2KWOA

Solution structure of the double phd (plant homeodomain) fingers of human transcriptional protein dpf3b bound to a histone h4 peptide containing n-terminal acetylation at serine 1
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
114
structure length
114
Chain Sequence
GSYCDFCLGGSNMNKKSGRPEELVSCADCGRSGHPTCLQFTLNMTEAVKTYKWQCIECKSCILCGTSENDDQLLFCDDCDRGYHMYCLNPPVAEPPEGSWSCHLCWELLKEKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mechanism and regulation of acetylated histone binding by the tandem PHD finger of DPF3b.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Histone peptide
total genus 15
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2010-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2kwoA00
4I7DA 4A4CA 5FERA 1WEVA 2XB1A 5FB0A 3U5OA 2KWNA 1G25A 4N4FA 2ECIA 1MM2A 2CT2A 1FBVA 2Y43A 4R2YA 2ECTA 2F6NA 1WFKA 2KWJA 5C13A 2YUCA 1BORA 4L58A 2RSDA 5AITA 4B7YC 2MA6A 2CSZA 2LN0A 3ZVZB 4B86C 4BHWA 5LKTA 1VFYA 4A4BA 4IC3A 3DQVR 3EB5A 5TDRA 1WEUA 5JG6A 2VPBA 2EGPA 4XI1A 2JMIA 4X3GA 3L1XA 2ECJA 2YHNA 3KV6A 3LQJA 4AVXA 3KNVA 5H9MA 3KQIA 2MA5A 4FJCA 3C6WA 3PURA 4LJNA 2YSJA 3I2DA 5C11A 4YABA 4PPEA 4WA6A 5FEYA 1DVPA 2YHOA 3N9QA 3ZYQA 1WEPA 3U5PA 1WEEA 2QJ0A 3IHPA 5TBNA 1WEOA 4GNGA 1E4UA 2LXHC 2JRJA 3O70A 1N87A 5KH3A 4WZ0A 4FO9A 2ECVA 3ZPVE 2ECGA 4V3LC 4S3OB 3O33A 5B79A 3N9PA 3VK6A 1U6GB 2CKLB 4LKAA 1WENA 3M62A 4LK9A 1Z2QA 2KGGA 4R7EA 4C9ZA 3LQIA 2VPGA 4BBQA 5LKXA 1WEMA 3M99A 3DPLR 2K16A 4FK5A 5KH7A 3O34A 2FUIA 4AP4A 3N9NA 4FIPA 2XEUA 1WIMA 3SOUA 2VJEA 4PTBA 2M3HA 2L5UA 2MUMA 2G43A 2E6RA 3GL6A 2VJEB 1RMDA 4YATA 3O35A 5LCWB 2VJFB 2LV9A 3T7LA 1WEWA 2VP7A 5H1TA 2D8SA 4CA1A 5I3LA 5J3XA 2KWKA 4QF2A 2AN6A 5G05B 2L43A 3NG2A 2G45A 2LRIC 4YADA 1WEQA 2JMJA 2HYED 1LDKC 1WESA 4I7BA 2KWOA 1CHCA 5EYAF 2KYUA 4LADB 5LKUA 1WGMA 2F6JA 4YBMA 3RPGC 2LXPC 2ZETC 3U5MA 3SOWA 2KE1A 4ZUXU 2K1JA 4NN2A 2UZGA 5B78A 5B75A 3HTKC 1HYJA 4IC2A 1VD4A 2YT5A 2JMDA 2YURA 3EB6A 3T6RA 3O7AA 4GNFA 2MT5A 5B77A 5LKZA 2LGVA 2PUYA 2VPDA 1HYIA 5H1VA 2OXQC 3U5NA 2MNZA 4V3KC 5FB1A 3HCTA 2FSAA 2LQ6A 3MHSA 1JM7B 4GNDA 2EODA 2M85A 4A49A 3LQHA 1K2FA 4F52B 1XWHA 2YQMA 5KH9A 1FP0A 2QICA 3O37A 4MSXA 1F62A 2I50A 1X4JA 3L11A 3LRQA 2LGLA 5D1KB 3C5KA 1JM7A 3ZVYA 2KR4A 4GB0A 4UI9B 2MIQA 4QF3A 2Y1NA 4AYCB 3N9MA 5D1LB 2C2LA 2LGKA 3HCSA 1WILA 5G04B 2YW8A 3ASLA 2F42A 2L80A 1ZBDB 2G6QA 4UP0A 4Q6FA 3RPGB 4YBSA 2M1RA 4L7XA 5AIUA 4ZQLA 2HDPA 1X4UA 4LLBA 3RTRB 5G0FA 2L0BA 2MD7B 3QZVA 3M63A 3V43A 4MVTA 5TDWA 4AUQB 1X4IA 1WE9A 2YQLA 2PNXA 4WZ2A 3HCUA 5DKAA 2YSMA 1LDJB 4I7CA 3FL2A 1IYMA 2E6SA 2BAYA 2LGGA 4S3OC 3PUQA 4O64A 2CKLA 3ZPV1 1Z6UA 5DINA 1T1HA 3PHDA 3L1ZB 2FUUA 3ZNIA 4N3WA 2ECNA 2KIZA 2KREA 2H0DB 5B76A 4UP5A 5TABA 4P5OB 2KGIA 2VJFA 2DX8A 2VPEA 4AYCA 5TRBA 2KU3A 4YBTA 4ZDTA 3MHHA 4CCGX 2MD8C 4W4UA 2YREA 2RI7A 2LDRA 2EA6A 5B8DA 2NAAA 2K4DA 2IDAA 2Y1MA 4WZ3B 2YYRA 3N9OA 3ZTGA 3KV5A 2K17A 2C2VS 4YC9A 4R8PK 4YAXA 2QIZA 2H0DA 2VNFA 4A0CD 2KFTA 1MM3A 2ECWA 3SHBA 5H1UA 2YU4A 1VYXA 4GNEA 2L75A 2MNYA 2CSYA 1V87A 4TKPB 5D1MB 3N9LA 1Z60A 3SOXA 3O36A 2M6MA 1JOCA 3GV4A
chains in the Genus database with same CATH superfamily
4I7DA 4A4CA 5FERA 1WEVA 2XB1A 5FB0A 3U5OA 2KWNA 1G25A 4N4FA 2ECIA 1MM2A 2FD4A 2CT2A 1FBVA 2Y43A 4R2YA 3H7HA 2ECTA 2F6NA 1WFKA 2KWJA 5C13A 2YUCA 2FFWA 1BORA 4L58A 2RSDA 5AITA 4B7YC 2MA6A 2CSZA 2LN0A 2XOZA 3ZVZB 4F1PA 4B86C 4BHWA 5LKTA 1VFYA 4A4BA 3FAOA 4IC3A 3DQVR 3EB5A 5TDRA 1WEUA 5JG6A 2VPBA 2EGPA 4XI1A 2JMIA 2CRWA 3PLWA 4X3GA 3L1XA 2ECJA 2XP0A 2YHNA 3KV6A 3LQJA 4AVXA 3KNVA 5H9MA 3KQIA 2MA5A 4FJCA 3C6WA 3PURA 4LJNA 2YSJA 5SVYA 2D8UA 3I2DA 5C11A 4YABA 4PPEA 4WA6A 5FEYA 1DVPA 2YHOA 3N9QA 3ZYQA 1WEPA 3U5PA 1WEEA 2QJ0A 3IHPA 5TBNA 1WEOA 4GNGA 1E4UA 2LXHC 2JRJA 3O70A 1N87A 5KH3A 2RR4A 5SVXA 4WZ0A 4FO9A 2ECVA 3ZPVE 2ECGA 4V3LC 4S3OB 3O33A 2KKXA 5B79A 3N9PA 3T9KA 3VK6A 1U6GB 2CKLB 4LKAA 2IQJA 2P57A 1WENA 3M62A 4LK9A 2M13A 1Z2QA 2KGGA 4R7EA 4C9ZA 5SVIB 3LQIA 2VPGA 4BBQA 5LKXA 1WEMA 3M99A 3DPLR 2K16A 4FK5A 5KH7A 3O34A 2FUIA 4AP4A 4O62A 3N9NA 4FIPA 2XEUA 1WIMA 3SOUA 2VJEA 4PTBA 2CSVA 2M3HA 2L5UA 2XOCA 2DJAA 2MUMA 2G43A 2E6RA 3GL6A 2VJEB 2EXUA 1RMDA 4YATA 3O35A 5LCWB 2VJFB 2CRRA 2LV9A 1WEWA 2VP7A 3T7LA 5H1TA 2D8SA 4CA1A 5I3LA 5J3XA 2KWKA 3O47A 3LVQE 4QF2A 2AN6A 4Z0OA 5G05B 2L43A 3NG2A 2G45A 2LRIC 4YADA 3MDBC 1WEQA 2JMJA 2HYED 2KKYA 3DDTA 1LDKC 1WESA 4I7BA 2KWOA 1CHCA 5EYAF 2KYUA 4LADB 5LKUA 1WGMA 2F6JA 4YBMA 2L7PA 3RPGC 1MBMA 2LXPC 2ZETC 3U5MA 3SOWA 2KE1A 2YVRA 4ZUXU 2K1JA 4NN2A 2UZGA 5B78A 5B75A 2OWAA 3HTKC 1HYJA 4IC2A 1VD4A 2YT5A 2JMDA 2YURA 3LDYA 3EB6A 3T6RA 3O7AA 4GNFA 2MT5A 5B77A 5LKZA 2LGVA 2JM3A 2PUYA 2VPDA 1HYIA 5H1VA 2OXQC 3U5NA 2MNZA 4V3KC 2MKEA 5FB1A 3HCTA 2FSAA 2LQ6A 3MHSA 1JM7B 4GNDA 2EODA 2M85A 4A49A 3LQHA 1K2FA 4F52B 1XWHA 1DCQA 2YQMA 5KH9A 1FP0A 2QICA 3FANA 3O37A 4MSXA 1F62A 2I50A 3SUBA 1X4JA 3L11A 3LRQA 3JUEA 2LGLA 5D1KB 3C5KA 1JM7A 3ZVYA 2KR4A 4GB0A 4UI9B 2MIQA 4QF3A 2Y1NA 3E2DA 4AYCB 2B0OE 3N9MA 5D1LB 2C2LA 5SVIA 2JUNA 2LGKA 3HCSA 1WILA 5G04B 3KDEC 2YW8A 3ASLA 2F42A 2EGMA 2L80A 1ZBDB 2G6QA 4UP0A 4Q6FA 3RPGB 4YBSA 2M1RA 4L7XA 2LAUA 5AIUA 4ZQLA 2HDPA 1X4UA 2DSMA 4LLBA 3RTRB 5G0FA 2L0BA 2MD7B 3QZVA 3M63A 3V43A 4MVTA 5TDWA 4AUQB 1X4IA 1WE9A 2YQLA 2PNXA 3FM8C 4WZ2A 3HCUA 5DKAA 2YSMA 1LDJB 4OGEA 4I7CA 3FL2A 1IYMA 2E6SA 2BAYA 2LGGA 3LJUX 3PUQA 4S3OC 4O64A 4OGCA 2CKLA 3ZPV1 1Z6UA 5DINA 1T1HA 3PHDA 3L1ZB 2FUUA 3ZNIA 4N3WA 4QQ4A 2ECNA 2KIZA 2KREA 2H0DB 5B76A 4UP5A 5TABA 4P5OB 2KGIA 4H9DA 2VJFA 2DX8A 2VPEA 4AYCA 5TRBA 2KU3A 2E61A 4YBTA 4ZDTA 3MHHA 4CCGX 2MD8C 4W4UA 4Z0RA 2YREA 2RI7A 2LDRA 2EA6A 5B8DA 2NAAA 2K4DA 3M7KA 2IDAA 2Y1MA 4WZ3B 2YYRA 3N9OA 3KV5A 3ZTGA 2K17A 2C2VS 5K3QA 2CONA 4YC9A 4R8PK 4YAXA 2QIZA 2H0DA 3DWDA 2VNFA 4A0CD 2KFTA 1MM3A 2ECWA 3FEHA 3SHBA 5H1UA 2YU4A 3Q1DA 1VYXA 4GNEA 2L75A 2MNYA 2CSYA 3FJUB 3LVRE 1V87A 4TKPB 5D1MB 3N9LA 1Z60A 3SOXA 3O36A 2M6MA 1JOCA 3GV4A 2XOYA
chains in the Genus database with same CATH topology
4I7DA 4A4CA 5FERA 1WEVA 2XB1A 5FB0A 3U5OA 2KWNA 1G25A 4N4FA 2ECIA 1MM2A 2CT2A 1FBVA 2Y43A 4R2YA 2ECTA 2F6NA 1WFKA 2KWJA 5C13A 2YUCA 1BORA 4L58A 2RSDA 5AITA 4B7YC 2MA6A 2CSZA 2LN0A 3ZVZB 4B86C 4BHWA 5LKTA 1VFYA 4A4BA 4IC3A 3DQVR 3EB5A 5TDRA 1WEUA 5JG6A 2VPBA 2EGPA 4XI1A 2JMIA 4X3GA 3L1XA 2ECJA 2YHNA 3KV6A 3LQJA 4AVXA 3KNVA 5H9MA 3KQIA 2MA5A 4FJCA 3C6WA 3PURA 4LJNA 2YSJA 3I2DA 5C11A 4YABA 4PPEA 4WA6A 5FEYA 1DVPA 2YHOA 3N9QA 3ZYQA 1WEPA 3U5PA 1WEEA 2QJ0A 3IHPA 5TBNA 1WEOA 4GNGA 1E4UA 2LXHC 2JRJA 3O70A 1N87A 5KH3A 4WZ0A 4FO9A 2ECVA 3ZPVE 2ECGA 4V3LC 4S3OB 3O33A 5B79A 3N9PA 3VK6A 1U6GB 2CKLB 4LKAA 1WENA 3M62A 4LK9A 1Z2QA 2KGGA 4R7EA 4C9ZA 3LQIA 2VPGA 4BBQA 5LKXA 1WEMA 3M99A 3DPLR 2K16A 4FK5A 5KH7A 3O34A 2FUIA 4AP4A 3N9NA 4FIPA 2XEUA 1WIMA 3SOUA 2VJEA 4PTBA 2M3HA 2L5UA 2MUMA 2G43A 2E6RA 3GL6A 2VJEB 1RMDA 4YATA 3O35A 5LCWB 2VJFB 2LV9A 3T7LA 1WEWA 2VP7A 5H1TA 2D8SA 4CA1A 5I3LA 5J3XA 2KWKA 4QF2A 2AN6A 5G05B 2L43A 3NG2A 2G45A 2LRIC 4YADA 1WEQA 2JMJA 2HYED 1LDKC 1WESA 4I7BA 2KWOA 1CHCA 5EYAF 2KYUA 4LADB 5LKUA 1WGMA 2F6JA 4YBMA 3RPGC 2LXPC 2ZETC 3U5MA 3SOWA 2KE1A 4ZUXU 2K1JA 4NN2A 2UZGA 5B78A 5B75A 3HTKC 1HYJA 4IC2A 1VD4A 2YT5A 2JMDA 2YURA 3EB6A 3T6RA 3O7AA 4GNFA 2MT5A 5B77A 5LKZA 2LGVA 2PUYA 2VPDA 1HYIA 5H1VA 2OXQC 3U5NA 2MNZA 4V3KC 5FB1A 3HCTA 2FSAA 2LQ6A 3MHSA 1JM7B 4GNDA 2EODA 2M85A 4A49A 3LQHA 1K2FA 4F52B 1XWHA 2YQMA 5KH9A 1FP0A 2QICA 3O37A 4MSXA 1F62A 2I50A 1X4JA 3L11A 3LRQA 2LGLA 5D1KB 3C5KA 1JM7A 3ZVYA 2KR4A 4GB0A 4UI9B 2MIQA 4QF3A 2Y1NA 4AYCB 3N9MA 5D1LB 2C2LA 2LGKA 3HCSA 1WILA 5G04B 2YW8A 3ASLA 2F42A 2L80A 1ZBDB 2G6QA 4UP0A 4Q6FA 3RPGB 4YBSA 2M1RA 4L7XA 5AIUA 4ZQLA 2HDPA 1X4UA 4LLBA 3RTRB 5G0FA 2L0BA 2MD7B 3QZVA 3M63A 3V43A 4MVTA 5TDWA 4AUQB 1X4IA 1WE9A 2YQLA 2PNXA 4WZ2A 3HCUA 5DKAA 2YSMA 1LDJB 4I7CA 3FL2A 1IYMA 2E6SA 2BAYA 2LGGA 4S3OC 3PUQA 4O64A 2CKLA 3ZPV1 1Z6UA 5DINA 1T1HA 3PHDA 3L1ZB 2FUUA 3ZNIA 4N3WA 2ECNA 2KIZA 2KREA 2H0DB 5B76A 4UP5A 5TABA 4P5OB 2KGIA 2VJFA 2DX8A 2VPEA 4AYCA 5TRBA 2KU3A 4YBTA 4ZDTA 3MHHA 4CCGX 2MD8C 4W4UA 2YREA 2RI7A 2LDRA 2EA6A 5B8DA 2NAAA 2K4DA 2IDAA 2Y1MA 4WZ3B 2YYRA 3N9OA 3ZTGA 3KV5A 2K17A 2C2VS 4YC9A 4R8PK 4YAXA 2QIZA 2H0DA 2VNFA 4A0CD 2KFTA 1MM3A 2ECWA 3SHBA 5H1UA 2YU4A 1VYXA 4GNEA 2L75A 2MNYA 2CSYA 1V87A 4TKPB 5D1MB 3N9LA 1Z60A 3SOXA 3O36A 2M6MA 1JOCA 3GV4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I7D A;  4A4C A;  5FER A;  1WEV A;  2XB1 A;  5FB0 A;  3U5O A;  2KWN A;  1G25 A;  4N4F A;  2ECI A;  1MM2 A;  2CT2 A;  1FBV A;  2Y43 A;  4R2Y A;  2ECT A;  2F6N A;  1WFK A;  2KWJ A;  5C13 A;  2YUC A;  1BOR A;  4L58 A;  2RSD A;  5AIT A;  4B7Y C;  2MA6 A;  2CSZ A;  2LN0 A;  3ZVZ B;  4B86 C;  4BHW A;  5LKT A;  1VFY A;  4A4B A;  4IC3 A;  3DQV R;  3EB5 A;  5TDR A;  1WEU A;  5JG6 A;  2VPB A;  2EGP A;  4XI1 A;  2JMI A;  4X3G A;  3L1X A;  2ECJ A;  2YHN A;  3KV6 A;  3LQJ A;  4AVX A;  3KNV A;  5H9M A;  3KQI A;  2MA5 A;  4FJC A;  3C6W A;  3PUR A;  4LJN A;  2YSJ A;  3I2D A;  5C11 A;  4YAB A;  4PPE A;  4WA6 A;  5FEY A;  1DVP A;  2YHO A;  3N9Q A;  3ZYQ A;  1WEP A;  3U5P A;  1WEE A;  2QJ0 A;  3IHP A;  5TBN A;  1WEO A;  4GNG A;  1E4U A;  2LXH C;  2JRJ A;  3O70 A;  1N87 A;  5KH3 A;  4WZ0 A;  4FO9 A;  2ECV A;  3ZPV E;  2ECG A;  4V3L C;  4S3O B;  3O33 A;  5B79 A;  3N9P A;  3VK6 A;  1U6G B;  2CKL B;  4LKA A;  1WEN A;  3M62 A;  4LK9 A;  1Z2Q A;  2KGG A;  4R7E A;  4C9Z A;  3LQI A;  2VPG A;  4BBQ A;  5LKX A;  1WEM A;  3M99 A;  3DPL R;  2K16 A;  4FK5 A;  5KH7 A;  3O34 A;  2FUI A;  4AP4 A;  3N9N A;  4FIP A;  2XEU A;  1WIM A;  3SOU A;  2VJE A;  4PTB A;  2M3H A;  2L5U A;  2MUM A;  2G43 A;  2E6R A;  3GL6 A;  2VJE B;  1RMD A;  4YAT A;  3O35 A;  5LCW B;  2VJF B;  2LV9 A;  3T7L A;  1WEW A;  2VP7 A;  5H1T A;  2D8S A;  4CA1 A;  5I3L A;  5J3X A;  2KWK A;  4QF2 A;  2AN6 A;  5G05 B;  2L43 A;  3NG2 A;  2G45 A;  2LRI C;  4YAD A;  1WEQ A;  2JMJ A;  2HYE D;  1LDK C;  1WES A;  4I7B A;  2KWO A;  1CHC A;  5EYA F;  2KYU A;  4LAD B;  5LKU A;  1WGM A;  2F6J A;  4YBM A;  3RPG C;  2LXP C;  2ZET C;  3U5M A;  3SOW A;  2KE1 A;  4ZUX U;  2K1J A;  4NN2 A;  2UZG A;  5B78 A;  5B75 A;  3HTK C;  1HYJ A;  4IC2 A;  1VD4 A;  2YT5 A;  2JMD A;  2YUR A;  3EB6 A;  3T6R A;  3O7A A;  4GNF A;  2MT5 A;  5B77 A;  5LKZ A;  2LGV A;  2PUY A;  2VPD A;  1HYI A;  5H1V A;  2OXQ C;  3U5N A;  2MNZ A;  4V3K C;  5FB1 A;  3HCT A;  2FSA A;  2LQ6 A;  3MHS A;  1JM7 B;  4GND A;  2EOD A;  2M85 A;  4A49 A;  3LQH A;  1K2F A;  4F52 B;  1XWH A;  2YQM A;  5KH9 A;  1FP0 A;  2QIC A;  3O37 A;  4MSX A;  1F62 A;  2I50 A;  1X4J A;  3L11 A;  3LRQ A;  2LGL A;  5D1K B;  3C5K A;  1JM7 A;  3ZVY A;  2KR4 A;  4GB0 A;  4UI9 B;  2MIQ A;  4QF3 A;  2Y1N A;  4AYC B;  3N9M A;  5D1L B;  2C2L A;  2LGK A;  3HCS A;  1WIL A;  5G04 B;  2YW8 A;  3ASL A;  2F42 A;  2L80 A;  1ZBD B;  2G6Q A;  4UP0 A;  4Q6F A;  3RPG B;  4YBS A;  2M1R A;  4L7X A;  5AIU A;  4ZQL A;  2HDP A;  1X4U A;  4LLB A;  3RTR B;  5G0F A;  2L0B A;  2MD7 B;  3QZV A;  3M63 A;  3V43 A;  4MVT A;  5TDW A;  4AUQ B;  1X4I A;  1WE9 A;  2YQL A;  2PNX A;  4WZ2 A;  3HCU A;  5DKA A;  2YSM A;  1LDJ B;  4I7C A;  3FL2 A;  1IYM A;  2E6S A;  2BAY A;  2LGG A;  4S3O C;  3PUQ A;  4O64 A;  2CKL A;  3ZPV 1;  1Z6U A;  5DIN A;  1T1H A;  3PHD A;  3L1Z B;  2FUU A;  3ZNI A;  4N3W A;  2ECN A;  2KIZ A;  2KRE A;  2H0D B;  5B76 A;  4UP5 A;  5TAB A;  4P5O B;  2KGI A;  2VJF A;  2DX8 A;  2VPE A;  4AYC A;  5TRB A;  2KU3 A;  4YBT A;  4ZDT A;  3MHH A;  4CCG X;  2MD8 C;  4W4U A;  2YRE A;  2RI7 A;  2LDR A;  2EA6 A;  5B8D A;  2NAA A;  2K4D A;  2IDA A;  2Y1M A;  4WZ3 B;  2YYR A;  3N9O A;  3ZTG A;  3KV5 A;  2K17 A;  2C2V S;  4YC9 A;  4R8P K;  4YAX A;  2QIZ A;  2H0D A;  2VNF A;  4A0C D;  2KFT A;  1MM3 A;  2ECW A;  3SHB A;  5H1U A;  2YU4 A;  1VYX A;  4GNE A;  2L75 A;  2MNY A;  2CSY A;  1V87 A;  4TKP B;  5D1M B;  3N9L A;  1Z60 A;  3SOX A;  3O36 A;  2M6M A;  1JOC A;  3GV4 A; 
#chains in the Genus database with same CATH topology
 4I7D A;  4A4C A;  5FER A;  1WEV A;  2XB1 A;  5FB0 A;  3U5O A;  2KWN A;  1G25 A;  4N4F A;  2ECI A;  1MM2 A;  2FD4 A;  2CT2 A;  1FBV A;  2Y43 A;  4R2Y A;  3H7H A;  2ECT A;  2F6N A;  1WFK A;  2KWJ A;  5C13 A;  2YUC A;  2FFW A;  1BOR A;  4L58 A;  2RSD A;  5AIT A;  4B7Y C;  2MA6 A;  2CSZ A;  2LN0 A;  2XOZ A;  3ZVZ B;  4F1P A;  4B86 C;  4BHW A;  5LKT A;  1VFY A;  4A4B A;  3FAO A;  4IC3 A;  3DQV R;  3EB5 A;  5TDR A;  1WEU A;  5JG6 A;  2VPB A;  2EGP A;  4XI1 A;  2JMI A;  2CRW A;  3PLW A;  4X3G A;  3L1X A;  2ECJ A;  2XP0 A;  2YHN A;  3KV6 A;  3LQJ A;  4AVX A;  3KNV A;  5H9M A;  3KQI A;  2MA5 A;  4FJC A;  3C6W A;  3PUR A;  4LJN A;  2YSJ A;  5SVY A;  2D8U A;  3I2D A;  5C11 A;  4YAB A;  4PPE A;  4WA6 A;  5FEY A;  1DVP A;  2YHO A;  3N9Q A;  3ZYQ A;  1WEP A;  3U5P A;  1WEE A;  2QJ0 A;  3IHP A;  5TBN A;  1WEO A;  4GNG A;  1E4U A;  2LXH C;  2JRJ A;  3O70 A;  1N87 A;  5KH3 A;  2RR4 A;  5SVX A;  4WZ0 A;  4FO9 A;  2ECV A;  3ZPV E;  2ECG A;  4V3L C;  4S3O B;  3O33 A;  2KKX A;  5B79 A;  3N9P A;  3T9K A;  3VK6 A;  1U6G B;  2CKL B;  4LKA A;  2IQJ A;  2P57 A;  1WEN A;  3M62 A;  4LK9 A;  2M13 A;  1Z2Q A;  2KGG A;  4R7E A;  4C9Z A;  5SVI B;  3LQI A;  2VPG A;  4BBQ A;  5LKX A;  1WEM A;  3M99 A;  3DPL R;  2K16 A;  4FK5 A;  5KH7 A;  3O34 A;  2FUI A;  4AP4 A;  4O62 A;  3N9N A;  4FIP A;  2XEU A;  1WIM A;  3SOU A;  2VJE A;  4PTB A;  2CSV A;  2M3H A;  2L5U A;  2XOC A;  2DJA A;  2MUM A;  2G43 A;  2E6R A;  3GL6 A;  2VJE B;  2EXU A;  1RMD A;  4YAT A;  3O35 A;  5LCW B;  2VJF B;  2CRR A;  2LV9 A;  1WEW A;  2VP7 A;  3T7L A;  5H1T A;  2D8S A;  4CA1 A;  5I3L A;  5J3X A;  2KWK A;  3O47 A;  3LVQ E;  4QF2 A;  2AN6 A;  4Z0O A;  5G05 B;  2L43 A;  3NG2 A;  2G45 A;  2LRI C;  4YAD A;  3MDB C;  1WEQ A;  2JMJ A;  2HYE D;  2KKY A;  3DDT A;  1LDK C;  1WES A;  4I7B A;  2KWO A;  1CHC A;  5EYA F;  2KYU A;  4LAD B;  5LKU A;  1WGM A;  2F6J A;  4YBM A;  2L7P A;  3RPG C;  1MBM A;  2LXP C;  2ZET C;  3U5M A;  3SOW A;  2KE1 A;  2YVR A;  4ZUX U;  2K1J A;  4NN2 A;  2UZG A;  5B78 A;  5B75 A;  2OWA A;  3HTK C;  1HYJ A;  4IC2 A;  1VD4 A;  2YT5 A;  2JMD A;  2YUR A;  3LDY A;  3EB6 A;  3T6R A;  3O7A A;  4GNF A;  2MT5 A;  5B77 A;  5LKZ A;  2LGV A;  2JM3 A;  2PUY A;  2VPD A;  1HYI A;  5H1V A;  2OXQ C;  3U5N A;  2MNZ A;  4V3K C;  2MKE A;  5FB1 A;  3HCT A;  2FSA A;  2LQ6 A;  3MHS A;  1JM7 B;  4GND A;  2EOD A;  2M85 A;  4A49 A;  3LQH A;  1K2F A;  4F52 B;  1XWH A;  1DCQ A;  2YQM A;  5KH9 A;  1FP0 A;  2QIC A;  3FAN A;  3O37 A;  4MSX A;  1F62 A;  2I50 A;  3SUB A;  1X4J A;  3L11 A;  3LRQ A;  3JUE A;  2LGL A;  5D1K B;  3C5K A;  1JM7 A;  3ZVY A;  2KR4 A;  4GB0 A;  4UI9 B;  2MIQ A;  4QF3 A;  2Y1N A;  3E2D A;  4AYC B;  2B0O E;  3N9M A;  5D1L B;  2C2L A;  5SVI A;  2JUN A;  2LGK A;  3HCS A;  1WIL A;  5G04 B;  3KDE C;  2YW8 A;  3ASL A;  2F42 A;  2EGM A;  2L80 A;  1ZBD B;  2G6Q A;  4UP0 A;  4Q6F A;  3RPG B;  4YBS A;  2M1R A;  4L7X A;  2LAU A;  5AIU A;  4ZQL A;  2HDP A;  1X4U A;  2DSM A;  4LLB A;  3RTR B;  5G0F A;  2L0B A;  2MD7 B;  3QZV A;  3M63 A;  3V43 A;  4MVT A;  5TDW A;  4AUQ B;  1X4I A;  1WE9 A;  2YQL A;  2PNX A;  3FM8 C;  4WZ2 A;  3HCU A;  5DKA A;  2YSM A;  1LDJ B;  4OGE A;  4I7C A;  3FL2 A;  1IYM A;  2E6S A;  2BAY A;  2LGG A;  3LJU X;  3PUQ A;  4S3O C;  4O64 A;  4OGC A;  2CKL A;  3ZPV 1;  1Z6U A;  5DIN A;  1T1H A;  3PHD A;  3L1Z B;  2FUU A;  3ZNI A;  4N3W A;  4QQ4 A;  2ECN A;  2KIZ A;  2KRE A;  2H0D B;  5B76 A;  4UP5 A;  5TAB A;  4P5O B;  2KGI A;  4H9D A;  2VJF A;  2DX8 A;  2VPE A;  4AYC A;  5TRB A;  2KU3 A;  2E61 A;  4YBT A;  4ZDT A;  3MHH A;  4CCG X;  2MD8 C;  4W4U A;  4Z0R A;  2YRE A;  2RI7 A;  2LDR A;  2EA6 A;  5B8D A;  2NAA A;  2K4D A;  3M7K A;  2IDA A;  2Y1M A;  4WZ3 B;  2YYR A;  3N9O A;  3KV5 A;  3ZTG A;  2K17 A;  2C2V S;  5K3Q A;  2CON A;  4YC9 A;  4R8P K;  4YAX A;  2QIZ A;  2H0D A;  3DWD A;  2VNF A;  4A0C D;  2KFT A;  1MM3 A;  2ECW A;  3FEH A;  3SHB A;  5H1U A;  2YU4 A;  3Q1D A;  1VYX A;  4GNE A;  2L75 A;  2MNY A;  2CSY A;  3FJU B;  3LVR E;  1V87 A;  4TKP B;  5D1M B;  3N9L A;  1Z60 A;  3SOX A;  3O36 A;  2M6M A;  1JOC A;  3GV4 A;  2XOY A; 
#chains in the Genus database with same CATH homology
 4I7D A;  4A4C A;  5FER A;  1WEV A;  2XB1 A;  5FB0 A;  3U5O A;  2KWN A;  1G25 A;  4N4F A;  2ECI A;  1MM2 A;  2CT2 A;  1FBV A;  2Y43 A;  4R2Y A;  2ECT A;  2F6N A;  1WFK A;  2KWJ A;  5C13 A;  2YUC A;  1BOR A;  4L58 A;  2RSD A;  5AIT A;  4B7Y C;  2MA6 A;  2CSZ A;  2LN0 A;  3ZVZ B;  4B86 C;  4BHW A;  5LKT A;  1VFY A;  4A4B A;  4IC3 A;  3DQV R;  3EB5 A;  5TDR A;  1WEU A;  5JG6 A;  2VPB A;  2EGP A;  4XI1 A;  2JMI A;  4X3G A;  3L1X A;  2ECJ A;  2YHN A;  3KV6 A;  3LQJ A;  4AVX A;  3KNV A;  5H9M A;  3KQI A;  2MA5 A;  4FJC A;  3C6W A;  3PUR A;  4LJN A;  2YSJ A;  3I2D A;  5C11 A;  4YAB A;  4PPE A;  4WA6 A;  5FEY A;  1DVP A;  2YHO A;  3N9Q A;  3ZYQ A;  1WEP A;  3U5P A;  1WEE A;  2QJ0 A;  3IHP A;  5TBN A;  1WEO A;  4GNG A;  1E4U A;  2LXH C;  2JRJ A;  3O70 A;  1N87 A;  5KH3 A;  4WZ0 A;  4FO9 A;  2ECV A;  3ZPV E;  2ECG A;  4V3L C;  4S3O B;  3O33 A;  5B79 A;  3N9P A;  3VK6 A;  1U6G B;  2CKL B;  4LKA A;  1WEN A;  3M62 A;  4LK9 A;  1Z2Q A;  2KGG A;  4R7E A;  4C9Z A;  3LQI A;  2VPG A;  4BBQ A;  5LKX A;  1WEM A;  3M99 A;  3DPL R;  2K16 A;  4FK5 A;  5KH7 A;  3O34 A;  2FUI A;  4AP4 A;  3N9N A;  4FIP A;  2XEU A;  1WIM A;  3SOU A;  2VJE A;  4PTB A;  2M3H A;  2L5U A;  2MUM A;  2G43 A;  2E6R A;  3GL6 A;  2VJE B;  1RMD A;  4YAT A;  3O35 A;  5LCW B;  2VJF B;  2LV9 A;  3T7L A;  1WEW A;  2VP7 A;  5H1T A;  2D8S A;  4CA1 A;  5I3L A;  5J3X A;  2KWK A;  4QF2 A;  2AN6 A;  5G05 B;  2L43 A;  3NG2 A;  2G45 A;  2LRI C;  4YAD A;  1WEQ A;  2JMJ A;  2HYE D;  1LDK C;  1WES A;  4I7B A;  2KWO A;  1CHC A;  5EYA F;  2KYU A;  4LAD B;  5LKU A;  1WGM A;  2F6J A;  4YBM A;  3RPG C;  2LXP C;  2ZET C;  3U5M A;  3SOW A;  2KE1 A;  4ZUX U;  2K1J A;  4NN2 A;  2UZG A;  5B78 A;  5B75 A;  3HTK C;  1HYJ A;  4IC2 A;  1VD4 A;  2YT5 A;  2JMD A;  2YUR A;  3EB6 A;  3T6R A;  3O7A A;  4GNF A;  2MT5 A;  5B77 A;  5LKZ A;  2LGV A;  2PUY A;  2VPD A;  1HYI A;  5H1V A;  2OXQ C;  3U5N A;  2MNZ A;  4V3K C;  5FB1 A;  3HCT A;  2FSA A;  2LQ6 A;  3MHS A;  1JM7 B;  4GND A;  2EOD A;  2M85 A;  4A49 A;  3LQH A;  1K2F A;  4F52 B;  1XWH A;  2YQM A;  5KH9 A;  1FP0 A;  2QIC A;  3O37 A;  4MSX A;  1F62 A;  2I50 A;  1X4J A;  3L11 A;  3LRQ A;  2LGL A;  5D1K B;  3C5K A;  1JM7 A;  3ZVY A;  2KR4 A;  4GB0 A;  4UI9 B;  2MIQ A;  4QF3 A;  2Y1N A;  4AYC B;  3N9M A;  5D1L B;  2C2L A;  2LGK A;  3HCS A;  1WIL A;  5G04 B;  2YW8 A;  3ASL A;  2F42 A;  2L80 A;  1ZBD B;  2G6Q A;  4UP0 A;  4Q6F A;  3RPG B;  4YBS A;  2M1R A;  4L7X A;  5AIU A;  4ZQL A;  2HDP A;  1X4U A;  4LLB A;  3RTR B;  5G0F A;  2L0B A;  2MD7 B;  3QZV A;  3M63 A;  3V43 A;  4MVT A;  5TDW A;  4AUQ B;  1X4I A;  1WE9 A;  2YQL A;  2PNX A;  4WZ2 A;  3HCU A;  5DKA A;  2YSM A;  1LDJ B;  4I7C A;  3FL2 A;  1IYM A;  2E6S A;  2BAY A;  2LGG A;  4S3O C;  3PUQ A;  4O64 A;  2CKL A;  3ZPV 1;  1Z6U A;  5DIN A;  1T1H A;  3PHD A;  3L1Z B;  2FUU A;  3ZNI A;  4N3W A;  2ECN A;  2KIZ A;  2KRE A;  2H0D B;  5B76 A;  4UP5 A;  5TAB A;  4P5O B;  2KGI A;  2VJF A;  2DX8 A;  2VPE A;  4AYC A;  5TRB A;  2KU3 A;  4YBT A;  4ZDT A;  3MHH A;  4CCG X;  2MD8 C;  4W4U A;  2YRE A;  2RI7 A;  2LDR A;  2EA6 A;  5B8D A;  2NAA A;  2K4D A;  2IDA A;  2Y1M A;  4WZ3 B;  2YYR A;  3N9O A;  3ZTG A;  3KV5 A;  2K17 A;  2C2V S;  4YC9 A;  4R8P K;  4YAX A;  2QIZ A;  2H0D A;  2VNF A;  4A0C D;  2KFT A;  1MM3 A;  2ECW A;  3SHB A;  5H1U A;  2YU4 A;  1VYX A;  4GNE A;  2L75 A;  2MNY A;  2CSY A;  1V87 A;  4TKP B;  5D1M B;  3N9L A;  1Z60 A;  3SOX A;  3O36 A;  2M6M A;  1JOC A;  3GV4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...