2KWOA

Solution structure of the double phd (plant homeodomain) fingers of human transcriptional protein dpf3b bound to a histone h4 peptide containing n-terminal acetylation at serine 1
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
114
structure length
114
Chain Sequence
GSYCDFCLGGSNMNKKSGRPEELVSCADCGRSGHPTCLQFTLNMTEAVKTYKWQCIECKSCILCGTSENDDQLLFCDDCDRGYHMYCLNPPVAEPPEGSWSCHLCWELLKEKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal binding protein
molecule keywords Histone peptide
publication title Mechanism and regulation of acetylated histone binding by the tandem PHD finger of DPF3b.
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2010-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2kwoA00
4YATA 2DX8A 4V3LC 4YC9A 2YQMA 2VPGA 2LGGA 4S3OC 2XEUA 4AP4A 2QICA 5G05B 2G43A 1VD4A 5TRBA 3RTRB 2FSAA 4CA1A 1WGMA 3U5OA 3RPGB 2UZGA 4N4FA 1WEEA 4GNFA 2Y1NA 3U5PA 1E4UA 4R7EA 2RSDA 5D1KB 4IC2A 4AUQB 4ZDTA 3HCSA 5J3XA 2VJFB 5TDRA 4P5OB 2IDAA 2PNXA 2LGVA 1Z60A 2VPEA 3QZVA 2ECWA 5LKTA 4Q6FA 4WZ0A 3O70A 1WENA 4A4BA 1N87A 4CCGX 3SOWA 3HTKC 2YHOA 4R2YA 5H1VA 4UP5A 4GNDA 1Z6UA 2Y1MA 5KH9A 4QF3A 2M6MA 2C2VS 4MSXA 3U5NA 2EA6A 4B7YC 2FUUA 1ZBDB 1HYJA 3O36A 3LRQA 2M1RA 2VJFA 1G25A 3N9PA 2L43A 4C9ZA 3O35A 3MHHA 4LLBA 1JOCA 1WESA 2ECTA 3O7AA 2YREA 3T6RA 1WILA 3M62A 5JG6A 4PTBA 4GB0A 4L58A 5TBNA 2XB1A 5I3LA 3NG2A 3L1ZB 4YBTA 4I7BA 2KGGA 5KH7A 4S3OB 1FBVA 2Y43A 4TKPB 4I7DA 3U5MA 4GNEA 2LGLA 5H1TA 2HDPA 2K17A 4NN2A 1WIMA 4LADB 2CKLA 3ZPV1 2YSMA 1X4JA 2YSJA 3N9OA 4WZ2A 5LKZA 2F6JA 5H9MA 2KWKA 2L75A 2YW8A 4V3KC 1RMDA 1DVPA 3N9NA 2E6SA 2YYRA 2KWJA 2L80A 3ZVZB 2JRJA 1F62A 2YHNA 5B77A 5KH3A 2LRIC 2LGKA 1V87A 3DQVR 3ASLA 4LKAA 3T7LA 2KYUA 5LCWB 1FP0A 5LKXA 1LDKC 4FO9A 2ECNA 3KQIA 3EB6A 4BBQA 2YT5A 2JMIA 3L1XA 3O37A 2G45A 1Z2QA 2MT5A 2G6QA 1BORA 3SOXA 2H0DA 4X3GA 3LQIA 1JM7B 3M99A 5G04B 2ECGA 2MD7B 4AYCA 2KWNA 2MUMA 1WEUA 1X4IA 4WZ3B 2YU4A 4FJCA 1WEOA 2EGPA 2CKLB 2LXPC 5B8DA 2L0BA 5G0FA 2ECIA 3C5KA 4YBSA 1WEVA 2ECVA 2KFTA 3HCTA 5FERA 4LK9A 3O34A 1HYIA 2KIZA 2QJ0A 4YADA 4F52B 2F42A 2BAYA 5FB1A 1CHCA 3M63A 1JM7A 4YABA 1LDJB 3ZTGA 5B76A 2MNYA 5H1UA 2CSZA 3KNVA 4L7XA 2JMDA 1U6GB 2VPBA 2KU3A 4FIPA 1WFKA 1XWHA 3KV5A 2JMJA 1IYMA 1X4UA 3PURA 4A0CD 2K16A 2LDRA 3PHDA 2KWOA 2L5UA 2FUIA 3ZVYA 5C11A 5D1MB 4ZUXU 5FB0A 2YURA 2ZETC 2MA5A 2VJEA 2OXQC 1WEMA 2QIZA 1WEPA 4QF2A 4I7CA 2H0DB 4R8PK 3LQHA 4IC3A 5AIUA 5TDWA 4AYCB 5EYAF 5DKAA 3C6WA 3KV6A 4N3WA 3ZPVE 3SHBA 2F6NA 3MHSA 2HYED 3V43A 4PPEA 5D1LB 2EODA 4UI9B 3IHPA 2LN0A 2I50A 2AN6A 1VFYA 2LXHC 4B86C 2YUCA 3N9MA 3SOUA 4FK5A 3RPGC 5TABA 1VYXA 4W4UA 4MVTA 3L11A 2CT2A 3FL2A 3GV4A 3N9LA 3N9QA 2NAAA 4XI1A 2CSYA 2MIQA 1MM3A 5DINA 3ZNIA 2MA6A 5B79A 3EB5A 2VP7A 3LQJA 5LKUA 2MD8C 4A49A 3HCUA 1T1HA 2VJEB 1WE9A 2K1JA 2KR4A 3O33A 5AITA 4AVXA 4YBMA 5FEYA 2KGIA 5C13A 2VPDA 4UP0A 2LQ6A 3I2DA 3GL6A 3VK6A 2MNZA 5B75A 4A4CA 4LJNA 1MM2A 1WEWA 1K2FA 4BHWA 4WA6A 4O64A 4YAXA 1WEQA 2M3HA 2YQLA 2E6RA 2KE1A 4GNGA 2PUYA 4ZQLA 2C2LA 2D8SA 2K4DA 2LV9A 2KREA 2VNFA 3PUQA 2ECJA 3ZYQA 5B78A 2M85A 3DPLR 2RI7A
chains in the Genus database with same CATH superfamily
4YATA 2DX8A 4V3LC 4YC9A 2YQMA 2VPGA 2LGGA 4S3OC 2XEUA 2EXUA 4AP4A 2QICA 5G05B 2G43A 1VD4A 5TRBA 3RTRB 2FSAA 4CA1A 1WGMA 3U5OA 3RPGB 2UZGA 3JUEA 4N4FA 1WEEA 4GNFA 2Y1NA 3U5PA 1E4UA 4R7EA 2RSDA 5SVYA 5D1KB 4IC2A 4AUQB 4ZDTA 3HCSA 4F1PA 2KKYA 5J3XA 2VJFB 5TDRA 2KKXA 4P5OB 5SVIB 2IDAA 2PNXA 2LGVA 4Z0OA 1Z60A 2VPEA 3QZVA 2ECWA 3Q1DA 5LKTA 3KDEC 4Q6FA 4WZ0A 5K3QA 3O70A 1WENA 4A4BA 1N87A 4CCGX 3SOWA 3HTKC 2YHOA 3SUBA 4R2YA 5H1VA 4UP5A 4GNDA 1Z6UA 2XOCA 2Y1MA 5KH9A 4QF3A 2M6MA 2C2VS 2MKEA 4MSXA 3U5NA 2XOYA 3LVQE 2EA6A 4B7YC 2FUUA 1ZBDB 1HYJA 3O36A 3LRQA 2M1RA 2VJFA 1G25A 3N9PA 2L43A 4C9ZA 3O35A 3MHHA 4LLBA 1JOCA 1WESA 2ECTA 3O7AA 2YREA 3T6RA 1WILA 3FJUB 3M62A 5JG6A 4PTBA 4GB0A 4L58A 3MDBC 2XB1A 5TBNA 5I3LA 3NG2A 3L1ZB 4YBTA 4I7BA 2XOZA 2KGGA 5KH7A 4OGEA 4S3OB 1FBVA 2Y43A 4TKPB 4I7DA 3U5MA 4GNEA 3DWDA 2LGLA 5H1TA 2HDPA 2K17A 2JM3A 4NN2A 1WIMA 3FEHA 4LADB 2CKLA 3ZPV1 2YSMA 1X4JA 2YSJA 3N9OA 4WZ2A 5LKZA 1DCQA 3H7HA 2F6JA 5H9MA 2KWKA 2RR4A 2L75A 2L7PA 2YW8A 4V3KC 1RMDA 1DVPA 2JUNA 3N9NA 2E6SA 2CRRA 2YYRA 2KWJA 2L80A 3ZVZB 2JRJA 3PLWA 3T9KA 1F62A 2YHNA 5B77A 5KH3A 2LRIC 2FD4A 2LGKA 1V87A 3DQVR 3ASLA 4LKAA 3T7LA 2KYUA 5LCWB 1FP0A 5LKXA 1LDKC 4FO9A 2ECNA 3KQIA 3EB6A 4BBQA 2YT5A 2JMIA 3L1XA 3O37A 2G45A 1Z2QA 2MT5A 2D8UA 2G6QA 1BORA 3SOXA 2H0DA 4X3GA 3LQIA 1JM7B 3M99A 3E2DA 3FM8C 5G04B 2ECGA 2MD7B 4AYCA 2KWNA 2MUMA 1WEUA 1X4IA 4WZ3B 2YU4A 4FJCA 1WEOA 2EGPA 2CKLB 3LDYA 2LXPC 5B8DA 2L0BA 5G0FA 2CRWA 2ECIA 3C5KA 4YBSA 1WEVA 2ECVA 3LJUX 2KFTA 3HCTA 5FERA 4LK9A 3O34A 1HYIA 2DSMA 2KIZA 2CSVA 2QJ0A 4YADA 2P57A 4F52B 2F42A 4H9DA 2BAYA 5FB1A 1CHCA 3M63A 1JM7A 4YABA 1LDJB 2B0OE 3ZTGA 2YVRA 5B76A 2MNYA 5H1UA 2CSZA 3KNVA 4L7XA 2JMDA 1U6GB 2VPBA 2KU3A 3LVRE 4FIPA 1WFKA 1XWHA 2XP0A 3KV5A 2JMJA 1IYMA 1X4UA 3PURA 4A0CD 2K16A 2LDRA 3PHDA 2KWOA 2L5UA 2FUIA 3ZVYA 5C11A 5D1MB 4ZUXU 2DJAA 5FB0A 2YURA 2ZETC 2MA5A 2VJEA 2OXQC 1WEMA 2QIZA 1WEPA 4QF2A 4I7CA 2M13A 3M7KA 2CONA 2H0DB 4R8PK 2IQJA 3LQHA 4IC3A 5AIUA 5TDWA 4AYCB 5EYAF 5DKAA 3C6WA 3KV6A 4N3WA 3ZPVE 3SHBA 2F6NA 3MHSA 2HYED 3V43A 4PPEA 2FFWA 5D1LB 2EODA 4UI9B 3IHPA 2LN0A 2I50A 2AN6A 1VFYA 5SVXA 2LXHC 4B86C 2E61A 2YUCA 3N9MA 3SOUA 4FK5A 3DDTA 3RPGC 5TABA 4Z0RA 4QQ4A 1VYXA 4W4UA 4MVTA 3L11A 2CT2A 3FL2A 3FANA 2OWAA 3GV4A 3N9LA 3N9QA 2NAAA 4XI1A 2CSYA 2MIQA 1MM3A 5DINA 3ZNIA 2MA6A 5B79A 3EB5A 2VP7A 3LQJA 5LKUA 2MD8C 4A49A 3HCUA 2EGMA 1T1HA 2VJEB 5SVIA 1WE9A 2K1JA 2KR4A 3O33A 5AITA 4AVXA 4YBMA 5FEYA 2KGIA 5C13A 2VPDA 4UP0A 2LQ6A 3I2DA 3GL6A 3VK6A 2MNZA 5B75A 4A4CA 4LJNA 4O62A 1MM2A 1WEWA 1K2FA 4BHWA 4WA6A 3O47A 4O64A 4OGCA 4YAXA 3FAOA 1WEQA 2M3HA 2YQLA 2E6RA 2KE1A 4GNGA 2PUYA 4ZQLA 2C2LA 2D8SA 2K4DA 2LV9A 2KREA 1MBMA 2VNFA 3PUQA 2ECJA 3ZYQA 5B78A 2LAUA 2M85A 3DPLR 2RI7A
chains in the Genus database with same CATH topology
4YATA 2DX8A 4V3LC 4YC9A 2YQMA 2VPGA 2LGGA 4S3OC 2XEUA 4AP4A 2QICA 5G05B 2G43A 1VD4A 5TRBA 3RTRB 2FSAA 4CA1A 1WGMA 3U5OA 3RPGB 2UZGA 4N4FA 1WEEA 4GNFA 2Y1NA 3U5PA 1E4UA 4R7EA 2RSDA 5D1KB 4IC2A 4AUQB 4ZDTA 3HCSA 5J3XA 2VJFB 5TDRA 4P5OB 2IDAA 2PNXA 2LGVA 1Z60A 2VPEA 3QZVA 2ECWA 5LKTA 4Q6FA 4WZ0A 3O70A 1WENA 4A4BA 1N87A 4CCGX 3SOWA 3HTKC 2YHOA 4R2YA 5H1VA 4UP5A 4GNDA 1Z6UA 2Y1MA 5KH9A 4QF3A 2M6MA 2C2VS 4MSXA 3U5NA 2EA6A 4B7YC 2FUUA 1ZBDB 1HYJA 3O36A 3LRQA 2M1RA 2VJFA 1G25A 3N9PA 2L43A 4C9ZA 3O35A 3MHHA 4LLBA 1JOCA 1WESA 2ECTA 3O7AA 2YREA 3T6RA 1WILA 3M62A 5JG6A 4PTBA 4GB0A 4L58A 5TBNA 2XB1A 5I3LA 3NG2A 3L1ZB 4YBTA 4I7BA 2KGGA 5KH7A 4S3OB 1FBVA 2Y43A 4TKPB 4I7DA 3U5MA 4GNEA 2LGLA 5H1TA 2HDPA 2K17A 4NN2A 1WIMA 4LADB 2CKLA 3ZPV1 2YSMA 1X4JA 2YSJA 3N9OA 4WZ2A 5LKZA 2F6JA 5H9MA 2KWKA 2L75A 2YW8A 4V3KC 1RMDA 1DVPA 3N9NA 2E6SA 2YYRA 2KWJA 2L80A 3ZVZB 2JRJA 1F62A 2YHNA 5B77A 5KH3A 2LRIC 2LGKA 1V87A 3DQVR 3ASLA 4LKAA 3T7LA 2KYUA 5LCWB 1FP0A 5LKXA 1LDKC 4FO9A 2ECNA 3KQIA 3EB6A 4BBQA 2YT5A 2JMIA 3L1XA 3O37A 2G45A 1Z2QA 2MT5A 2G6QA 1BORA 3SOXA 2H0DA 4X3GA 3LQIA 1JM7B 3M99A 5G04B 2ECGA 2MD7B 4AYCA 2KWNA 2MUMA 1WEUA 1X4IA 4WZ3B 2YU4A 4FJCA 1WEOA 2EGPA 2CKLB 2LXPC 5B8DA 2L0BA 5G0FA 2ECIA 3C5KA 4YBSA 1WEVA 2ECVA 2KFTA 3HCTA 5FERA 4LK9A 3O34A 1HYIA 2KIZA 2QJ0A 4YADA 4F52B 2F42A 2BAYA 5FB1A 1CHCA 3M63A 1JM7A 4YABA 1LDJB 3ZTGA 5B76A 2MNYA 5H1UA 2CSZA 3KNVA 4L7XA 2JMDA 1U6GB 2VPBA 2KU3A 4FIPA 1WFKA 1XWHA 3KV5A 2JMJA 1IYMA 1X4UA 3PURA 4A0CD 2K16A 2LDRA 3PHDA 2KWOA 2L5UA 2FUIA 3ZVYA 5C11A 5D1MB 4ZUXU 5FB0A 2YURA 2ZETC 2MA5A 2VJEA 2OXQC 1WEMA 2QIZA 1WEPA 4QF2A 4I7CA 2H0DB 4R8PK 3LQHA 4IC3A 5AIUA 5TDWA 4AYCB 5EYAF 5DKAA 3C6WA 3KV6A 4N3WA 3ZPVE 3SHBA 2F6NA 3MHSA 2HYED 3V43A 4PPEA 5D1LB 2EODA 4UI9B 3IHPA 2LN0A 2I50A 2AN6A 1VFYA 2LXHC 4B86C 2YUCA 3N9MA 3SOUA 4FK5A 3RPGC 5TABA 1VYXA 4W4UA 4MVTA 3L11A 2CT2A 3FL2A 3GV4A 3N9LA 3N9QA 2NAAA 4XI1A 2CSYA 2MIQA 1MM3A 5DINA 3ZNIA 2MA6A 5B79A 3EB5A 2VP7A 3LQJA 5LKUA 2MD8C 4A49A 3HCUA 1T1HA 2VJEB 1WE9A 2K1JA 2KR4A 3O33A 5AITA 4AVXA 4YBMA 5FEYA 2KGIA 5C13A 2VPDA 4UP0A 2LQ6A 3I2DA 3GL6A 3VK6A 2MNZA 5B75A 4A4CA 4LJNA 1MM2A 1WEWA 1K2FA 4BHWA 4WA6A 4O64A 4YAXA 1WEQA 2M3HA 2YQLA 2E6RA 2KE1A 4GNGA 2PUYA 4ZQLA 2C2LA 2D8SA 2K4DA 2LV9A 2KREA 2VNFA 3PUQA 2ECJA 3ZYQA 5B78A 2M85A 3DPLR 2RI7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YAT A;  2DX8 A;  4V3L C;  4YC9 A;  2YQM A;  2VPG A;  2LGG A;  4S3O C;  2XEU A;  4AP4 A;  2QIC A;  5G05 B;  2G43 A;  1VD4 A;  5TRB A;  3RTR B;  2FSA A;  4CA1 A;  1WGM A;  3U5O A;  3RPG B;  2UZG A;  4N4F A;  1WEE A;  4GNF A;  2Y1N A;  3U5P A;  1E4U A;  4R7E A;  2RSD A;  5D1K B;  4IC2 A;  4AUQ B;  4ZDT A;  3HCS A;  5J3X A;  2VJF B;  5TDR A;  4P5O B;  2IDA A;  2PNX A;  2LGV A;  1Z60 A;  2VPE A;  3QZV A;  2ECW A;  5LKT A;  4Q6F A;  4WZ0 A;  3O70 A;  1WEN A;  4A4B A;  1N87 A;  4CCG X;  3SOW A;  3HTK C;  2YHO A;  4R2Y A;  5H1V A;  4UP5 A;  4GND A;  1Z6U A;  2Y1M A;  5KH9 A;  4QF3 A;  2M6M A;  2C2V S;  4MSX A;  3U5N A;  2EA6 A;  4B7Y C;  2FUU A;  1ZBD B;  1HYJ A;  3O36 A;  3LRQ A;  2M1R A;  2VJF A;  1G25 A;  3N9P A;  2L43 A;  4C9Z A;  3O35 A;  3MHH A;  4LLB A;  1JOC A;  1WES A;  2ECT A;  3O7A A;  2YRE A;  3T6R A;  1WIL A;  3M62 A;  5JG6 A;  4PTB A;  4GB0 A;  4L58 A;  5TBN A;  2XB1 A;  5I3L A;  3NG2 A;  3L1Z B;  4YBT A;  4I7B A;  2KGG A;  5KH7 A;  4S3O B;  1FBV A;  2Y43 A;  4TKP B;  4I7D A;  3U5M A;  4GNE A;  2LGL A;  5H1T A;  2HDP A;  2K17 A;  4NN2 A;  1WIM A;  4LAD B;  2CKL A;  3ZPV 1;  2YSM A;  1X4J A;  2YSJ A;  3N9O A;  4WZ2 A;  5LKZ A;  2F6J A;  5H9M A;  2KWK A;  2L75 A;  2YW8 A;  4V3K C;  1RMD A;  1DVP A;  3N9N A;  2E6S A;  2YYR A;  2KWJ A;  2L80 A;  3ZVZ B;  2JRJ A;  1F62 A;  2YHN A;  5B77 A;  5KH3 A;  2LRI C;  2LGK A;  1V87 A;  3DQV R;  3ASL A;  4LKA A;  3T7L A;  2KYU A;  5LCW B;  1FP0 A;  5LKX A;  1LDK C;  4FO9 A;  2ECN A;  3KQI A;  3EB6 A;  4BBQ A;  2YT5 A;  2JMI A;  3L1X A;  3O37 A;  2G45 A;  1Z2Q A;  2MT5 A;  2G6Q A;  1BOR A;  3SOX A;  2H0D A;  4X3G A;  3LQI A;  1JM7 B;  3M99 A;  5G04 B;  2ECG A;  2MD7 B;  4AYC A;  2KWN A;  2MUM A;  1WEU A;  1X4I A;  4WZ3 B;  2YU4 A;  4FJC A;  1WEO A;  2EGP A;  2CKL B;  2LXP C;  5B8D A;  2L0B A;  5G0F A;  2ECI A;  3C5K A;  4YBS A;  1WEV A;  2ECV A;  2KFT A;  3HCT A;  5FER A;  4LK9 A;  3O34 A;  1HYI A;  2KIZ A;  2QJ0 A;  4YAD A;  4F52 B;  2F42 A;  2BAY A;  5FB1 A;  1CHC A;  3M63 A;  1JM7 A;  4YAB A;  1LDJ B;  3ZTG A;  5B76 A;  2MNY A;  5H1U A;  2CSZ A;  3KNV A;  4L7X A;  2JMD A;  1U6G B;  2VPB A;  2KU3 A;  4FIP A;  1WFK A;  1XWH A;  3KV5 A;  2JMJ A;  1IYM A;  1X4U A;  3PUR A;  4A0C D;  2K16 A;  2LDR A;  3PHD A;  2KWO A;  2L5U A;  2FUI A;  3ZVY A;  5C11 A;  5D1M B;  4ZUX U;  5FB0 A;  2YUR A;  2ZET C;  2MA5 A;  2VJE A;  2OXQ C;  1WEM A;  2QIZ A;  1WEP A;  4QF2 A;  4I7C A;  2H0D B;  4R8P K;  3LQH A;  4IC3 A;  5AIU A;  5TDW A;  4AYC B;  5EYA F;  5DKA A;  3C6W A;  3KV6 A;  4N3W A;  3ZPV E;  3SHB A;  2F6N A;  3MHS A;  2HYE D;  3V43 A;  4PPE A;  5D1L B;  2EOD A;  4UI9 B;  3IHP A;  2LN0 A;  2I50 A;  2AN6 A;  1VFY A;  2LXH C;  4B86 C;  2YUC A;  3N9M A;  3SOU A;  4FK5 A;  3RPG C;  5TAB A;  1VYX A;  4W4U A;  4MVT A;  3L11 A;  2CT2 A;  3FL2 A;  3GV4 A;  3N9L A;  3N9Q A;  2NAA A;  4XI1 A;  2CSY A;  2MIQ A;  1MM3 A;  5DIN A;  3ZNI A;  2MA6 A;  5B79 A;  3EB5 A;  2VP7 A;  3LQJ A;  5LKU A;  2MD8 C;  4A49 A;  3HCU A;  1T1H A;  2VJE B;  1WE9 A;  2K1J A;  2KR4 A;  3O33 A;  5AIT A;  4AVX A;  4YBM A;  5FEY A;  2KGI A;  5C13 A;  2VPD A;  4UP0 A;  2LQ6 A;  3I2D A;  3GL6 A;  3VK6 A;  2MNZ A;  5B75 A;  4A4C A;  4LJN A;  1MM2 A;  1WEW A;  1K2F A;  4BHW A;  4WA6 A;  4O64 A;  4YAX A;  1WEQ A;  2M3H A;  2YQL A;  2E6R A;  2KE1 A;  4GNG A;  2PUY A;  4ZQL A;  2C2L A;  2D8S A;  2K4D A;  2LV9 A;  2KRE A;  2VNF A;  3PUQ A;  2ECJ A;  3ZYQ A;  5B78 A;  2M85 A;  3DPL R;  2RI7 A; 
#chains in the Genus database with same CATH topology
 4YAT A;  2DX8 A;  4V3L C;  4YC9 A;  2YQM A;  2VPG A;  2LGG A;  4S3O C;  2XEU A;  2EXU A;  4AP4 A;  2QIC A;  5G05 B;  2G43 A;  1VD4 A;  5TRB A;  3RTR B;  2FSA A;  4CA1 A;  1WGM A;  3U5O A;  3RPG B;  2UZG A;  3JUE A;  4N4F A;  1WEE A;  4GNF A;  2Y1N A;  3U5P A;  1E4U A;  4R7E A;  2RSD A;  5SVY A;  5D1K B;  4IC2 A;  4AUQ B;  4ZDT A;  3HCS A;  4F1P A;  2KKY A;  5J3X A;  2VJF B;  5TDR A;  2KKX A;  4P5O B;  5SVI B;  2IDA A;  2PNX A;  2LGV A;  4Z0O A;  1Z60 A;  2VPE A;  3QZV A;  2ECW A;  3Q1D A;  5LKT A;  3KDE C;  4Q6F A;  4WZ0 A;  5K3Q A;  3O70 A;  1WEN A;  4A4B A;  1N87 A;  4CCG X;  3SOW A;  3HTK C;  2YHO A;  3SUB A;  4R2Y A;  5H1V A;  4UP5 A;  4GND A;  1Z6U A;  2XOC A;  2Y1M A;  5KH9 A;  4QF3 A;  2M6M A;  2C2V S;  2MKE A;  4MSX A;  3U5N A;  2XOY A;  3LVQ E;  2EA6 A;  4B7Y C;  2FUU A;  1ZBD B;  1HYJ A;  3O36 A;  3LRQ A;  2M1R A;  2VJF A;  1G25 A;  3N9P A;  2L43 A;  4C9Z A;  3O35 A;  3MHH A;  4LLB A;  1JOC A;  1WES A;  2ECT A;  3O7A A;  2YRE A;  3T6R A;  1WIL A;  3FJU B;  3M62 A;  5JG6 A;  4PTB A;  4GB0 A;  4L58 A;  3MDB C;  2XB1 A;  5TBN A;  5I3L A;  3NG2 A;  3L1Z B;  4YBT A;  4I7B A;  2XOZ A;  2KGG A;  5KH7 A;  4OGE A;  4S3O B;  1FBV A;  2Y43 A;  4TKP B;  4I7D A;  3U5M A;  4GNE A;  3DWD A;  2LGL A;  5H1T A;  2HDP A;  2K17 A;  2JM3 A;  4NN2 A;  1WIM A;  3FEH A;  4LAD B;  2CKL A;  3ZPV 1;  2YSM A;  1X4J A;  2YSJ A;  3N9O A;  4WZ2 A;  5LKZ A;  1DCQ A;  3H7H A;  2F6J A;  5H9M A;  2KWK A;  2RR4 A;  2L75 A;  2L7P A;  2YW8 A;  4V3K C;  1RMD A;  1DVP A;  2JUN A;  3N9N A;  2E6S A;  2CRR A;  2YYR A;  2KWJ A;  2L80 A;  3ZVZ B;  2JRJ A;  3PLW A;  3T9K A;  1F62 A;  2YHN A;  5B77 A;  5KH3 A;  2LRI C;  2FD4 A;  2LGK A;  1V87 A;  3DQV R;  3ASL A;  4LKA A;  3T7L A;  2KYU A;  5LCW B;  1FP0 A;  5LKX A;  1LDK C;  4FO9 A;  2ECN A;  3KQI A;  3EB6 A;  4BBQ A;  2YT5 A;  2JMI A;  3L1X A;  3O37 A;  2G45 A;  1Z2Q A;  2MT5 A;  2D8U A;  2G6Q A;  1BOR A;  3SOX A;  2H0D A;  4X3G A;  3LQI A;  1JM7 B;  3M99 A;  3E2D A;  3FM8 C;  5G04 B;  2ECG A;  2MD7 B;  4AYC A;  2KWN A;  2MUM A;  1WEU A;  1X4I A;  4WZ3 B;  2YU4 A;  4FJC A;  1WEO A;  2EGP A;  2CKL B;  3LDY A;  2LXP C;  5B8D A;  2L0B A;  5G0F A;  2CRW A;  2ECI A;  3C5K A;  4YBS A;  1WEV A;  2ECV A;  3LJU X;  2KFT A;  3HCT A;  5FER A;  4LK9 A;  3O34 A;  1HYI A;  2DSM A;  2KIZ A;  2CSV A;  2QJ0 A;  4YAD A;  2P57 A;  4F52 B;  2F42 A;  4H9D A;  2BAY A;  5FB1 A;  1CHC A;  3M63 A;  1JM7 A;  4YAB A;  1LDJ B;  2B0O E;  3ZTG A;  2YVR A;  5B76 A;  2MNY A;  5H1U A;  2CSZ A;  3KNV A;  4L7X A;  2JMD A;  1U6G B;  2VPB A;  2KU3 A;  3LVR E;  4FIP A;  1WFK A;  1XWH A;  2XP0 A;  3KV5 A;  2JMJ A;  1IYM A;  1X4U A;  3PUR A;  4A0C D;  2K16 A;  2LDR A;  3PHD A;  2KWO A;  2L5U A;  2FUI A;  3ZVY A;  5C11 A;  5D1M B;  4ZUX U;  2DJA A;  5FB0 A;  2YUR A;  2ZET C;  2MA5 A;  2VJE A;  2OXQ C;  1WEM A;  2QIZ A;  1WEP A;  4QF2 A;  4I7C A;  2M13 A;  3M7K A;  2CON A;  2H0D B;  4R8P K;  2IQJ A;  3LQH A;  4IC3 A;  5AIU A;  5TDW A;  4AYC B;  5EYA F;  5DKA A;  3C6W A;  3KV6 A;  4N3W A;  3ZPV E;  3SHB A;  2F6N A;  3MHS A;  2HYE D;  3V43 A;  4PPE A;  2FFW A;  5D1L B;  2EOD A;  4UI9 B;  3IHP A;  2LN0 A;  2I50 A;  2AN6 A;  1VFY A;  5SVX A;  2LXH C;  4B86 C;  2E61 A;  2YUC A;  3N9M A;  3SOU A;  4FK5 A;  3DDT A;  3RPG C;  5TAB A;  4Z0R A;  4QQ4 A;  1VYX A;  4W4U A;  4MVT A;  3L11 A;  2CT2 A;  3FL2 A;  3FAN A;  2OWA A;  3GV4 A;  3N9L A;  3N9Q A;  2NAA A;  4XI1 A;  2CSY A;  2MIQ A;  1MM3 A;  5DIN A;  3ZNI A;  2MA6 A;  5B79 A;  3EB5 A;  2VP7 A;  3LQJ A;  5LKU A;  2MD8 C;  4A49 A;  3HCU A;  2EGM A;  1T1H A;  2VJE B;  5SVI A;  1WE9 A;  2K1J A;  2KR4 A;  3O33 A;  5AIT A;  4AVX A;  4YBM A;  5FEY A;  2KGI A;  5C13 A;  2VPD A;  4UP0 A;  2LQ6 A;  3I2D A;  3GL6 A;  3VK6 A;  2MNZ A;  5B75 A;  4A4C A;  4LJN A;  4O62 A;  1MM2 A;  1WEW A;  1K2F A;  4BHW A;  4WA6 A;  3O47 A;  4O64 A;  4OGC A;  4YAX A;  3FAO A;  1WEQ A;  2M3H A;  2YQL A;  2E6R A;  2KE1 A;  4GNG A;  2PUY A;  4ZQL A;  2C2L A;  2D8S A;  2K4D A;  2LV9 A;  2KRE A;  1MBM A;  2VNF A;  3PUQ A;  2ECJ A;  3ZYQ A;  5B78 A;  2LAU A;  2M85 A;  3DPL R;  2RI7 A; 
#chains in the Genus database with same CATH homology
 4YAT A;  2DX8 A;  4V3L C;  4YC9 A;  2YQM A;  2VPG A;  2LGG A;  4S3O C;  2XEU A;  4AP4 A;  2QIC A;  5G05 B;  2G43 A;  1VD4 A;  5TRB A;  3RTR B;  2FSA A;  4CA1 A;  1WGM A;  3U5O A;  3RPG B;  2UZG A;  4N4F A;  1WEE A;  4GNF A;  2Y1N A;  3U5P A;  1E4U A;  4R7E A;  2RSD A;  5D1K B;  4IC2 A;  4AUQ B;  4ZDT A;  3HCS A;  5J3X A;  2VJF B;  5TDR A;  4P5O B;  2IDA A;  2PNX A;  2LGV A;  1Z60 A;  2VPE A;  3QZV A;  2ECW A;  5LKT A;  4Q6F A;  4WZ0 A;  3O70 A;  1WEN A;  4A4B A;  1N87 A;  4CCG X;  3SOW A;  3HTK C;  2YHO A;  4R2Y A;  5H1V A;  4UP5 A;  4GND A;  1Z6U A;  2Y1M A;  5KH9 A;  4QF3 A;  2M6M A;  2C2V S;  4MSX A;  3U5N A;  2EA6 A;  4B7Y C;  2FUU A;  1ZBD B;  1HYJ A;  3O36 A;  3LRQ A;  2M1R A;  2VJF A;  1G25 A;  3N9P A;  2L43 A;  4C9Z A;  3O35 A;  3MHH A;  4LLB A;  1JOC A;  1WES A;  2ECT A;  3O7A A;  2YRE A;  3T6R A;  1WIL A;  3M62 A;  5JG6 A;  4PTB A;  4GB0 A;  4L58 A;  5TBN A;  2XB1 A;  5I3L A;  3NG2 A;  3L1Z B;  4YBT A;  4I7B A;  2KGG A;  5KH7 A;  4S3O B;  1FBV A;  2Y43 A;  4TKP B;  4I7D A;  3U5M A;  4GNE A;  2LGL A;  5H1T A;  2HDP A;  2K17 A;  4NN2 A;  1WIM A;  4LAD B;  2CKL A;  3ZPV 1;  2YSM A;  1X4J A;  2YSJ A;  3N9O A;  4WZ2 A;  5LKZ A;  2F6J A;  5H9M A;  2KWK A;  2L75 A;  2YW8 A;  4V3K C;  1RMD A;  1DVP A;  3N9N A;  2E6S A;  2YYR A;  2KWJ A;  2L80 A;  3ZVZ B;  2JRJ A;  1F62 A;  2YHN A;  5B77 A;  5KH3 A;  2LRI C;  2LGK A;  1V87 A;  3DQV R;  3ASL A;  4LKA A;  3T7L A;  2KYU A;  5LCW B;  1FP0 A;  5LKX A;  1LDK C;  4FO9 A;  2ECN A;  3KQI A;  3EB6 A;  4BBQ A;  2YT5 A;  2JMI A;  3L1X A;  3O37 A;  2G45 A;  1Z2Q A;  2MT5 A;  2G6Q A;  1BOR A;  3SOX A;  2H0D A;  4X3G A;  3LQI A;  1JM7 B;  3M99 A;  5G04 B;  2ECG A;  2MD7 B;  4AYC A;  2KWN A;  2MUM A;  1WEU A;  1X4I A;  4WZ3 B;  2YU4 A;  4FJC A;  1WEO A;  2EGP A;  2CKL B;  2LXP C;  5B8D A;  2L0B A;  5G0F A;  2ECI A;  3C5K A;  4YBS A;  1WEV A;  2ECV A;  2KFT A;  3HCT A;  5FER A;  4LK9 A;  3O34 A;  1HYI A;  2KIZ A;  2QJ0 A;  4YAD A;  4F52 B;  2F42 A;  2BAY A;  5FB1 A;  1CHC A;  3M63 A;  1JM7 A;  4YAB A;  1LDJ B;  3ZTG A;  5B76 A;  2MNY A;  5H1U A;  2CSZ A;  3KNV A;  4L7X A;  2JMD A;  1U6G B;  2VPB A;  2KU3 A;  4FIP A;  1WFK A;  1XWH A;  3KV5 A;  2JMJ A;  1IYM A;  1X4U A;  3PUR A;  4A0C D;  2K16 A;  2LDR A;  3PHD A;  2KWO A;  2L5U A;  2FUI A;  3ZVY A;  5C11 A;  5D1M B;  4ZUX U;  5FB0 A;  2YUR A;  2ZET C;  2MA5 A;  2VJE A;  2OXQ C;  1WEM A;  2QIZ A;  1WEP A;  4QF2 A;  4I7C A;  2H0D B;  4R8P K;  3LQH A;  4IC3 A;  5AIU A;  5TDW A;  4AYC B;  5EYA F;  5DKA A;  3C6W A;  3KV6 A;  4N3W A;  3ZPV E;  3SHB A;  2F6N A;  3MHS A;  2HYE D;  3V43 A;  4PPE A;  5D1L B;  2EOD A;  4UI9 B;  3IHP A;  2LN0 A;  2I50 A;  2AN6 A;  1VFY A;  2LXH C;  4B86 C;  2YUC A;  3N9M A;  3SOU A;  4FK5 A;  3RPG C;  5TAB A;  1VYX A;  4W4U A;  4MVT A;  3L11 A;  2CT2 A;  3FL2 A;  3GV4 A;  3N9L A;  3N9Q A;  2NAA A;  4XI1 A;  2CSY A;  2MIQ A;  1MM3 A;  5DIN A;  3ZNI A;  2MA6 A;  5B79 A;  3EB5 A;  2VP7 A;  3LQJ A;  5LKU A;  2MD8 C;  4A49 A;  3HCU A;  1T1H A;  2VJE B;  1WE9 A;  2K1J A;  2KR4 A;  3O33 A;  5AIT A;  4AVX A;  4YBM A;  5FEY A;  2KGI A;  5C13 A;  2VPD A;  4UP0 A;  2LQ6 A;  3I2D A;  3GL6 A;  3VK6 A;  2MNZ A;  5B75 A;  4A4C A;  4LJN A;  1MM2 A;  1WEW A;  1K2F A;  4BHW A;  4WA6 A;  4O64 A;  4YAX A;  1WEQ A;  2M3H A;  2YQL A;  2E6R A;  2KE1 A;  4GNG A;  2PUY A;  4ZQL A;  2C2L A;  2D8S A;  2K4D A;  2LV9 A;  2KRE A;  2VNF A;  3PUQ A;  2ECJ A;  3ZYQ A;  5B78 A;  2M85 A;  3DPL R;  2RI7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...