;  1JM7 A;  3U5O A;  2DSM A;  2M85 A;  2CKL B;  1WEW A;  3C5K A;  1MM3 A;  2ECV A;  2OXQ C;  5B79 A;  2VNF A;  2LGG A;  4TKP B;  1ZBD B;  1RMD A;  2KWJ A;  4ZDT A;  3FAO A;  2M6M A;  3HCU A;  1JM7 B;  2MIQ A;  3M62 A;  2L75 A;  5EYA F;  1Z60 A;  4LAD B;  3U5M A;  2LXP C;  2L7P A;  4YBS A;  4UP0 A;  4ZUX U;  3HTK C;  2RI7 A;  4QF3 A;  2F6N A;  4AUQ B;  2E61 A;  1LDJ B;  4QQ4 A;  2MKE A;  2YUR A;  1IYM A;  4GNF A;  2XOZ A;  4WZ2 A;  5B8D A;  2ECT A;  2JUN A;  3LQI A;  1XWH A;  3O36 A;  2DX8 A;  2YT5 A;  4UI9 B;  2EGM A;  3JUE A;  4FJC A;  4PPE A;  2VPB A;  5SVI A;  1FBV A;  2LRI C;  3FL2 A;  4BHW A;  3VK6 A;  2JMI A;  4N4F A;  3N9N A;  3HCS A;  2M1R A;  5SVY A;  2ECW A;  5B76 A;  4S3O C;  4YAD A;  3N9Q A;  3N9O A;  4L58 A;  2LGL A;  4LK9 A;  1WFK A;  2L43 A;  5SVI B;  2K4D A;  4A4B A;  2KR4 A;  4IC3 A;  3RPG B;  2KE1 A;  3O35 A;  5G0F A;  4B7Y C;  3DQV R;  2YHO A;  3MHS A;  2KWN A;  2XB1 A;  2KU3 A;  4O62 A;  2VPE A;  1WEM A;  2KKY A;  2FSA A;  4FK5 A;  1E4U A;  3FAN A;  4W4U A;  2KGG A;  2ECJ A;  2LN0 A;  2OWA A;  2B0O E;  1V87 A;  1WEE A;  3MDB C;  3MHH A;  2D8S A;  2EA6 A;  2KKX A;  3T7L A;  5K3Q A;  3N9P A;  3O33 A;  2LQ6 A;  2CRW A; 
#chains in the Genus database with same CATH homology
 2ECI A;  3KNV A;  4Q6F A;  2CT2 A;  1BOR A;  1JOC A;  4F52 B;  5H1U A;  2KYU A;  3GV4 A;  2YSJ A;  5FB0 A;  5TDW A;  5C11 A;  2Y1N A;  5LKT A;  2KGI A;  1FP0 A;  3O37 A;  5TAB A;  2HDP A;  3PUR A;  5H1V A;  2JMJ A;  3ASL A;  5I3L A;  3SOW A;  2I50 A;  5LCW B;  2KRE A;  3T6R A;  3PHD A;  1WES A;  1X4J A;  2RSD A;  2F6J A;  4BBQ A;  3LQJ A;  5JG6 A;  5D1L B;  4V3K C;  3U5P A;  2ZET C;  4B86 C;  1WEQ A;  1WIL A;  1WEU A;  1VD4 A;  3ZYQ A;  3L1X A;  2JMD A;  4ZQL A;  3O70 A;  4MSX A;  2KWK A;  3EB6 A;  4A49 A;  2C2V S;  2MD8 C;  3QZV A;  1HYJ A;  5B77 A;  5D1M B;  1F62 A;  1MM2 A;  2VJE A;  4P5O B;  2ECG A;  2YSM A;  2L80 A;  2HYE D;  4LKA A;  4PTB A;  3RPG C;  2VJF A;  2Y1M A;  5D1K B;  4V3L C;  4WZ0 A;  2G45 A;  3HCT A;  2ECN A;  3RTR B;  4XI1 A;  1U6G B;  3NG2 A;  2VJE B;  2LGV A;  1K2F A;  4AYC A;  2VP7 A;  4A4C A;  1WGM A;  2VJF B;  2EOD A;  4O64 A;  2G43 A;  5FER A;  3SOU A;  2IDA A;  1WEP A;  5TRB A;  3ZNI A;  4GNE A;  3ZVY A;  4AYC B;  4R2Y A;  5B75 A;  2E6S A;  3O34 A;  4YBM A;  4C9Z A;  3I2D A;  3ZVZ B;  2MUM A;  4LJN A;  5KH7 A;  5LKX A;  5LKU A;  2YHN A;  2FUI A;  1CHC A;  2YYR A;  4IC2 A;  2PNX A;  4LLB A;  2VPG A;  1WEO A;  3M99 A;  2KIZ A;  4YBT A;  4R8P K;  1T1H A;  4QF2 A;  1G25 A;  3O7A A;  5FEY A;  5H1T A;  4R7E A;  3V43 A;  3LRQ A;  3ZPV 1;  3C6W A;  4CA1 A;  3IHP A;  4NN2 A;  3SHB A;  5FB1 A;  2PUY A;  2YU4 A;  2MNZ A;  5KH9 A;  3L11 A;  4A0C D;  3PUQ A;  2EGP A;  3KV6 A;  3M63 A;  2CSY A;  4L7X A;  4AP4 A;  1DVP A;  2BAY A;  2KFT A;  2VPD A;  5B78 A;  2LXH C;  3DPL R;  4I7D A;  2QIZ A;  2K17 A;  2XEU A;  2MT5 A;  5LKZ A;  5J3X A;  2MA5 A;  2UZG A;  2NAA A;  4GND A;  2K16 A;  5TBN A;  2K1J A;  2L5U A;  1WEN A;  2KWO A;  3GL6 A;  4FO9 A;  1VFY A;  5TDR A;  2MNY A;  4YAB A;  1VYX A;  2QJ0 A;  2F42 A;  4YAX A;  2L0B A;  2YW8 A;  1WEV A;  3KQI A;  2JRJ A;  4GNG A;  5DIN A;  2G6Q A;  3N9M A;  4YC9 A;  5G04 B;  1X4I A;  2QIC A;  2M3H A;  2YQL A;  4MVT A;  4I7B A;  4X3G A;  5AIT A;  4AVX A;  3LQH A;  4S3O B;  4WZ3 B;  2H0D A;  1N87 A;  2MA6 A;  1X4U A;  3ZTG A;  3EB5 A;  2YQM A;  3N9L A;  1WIM A;  5H9M A;  4YAT A;  2FUU A;  2H0D B;  1WE9 A;  3L1Z B;  2YUC A;  3SOX A;  5KH3 A;  4UP5 A;  3ZPV E;  4CCG X;  2LV9 A;  1HYI A;  3U5N A;  3KV5 A;  5G05 B;  4N3W A;  2Y43 A;  2CSZ A;  2E6R A;  2CKL A;  1Z2Q A;  2MD7 B;  4WA6 A;  5C13 A;  2AN6 A;  1LDK C;  2C2L A;  1Z6U A;  2LGK A;  2LDR A;  2YRE A;  4FIP A;  5AIU A;  5DKA A;  4GB0 A;  4I7C A;  1JM7 A;  3U5O A;  2M85 A;  2CKL B;  1WEW A;  3C5K A;  1MM3 A;  2ECV A;  2OXQ C;  5B79 A;  2VNF A;  2LGG A;  4TKP B;  1ZBD B;  1RMD A;  2KWJ A;  4ZDT A;  2M6M A;  3HCU A;  1JM7 B;  2MIQ A;  3M62 A;  2L75 A;  5EYA F;  1Z60 A;  4LAD B;  3U5M A;  2LXP C;  4YBS A;  4UP0 A;  4ZUX U;  3HTK C;  2RI7 A;  4QF3 A;  2F6N A;  4AUQ B;  1LDJ B;  2YUR A;  1IYM A;  4GNF A;  4WZ2 A;  5B8D A;  2ECT A;  3LQI A;  1XWH A;  3O36 A;  2DX8 A;  2YT5 A;  4UI9 B;  4FJC A;  4PPE A;  2VPB A;  1FBV A;  2LRI C;  3FL2 A;  4BHW A;  3VK6 A;  2JMI A;  4N4F A;  3N9N A;  3HCS A;  2M1R A;  2ECW A;  5B76 A;  4S3O C;  4YAD A;  3N9Q A;  3N9O A;  4L58 A;  2LGL A;  4LK9 A;  1WFK A;  2L43 A;  4A4B A;  2K4D A;  2KR4 A;  4IC3 A;  3RPG B;  2KE1 A;  3O35 A;  5G0F A;  4B7Y C;  3DQV R;  2YHO A;  3MHS A;  2KWN A;  2XB1 A;  2KU3 A;  2VPE A;  1WEM A;  2FSA A;  4FK5 A;  1E4U A;  4W4U A;  2KGG A;  2ECJ A;  2LN0 A;  1V87 A;  1WEE A;  3MHH A;  2D8S A;  2EA6 A;  3T7L A;  3N9P A;  3O33 A;  2LQ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...