1XWHA

Nmr structure of the first phd finger of autoimmune regulator protein (aire1): insights into apeced
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
66
structure length
66
Chain Sequence
GAMAQKNEDECAVCRDGGELICCDGCPRAFHLACLSPPLREIPSGTWRCSSCLQATVQEVQPRAEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title NMR structure of the first PHD finger of autoimmune regulator protein (AIRE1). Insights into autoimmune polyendocrinopathy-candidiasis-ectodermal dystrophy (APECED) disease
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Autoimmune regulator
total genus 4
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2004-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1xwhA00
3O70A 2KU3A 5FB1A 2CT2A 3SOWA 2YURA 2KWKA 2L80A 5D1LB 4GNEA 3V43A 1JOCA 3N9LA 2C2VS 4B86C 1HYIA 2YUCA 4L58A 3N9PA 3ZNIA 3N9OA 1E4UA 2QIZA 3GV4A 3I2DA 2XEUA 4LADB 4BBQA 3U5OA 1V87A 2YT5A 3SHBA 3HTKC 5FB0A 2EGPA 2K4DA 2YHNA 3O34A 1HYJA 4S3OC 5DKAA 4ZQLA 5TDRA 5TBNA 1U6GB 4N3WA 2PUYA 2YU4A 1VYXA 1WEMA 3O7AA 5B78A 2EODA 2HDPA 3HCUA 5J3XA 2ECWA 4UP0A 2VPBA 2K1JA 4FK5A 3C5KA 3KV5A 2QJ0A 2LN0A 2K16A 4LLBA 3L1ZB 2JMJA 2Y1MA 5AIUA 1CHCA 4MVTA 5JG6A 2FUUA 3LRQA 2ECTA 4AVXA 1F62A 2Y43A 2L43A 5H1UA 2M6MA 4YABA 4GNGA 4FO9A 4PTBA 3U5MA 1LDKC 3U5NA 4O64A 5TRBA 4PPEA 4AYCA 4CA1A 2KWNA 2ECNA 5KH7A 2ECGA 5KH9A 4YBMA 2FSAA 5B8DA 2KFTA 3M63A 4LJNA 4YAXA 1K2FA 2L75A 4NN2A 3ZVYA 2MNZA 2YQMA 5G05B 4IC3A 5C13A 4L7XA 4I7DA 2F42A 2RSDA 2G45A 2KIZA 2YREA 1X4JA 2KWOA 5H1TA 2EA6A 5DINA 4FJCA 1BORA 3HCTA 1WEVA 2AN6A 3ZYQA 2MA5A 1WEEA 1MM3A 1Z60A 3VK6A 2LGKA 2JMDA 4IC2A 4XI1A 2C2LA 4S3OB 5LKTA 2OXQC 2H0DA 1WILA 4YATA 5FERA 4YC9A 3MHHA 3T6RA 2FUIA 5B77A 1N87A 2G43A 4R8PK 5C11A 2E6SA 2LXHC 4X3GA 1WEUA 1WENA 1IYMA 4QF2A 5TABA 3SOUA 1JM7B 4ZDTA 2QICA 4GB0A 4CCGX 3EB5A 4W4UA 1FP0A 3LQIA 2Y1NA 5D1MB 3KNVA 4LKAA 2VP7A 3ASLA 5D1KB 4B7YC 2BAYA 2YQLA 1VFYA 2F6JA 4GNFA 4I7CA 4R2YA 3ZVZB 2G6QA 4WA6A 3MHSA 1G25A 3LQJA 2KR4A 1WGMA 2XB1A 2CSZA 2H0DB 1WESA 5B75A 4A4CA 4BHWA 2M1RA 1WIMA 4GNDA 2MIQA 4LK9A 3T7LA 5G0FA 2MNYA 3ZPV1 1RMDA 1WE9A 3L1XA 2LGVA 3N9NA 1WFKA 2KREA 1VD4A 3NG2A 4P5OB 2M3HA 3EB6A 1WEWA 1X4IA 3ZTGA 2NAAA 2UZGA 5LCWB 4C9ZA 4YBSA 4FIPA 2VJEA 4YBTA 3O36A 4V3LC 2KYUA 3M62A 3RPGB 2DX8A 3HCSA 2ZETC 2IDAA 2KE1A 2KWJA 2VPEA 3O33A 2YSMA 1WEQA 3IHPA 1LDJB 1FBVA 2RI7A 2PNXA 2E6RA 1ZBDB 1JM7A 4AYCB 3QZVA 5B79A 2CKLA 3LQHA 5AITA 4UI9B 2MUMA 2LV9A 1X4UA 2YHOA 4A49A 4WZ3B 2LGLA 1DVPA 2ECIA 4AP4A 2LGGA 4MSXA 3PHDA 2CSYA 2L5UA 3DQVR 5FEYA 2LRIC 2K17A 4A0CD 2KGIA 5EYAF 5G04B 5LKXA 2LQ6A 5TDWA 2VJFB 2M85A 3RTRB 3M99A 4YADA 3FL2A 1WEOA 3N9QA 4F52B 3PUQA 2JMIA 4V3KC 1Z6UA 1MM2A 3KQIA 3O37A 3KV6A 4N4FA 1XWHA 2YSJA 3L11A 2LXPC 2YW8A 4I7BA 4AUQB 2L0BA 4ZUXU 3O35A 4WZ2A 2VJEB 1T1HA 4TKPB 5KH3A 1Z2QA 2VPGA 5H9MA 4Q6FA 2CKLB 2HYED 2VNFA 4UP5A 2ECJA 3PURA 3RPGC 4QF3A 2KGGA 2MT5A 3GL6A 5I3LA 5LKZA 2MD7B 2VPDA 2D8SA 2MD8C 2MA6A 4R7EA 3N9MA 4WZ0A 3U5PA 2JRJA 2ECVA 2YYRA 3SOXA 5B76A 5H1VA 5LKUA 2VJFA 1WEPA 2F6NA 3C6WA 3DPLR 3ZPVE 2I50A 4A4BA 2LDRA
chains in the Genus database with same CATH superfamily
3O70A 4Z0OA 2KU3A 5FB1A 2CT2A 3SOWA 2YURA 2DJAA 2KWKA 2L80A 5D1LB 4GNEA 3V43A 1JOCA 3N9LA 2C2VS 4B86C 4QQ4A 1HYIA 2YUCA 5SVIA 4L58A 5SVXA 3N9PA 3ZNIA 3N9OA 1E4UA 2QIZA 3GV4A 3I2DA 2XEUA 4LADB 4BBQA 3U5OA 1V87A 2YT5A 3SHBA 3HTKC 5FB0A 4H9DA 2EGPA 2K4DA 2YHNA 3JUEA 3O34A 1HYJA 4S3OC 5DKAA 4ZQLA 5TDRA 5TBNA 1U6GB 4N3WA 2PUYA 2YU4A 1VYXA 1WEMA 3O7AA 2CRWA 5B78A 2EODA 2HDPA 3HCUA 3LVRE 5J3XA 2ECWA 4UP0A 2VPBA 2K1JA 4FK5A 3C5KA 3KV5A 2QJ0A 2LN0A 2K16A 4LLBA 3L1ZB 2JMJA 2Y1MA 5AIUA 1CHCA 2P57A 4MVTA 2CONA 5JG6A 2FFWA 2FUUA 3LRQA 2ECTA 3SUBA 4AVXA 1F62A 2Y43A 2L43A 5H1UA 2M6MA 4YABA 4GNGA 3DDTA 4FO9A 1DCQA 4PTBA 3U5MA 1LDKC 3U5NA 2RR4A 2E61A 4O64A 5TRBA 4PPEA 4AYCA 4CA1A 2KWNA 2ECNA 5KH7A 2ECGA 5KH9A 2XOCA 4YBMA 2FSAA 5B8DA 2KFTA 3LVQE 3M63A 4LJNA 4YAXA 1K2FA 2L75A 3FAOA 4NN2A 3ZVYA 2MNZA 2YQMA 5G05B 4IC3A 5C13A 4L7XA 4I7DA 2F42A 2RSDA 2G45A 2KIZA 2YREA 1X4JA 2KWOA 5H1TA 2EA6A 5DINA 4FJCA 1BORA 3HCTA 1WEVA 2AN6A 3ZYQA 2MA5A 1WEEA 1MM3A 1Z60A 3VK6A 3FANA 2EXUA 2KKXA 2LGKA 2JMDA 4IC2A 4XI1A 2C2LA 4S3OB 5LKTA 2OXQC 2H0DA 1WILA 4YATA 5FERA 2DSMA 4YC9A 3MHHA 3T6RA 2YVRA 4F1PA 2FUIA 5B77A 1N87A 3E2DA 2G43A 4R8PK 5C11A 2E6SA 2JUNA 2LXHC 2M13A 4X3GA 1WEUA 1WENA 1IYMA 4QF2A 5TABA 3SOUA 3Q1DA 1JM7B 4ZDTA 2QICA 4GB0A 4CCGX 3EB5A 4W4UA 2L7PA 1FP0A 3FJUB 3LQIA 2Y1NA 5D1MB 3KNVA 4LKAA 2VP7A 3ASLA 5D1KB 4B7YC 2BAYA 2YQLA 1VFYA 2F6JA 4GNFA 4I7CA 4R2YA 3ZVZB 2G6QA 4WA6A 3MHSA 1G25A 3LQJA 2KR4A 1WGMA 5SVYA 2XB1A 2CSZA 1WESA 2H0DB 5B75A 4A4CA 4BHWA 2M1RA 1WIMA 4GNDA 2MIQA 2KKYA 4LK9A 4Z0RA 3T7LA 5G0FA 2B0OE 2MNYA 3ZPV1 3O47A 1RMDA 1WE9A 3L1XA 2LGVA 3N9NA 3MDBC 1WFKA 2KREA 1VD4A 3NG2A 4P5OB 2M3HA 3EB6A 1WEWA 1X4IA 3LJUX 3ZTGA 2NAAA 2UZGA 5LCWB 3M7KA 4C9ZA 4YBSA 2XOYA 2JM3A 4FIPA 2VJEA 3PLWA 4YBTA 3O36A 3DWDA 4V3LC 2KYUA 3T9KA 3M62A 3RPGB 2DX8A 3HCSA 2ZETC 2IDAA 2KE1A 2KWJA 2VPEA 3O33A 2MKEA 2YSMA 1WEQA 3IHPA 5SVIB 1LDJB 1FBVA 2RI7A 2PNXA 2E6RA 1ZBDB 1JM7A 4AYCB 2XOZA 3FM8C 3QZVA 1MBMA 5B79A 2CKLA 3LQHA 5AITA 4UI9B 2MUMA 2LV9A 1X4UA 2FD4A 2YHOA 4A49A 4WZ3B 2LGLA 1DVPA 2ECIA 4AP4A 2LGGA 4MSXA 3PHDA 2CSYA 2L5UA 3DQVR 5FEYA 2LRIC 2K17A 4A0CD 2KGIA 5EYAF 5G04B 5LKXA 2LQ6A 5TDWA 4O62A 2VJFB 2M85A 3RTRB 3M99A 4OGEA 4YADA 3FL2A 1WEOA 3N9QA 2CRRA 4F52B 3PUQA 3LDYA 2JMIA 4V3KC 1Z6UA 1MM2A 3KQIA 3O37A 3KV6A 4N4FA 1XWHA 2YSJA 3FEHA 3L11A 2IQJA 2LXPC 2YW8A 4I7BA 2OWAA 3H7HA 4AUQB 2L0BA 4ZUXU 2LAUA 3O35A 5K3QA 4WZ2A 2EGMA 2D8UA 2VJEB 1T1HA 4TKPB 5KH3A 1Z2QA 2VPGA 5H9MA 4Q6FA 2CKLB 2HYED 2VNFA 4UP5A 2ECJA 3PURA 3RPGC 4QF3A 2KGGA 2MT5A 3GL6A 4OGCA 5I3LA 5LKZA 2MD7B 2VPDA 2D8SA 2MD8C 2MA6A 4R7EA 2CSVA 3N9MA 4WZ0A 3U5PA 2JRJA 2ECVA 2YYRA 3SOXA 5B76A 5H1VA 5LKUA 2VJFA 1WEPA 2F6NA 3C6WA 3DPLR 3ZPVE 2I50A 3KDEC 4A4BA 2LDRA 2XP0A
chains in the Genus database with same CATH topology
3O70A 2KU3A 5FB1A 2CT2A 3SOWA 2YURA 2KWKA 2L80A 5D1LB 4GNEA 3V43A 1JOCA 3N9LA 2C2VS 4B86C 1HYIA 2YUCA 4L58A 3N9PA 3ZNIA 3N9OA 1E4UA 2QIZA 3GV4A 3I2DA 2XEUA 4LADB 4BBQA 3U5OA 1V87A 2YT5A 3SHBA 3HTKC 5FB0A 2EGPA 2K4DA 2YHNA 3O34A 1HYJA 4S3OC 5DKAA 4ZQLA 5TDRA 5TBNA 1U6GB 4N3WA 2PUYA 2YU4A 1VYXA 1WEMA 3O7AA 5B78A 2EODA 2HDPA 3HCUA 5J3XA 2ECWA 4UP0A 2VPBA 2K1JA 4FK5A 3C5KA 3KV5A 2QJ0A 2LN0A 2K16A 4LLBA 3L1ZB 2JMJA 2Y1MA 5AIUA 1CHCA 4MVTA 5JG6A 2FUUA 3LRQA 2ECTA 4AVXA 1F62A 2Y43A 2L43A 5H1UA 2M6MA 4YABA 4GNGA 4FO9A 4PTBA 3U5MA 1LDKC 3U5NA 4O64A 5TRBA 4PPEA 4AYCA 4CA1A 2KWNA 2ECNA 5KH7A 2ECGA 5KH9A 4YBMA 2FSAA 5B8DA 2KFTA 3M63A 4LJNA 4YAXA 1K2FA 2L75A 4NN2A 3ZVYA 2MNZA 2YQMA 5G05B 4IC3A 5C13A 4L7XA 4I7DA 2F42A 2RSDA 2G45A 2KIZA 2YREA 1X4JA 2KWOA 5H1TA 2EA6A 5DINA 4FJCA 1BORA 3HCTA 1WEVA 2AN6A 3ZYQA 2MA5A 1WEEA 1MM3A 1Z60A 3VK6A 2LGKA 2JMDA 4IC2A 4XI1A 2C2LA 4S3OB 5LKTA 2OXQC 2H0DA 1WILA 4YATA 5FERA 4YC9A 3MHHA 3T6RA 2FUIA 5B77A 1N87A 2G43A 4R8PK 5C11A 2E6SA 2LXHC 4X3GA 1WEUA 1WENA 1IYMA 4QF2A 5TABA 3SOUA 1JM7B 4ZDTA 2QICA 4GB0A 4CCGX 3EB5A 4W4UA 1FP0A 3LQIA 2Y1NA 5D1MB 3KNVA 4LKAA 2VP7A 3ASLA 5D1KB 4B7YC 2BAYA 2YQLA 1VFYA 2F6JA 4GNFA 4I7CA 4R2YA 3ZVZB 2G6QA 4WA6A 3MHSA 1G25A 3LQJA 2KR4A 1WGMA 2XB1A 2CSZA 2H0DB 1WESA 5B75A 4A4CA 4BHWA 2M1RA 1WIMA 4GNDA 2MIQA 4LK9A 3T7LA 5G0FA 2MNYA 3ZPV1 1RMDA 1WE9A 3L1XA 2LGVA 3N9NA 1WFKA 2KREA 1VD4A 3NG2A 4P5OB 2M3HA 3EB6A 1WEWA 1X4IA 3ZTGA 2NAAA 2UZGA 5LCWB 4C9ZA 4YBSA 4FIPA 2VJEA 4YBTA 3O36A 4V3LC 2KYUA 3M62A 3RPGB 2DX8A 3HCSA 2ZETC 2IDAA 2KE1A 2KWJA 2VPEA 3O33A 2YSMA 1WEQA 3IHPA 1LDJB 1FBVA 2RI7A 2PNXA 2E6RA 1ZBDB 1JM7A 4AYCB 3QZVA 5B79A 2CKLA 3LQHA 5AITA 4UI9B 2MUMA 2LV9A 1X4UA 2YHOA 4A49A 4WZ3B 2LGLA 1DVPA 2ECIA 4AP4A 2LGGA 4MSXA 3PHDA 2CSYA 2L5UA 3DQVR 5FEYA 2LRIC 2K17A 4A0CD 2KGIA 5EYAF 5G04B 5LKXA 2LQ6A 5TDWA 2VJFB 2M85A 3RTRB 3M99A 4YADA 3FL2A 1WEOA 3N9QA 4F52B 3PUQA 2JMIA 4V3KC 1Z6UA 1MM2A 3KQIA 3O37A 3KV6A 4N4FA 1XWHA 2YSJA 3L11A 2LXPC 2YW8A 4I7BA 4AUQB 2L0BA 4ZUXU 3O35A 4WZ2A 2VJEB 1T1HA 4TKPB 5KH3A 1Z2QA 2VPGA 5H9MA 4Q6FA 2CKLB 2HYED 2VNFA 4UP5A 2ECJA 3PURA 3RPGC 4QF3A 2KGGA 2MT5A 3GL6A 5I3LA 5LKZA 2MD7B 2VPDA 2D8SA 2MD8C 2MA6A 4R7EA 3N9MA 4WZ0A 3U5PA 2JRJA 2ECVA 2YYRA 3SOXA 5B76A 5H1VA 5LKUA 2VJFA 1WEPA 2F6NA 3C6WA 3DPLR 3ZPVE 2I50A 4A4BA 2LDRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O70 A;  2KU3 A;  5FB1 A;  2CT2 A;  3SOW A;  2YUR A;  2KWK A;  2L80 A;  5D1L B;  4GNE A;  3V43 A;  1JOC A;  3N9L A;  2C2V S;  4B86 C;  1HYI A;  2YUC A;  4L58 A;  3N9P A;  3ZNI A;  3N9O A;  1E4U A;  2QIZ A;  3GV4 A;  3I2D A;  2XEU A;  4LAD B;  4BBQ A;  3U5O A;  1V87 A;  2YT5 A;  3SHB A;  3HTK C;  5FB0 A;  2EGP A;  2K4D A;  2YHN A;  3O34 A;  1HYJ A;  4S3O C;  5DKA A;  4ZQL A;  5TDR A;  5TBN A;  1U6G B;  4N3W A;  2PUY A;  2YU4 A;  1VYX A;  1WEM A;  3O7A A;  5B78 A;  2EOD A;  2HDP A;  3HCU A;  5J3X A;  2ECW A;  4UP0 A;  2VPB A;  2K1J A;  4FK5 A;  3C5K A;  3KV5 A;  2QJ0 A;  2LN0 A;  2K16 A;  4LLB A;  3L1Z B;  2JMJ A;  2Y1M A;  5AIU A;  1CHC A;  4MVT A;  5JG6 A;  2FUU A;  3LRQ A;  2ECT A;  4AVX A;  1F62 A;  2Y43 A;  2L43 A;  5H1U A;  2M6M A;  4YAB A;  4GNG A;  4FO9 A;  4PTB A;  3U5M A;  1LDK C;  3U5N A;  4O64 A;  5TRB A;  4PPE A;  4AYC A;  4CA1 A;  2KWN A;  2ECN A;  5KH7 A;  2ECG A;  5KH9 A;  4YBM A;  2FSA A;  5B8D A;  2KFT A;  3M63 A;  4LJN A;  4YAX A;  1K2F A;  2L75 A;  4NN2 A;  3ZVY A;  2MNZ A;  2YQM A;  5G05 B;  4IC3 A;  5C13 A;  4L7X A;  4I7D A;  2F42 A;  2RSD A;  2G45 A;  2KIZ A;  2YRE A;  1X4J A;  2KWO A;  5H1T A;  2EA6 A;  5DIN A;  4FJC A;  1BOR A;  3HCT A;  1WEV A;  2AN6 A;  3ZYQ A;  2MA5 A;  1WEE A;  1MM3 A;  1Z60 A;  3VK6 A;  2LGK A;  2JMD A;  4IC2 A;  4XI1 A;  2C2L A;  4S3O B;  5LKT A;  2OXQ C;  2H0D A;  1WIL A;  4YAT A;  5FER A;  4YC9 A;  3MHH A;  3T6R A;  2FUI A;  5B77 A;  1N87 A;  2G43 A;  4R8P K;  5C11 A;  2E6S A;  2LXH C;  4X3G A;  1WEU A;  1WEN A;  1IYM A;  4QF2 A;  5TAB A;  3SOU A;  1JM7 B;  4ZDT A;  2QIC A;  4GB0 A;  4CCG X;  3EB5 A;  4W4U A;  1FP0 A;  3LQI A;  2Y1N A;  5D1M B;  3KNV A;  4LKA A;  2VP7 A;  3ASL A;  5D1K B;  4B7Y C;  2BAY A;  2YQL A;  1VFY A;  2F6J A;  4GNF A;  4I7C A;  4R2Y A;  3ZVZ B;  2G6Q A;  4WA6 A;  3MHS A;  1G25 A;  3LQJ A;  2KR4 A;  1WGM A;  2XB1 A;  2CSZ A;  2H0D B;  1WES A;  5B75 A;  4A4C A;  4BHW A;  2M1R A;  1WIM A;  4GND A;  2MIQ A;  4LK9 A;  3T7L A;  5G0F A;  2MNY A;  3ZPV 1;  1RMD A;  1WE9 A;  3L1X A;  2LGV A;  3N9N A;  1WFK A;  2KRE A;  1VD4 A;  3NG2 A;  4P5O B;  2M3H A;  3EB6 A;  1WEW A;  1X4I A;  3ZTG A;  2NAA A;  2UZG A;  5LCW B;  4C9Z A;  4YBS A;  4FIP A;  2VJE A;  4YBT A;  3O36 A;  4V3L C;  2KYU A;  3M62 A;  3RPG B;  2DX8 A;  3HCS A;  2ZET C;  2IDA A;  2KE1 A;  2KWJ A;  2VPE A;  3O33 A;  2YSM A;  1WEQ A;  3IHP A;  1LDJ B;  1FBV A;  2RI7 A;  2PNX A;  2E6R A;  1ZBD B;  1JM7 A;  4AYC B;  3QZV A;  5B79 A;  2CKL A;  3LQH A;  5AIT A;  4UI9 B;  2MUM A;  2LV9 A;  1X4U A;  2YHO A;  4A49 A;  4WZ3 B;  2LGL A;  1DVP A;  2ECI A;  4AP4 A;  2LGG A;  4MSX A;  3PHD A;  2CSY A;  2L5U A;  3DQV R;  5FEY A;  2LRI C;  2K17 A;  4A0C D;  2KGI A;  5EYA F;  5G04 B;  5LKX A;  2LQ6 A;  5TDW A;  2VJF B;  2M85 A;  3RTR B;  3M99 A;  4YAD A;  3FL2 A;  1WEO A;  3N9Q A;  4F52 B;  3PUQ A;  2JMI A;  4V3K C;  1Z6U A;  1MM2 A;  3KQI A;  3O37 A;  3KV6 A;  4N4F A;  1XWH A;  2YSJ A;  3L11 A;  2LXP C;  2YW8 A;  4I7B A;  4AUQ B;  2L0B A;  4ZUX U;  3O35 A;  4WZ2 A;  2VJE B;  1T1H A;  4TKP B;  5KH3 A;  1Z2Q A;  2VPG A;  5H9M A;  4Q6F A;  2CKL B;  2HYE D;  2VNF A;  4UP5 A;  2ECJ A;  3PUR A;  3RPG C;  4QF3 A;  2KGG A;  2MT5 A;  3GL6 A;  5I3L A;  5LKZ A;  2MD7 B;  2VPD A;  2D8S A;  2MD8 C;  2MA6 A;  4R7E A;  3N9M A;  4WZ0 A;  3U5P A;  2JRJ A;  2ECV A;  2YYR A;  3SOX A;  5B76 A;  5H1V A;  5LKU A;  2VJF A;  1WEP A;  2F6N A;  3C6W A;  3DPL R;  3ZPV E;  2I50 A;  4A4B A;  2LDR A; 
#chains in the Genus database with same CATH topology
 3O70 A;  4Z0O A;  2KU3 A;  5FB1 A;  2CT2 A;  3SOW A;  2YUR A;  2DJA A;  2KWK A;  2L80 A;  5D1L B;  4GNE A;  3V43 A;  1JOC A;  3N9L A;  2C2V S;  4B86 C;  4QQ4 A;  1HYI A;  2YUC A;  5SVI A;  4L58 A;  5SVX A;  3N9P A;  3ZNI A;  3N9O A;  1E4U A;  2QIZ A;  3GV4 A;  3I2D A;  2XEU A;  4LAD B;  4BBQ A;  3U5O A;  1V87 A;  2YT5 A;  3SHB A;  3HTK C;  5FB0 A;  4H9D A;  2EGP A;  2K4D A;  2YHN A;  3JUE A;  3O34 A;  1HYJ A;  4S3O C;  5DKA A;  4ZQL A;  5TDR A;  5TBN A;  1U6G B;  4N3W A;  2PUY A;  2YU4 A;  1VYX A;  1WEM A;  3O7A A;  2CRW A;  5B78 A;  2EOD A;  2HDP A;  3HCU A;  3LVR E;  5J3X A;  2ECW A;  4UP0 A;  2VPB A;  2K1J A;  4FK5 A;  3C5K A;  3KV5 A;  2QJ0 A;  2LN0 A;  2K16 A;  4LLB A;  3L1Z B;  2JMJ A;  2Y1M A;  5AIU A;  1CHC A;  2P57 A;  4MVT A;  2CON A;  5JG6 A;  2FFW A;  2FUU A;  3LRQ A;  2ECT A;  3SUB A;  4AVX A;  1F62 A;  2Y43 A;  2L43 A;  5H1U A;  2M6M A;  4YAB A;  4GNG A;  3DDT A;  4FO9 A;  1DCQ A;  4PTB A;  3U5M A;  1LDK C;  3U5N A;  2RR4 A;  2E61 A;  4O64 A;  5TRB A;  4PPE A;  4AYC A;  4CA1 A;  2KWN A;  2ECN A;  5KH7 A;  2ECG A;  5KH9 A;  2XOC A;  4YBM A;  2FSA A;  5B8D A;  2KFT A;  3LVQ E;  3M63 A;  4LJN A;  4YAX A;  1K2F A;  2L75 A;  3FAO A;  4NN2 A;  3ZVY A;  2MNZ A;  2YQM A;  5G05 B;  4IC3 A;  5C13 A;  4L7X A;  4I7D A;  2F42 A;  2RSD A;  2G45 A;  2KIZ A;  2YRE A;  1X4J A;  2KWO A;  5H1T A;  2EA6 A;  5DIN A;  4FJC A;  1BOR A;  3HCT A;  1WEV A;  2AN6 A;  3ZYQ A;  2MA5 A;  1WEE A;  1MM3 A;  1Z60 A;  3VK6 A;  3FAN A;  2EXU A;  2KKX A;  2LGK A;  2JMD A;  4IC2 A;  4XI1 A;  2C2L A;  4S3O B;  5LKT A;  2OXQ C;  2H0D A;  1WIL A;  4YAT A;  5FER A;  2DSM A;  4YC9 A;  3MHH A;  3T6R A;  2YVR A;  4F1P A;  2FUI A;  5B77 A;  1N87 A;  3E2D A;  2G43 A;  4R8P K;  5C11 A;  2E6S A;  2JUN A;  2LXH C;  2M13 A;  4X3G A;  1WEU A;  1WEN A;  1IYM A;  4QF2 A;  5TAB A;  3SOU A;  3Q1D A;  1JM7 B;  4ZDT A;  2QIC A;  4GB0 A;  4CCG X;  3EB5 A;  4W4U A;  2L7P A;  1FP0 A;  3FJU B;  3LQI A;  2Y1N A;  5D1M B;  3KNV A;  4LKA A;  2VP7 A;  3ASL A;  5D1K B;  4B7Y C;  2BAY A;  2YQL A;  1VFY A;  2F6J A;  4GNF A;  4I7C A;  4R2Y A;  3ZVZ B;  2G6Q A;  4WA6 A;  3MHS A;  1G25 A;  3LQJ A;  2KR4 A;  1WGM A;  5SVY A;  2XB1 A;  2CSZ A;  1WES A;  2H0D B;  5B75 A;  4A4C A;  4BHW A;  2M1R A;  1WIM A;  4GND A;  2MIQ A;  2KKY A;  4LK9 A;  4Z0R A;  3T7L A;  5G0F A;  2B0O E;  2MNY A;  3ZPV 1;  3O47 A;  1RMD A;  1WE9 A;  3L1X A;  2LGV A;  3N9N A;  3MDB C;  1WFK A;  2KRE A;  1VD4 A;  3NG2 A;  4P5O B;  2M3H A;  3EB6 A;  1WEW A;  1X4I A;  3LJU X;  3ZTG A;  2NAA A;  2UZG A;  5LCW B;  3M7K A;  4C9Z A;  4YBS A;  2XOY A;  2JM3 A;  4FIP A;  2VJE A;  3PLW A;  4YBT A;  3O36 A;  3DWD A;  4V3L C;  2KYU A;  3T9K A;  3M62 A;  3RPG B;  2DX8 A;  3HCS A;  2ZET C;  2IDA A;  2KE1 A;  2KWJ A;  2VPE A;  3O33 A;  2MKE A;  2YSM A;  1WEQ A;  3IHP A;  5SVI B;  1LDJ B;  1FBV A;  2RI7 A;  2PNX A;  2E6R A;  1ZBD B;  1JM7 A;  4AYC B;  2XOZ A;  3FM8 C;  3QZV A;  1MBM A;  5B79 A;  2CKL A;  3LQH A;  5AIT A;  4UI9 B;  2MUM A;  2LV9 A;  1X4U A;  2FD4 A;  2YHO A;  4A49 A;  4WZ3 B;  2LGL A;  1DVP A;  2ECI A;  4AP4 A;  2LGG A;  4MSX A;  3PHD A;  2CSY A;  2L5U A;  3DQV R;  5FEY A;  2LRI C;  2K17 A;  4A0C D;  2KGI A;  5EYA F;  5G04 B;  5LKX A;  2LQ6 A;  5TDW A;  4O62 A;  2VJF B;  2M85 A;  3RTR B;  3M99 A;  4OGE A;  4YAD A;  3FL2 A;  1WEO A;  3N9Q A;  2CRR A;  4F52 B;  3PUQ A;  3LDY A;  2JMI A;  4V3K C;  1Z6U A;  1MM2 A;  3KQI A;  3O37 A;  3KV6 A;  4N4F A;  1XWH A;  2YSJ A;  3FEH A;  3L11 A;  2IQJ A;  2LXP C;  2YW8 A;  4I7B A;  2OWA A;  3H7H A;  4AUQ B;  2L0B A;  4ZUX U;  2LAU A;  3O35 A;  5K3Q A;  4WZ2 A;  2EGM A;  2D8U A;  2VJE B;  1T1H A;  4TKP B;  5KH3 A;  1Z2Q A;  2VPG A;  5H9M A;  4Q6F A;  2CKL B;  2HYE D;  2VNF A;  4UP5 A;  2ECJ A;  3PUR A;  3RPG C;  4QF3 A;  2KGG A;  2MT5 A;  3GL6 A;  4OGC A;  5I3L A;  5LKZ A;  2MD7 B;  2VPD A;  2D8S A;  2MD8 C;  2MA6 A;  4R7E A;  2CSV A;  3N9M A;  4WZ0 A;  3U5P A;  2JRJ A;  2ECV A;  2YYR A;  3SOX A;  5B76 A;  5H1V A;  5LKU A;  2VJF A;  1WEP A;  2F6N A;  3C6W A;  3DPL R;  3ZPV E;  2I50 A;  3KDE C;  4A4B A;  2LDR A;  2XP0 A; 
#chains in the Genus database with same CATH homology
 3O70 A;  2KU3 A;  5FB1 A;  2CT2 A;  3SOW A;  2YUR A;  2KWK A;  2L80 A;  5D1L B;  4GNE A;  3V43 A;  1JOC A;  3N9L A;  2C2V S;  4B86 C;  1HYI A;  2YUC A;  4L58 A;  3N9P A;  3ZNI A;  3N9O A;  1E4U A;  2QIZ A;  3GV4 A;  3I2D A;  2XEU A;  4LAD B;  4BBQ A;  3U5O A;  1V87 A;  2YT5 A;  3SHB A;  3HTK C;  5FB0 A;  2EGP A;  2K4D A;  2YHN A;  3O34 A;  1HYJ A;  4S3O C;  5DKA A;  4ZQL A;  5TDR A;  5TBN A;  1U6G B;  4N3W A;  2PUY A;  2YU4 A;  1VYX A;  1WEM A;  3O7A A;  5B78 A;  2EOD A;  2HDP A;  3HCU A;  5J3X A;  2ECW A;  4UP0 A;  2VPB A;  2K1J A;  4FK5 A;  3C5K A;  3KV5 A;  2QJ0 A;  2LN0 A;  2K16 A;  4LLB A;  3L1Z B;  2JMJ A;  2Y1M A;  5AIU A;  1CHC A;  4MVT A;  5JG6 A;  2FUU A;  3LRQ A;  2ECT A;  4AVX A;  1F62 A;  2Y43 A;  2L43 A;  5H1U A;  2M6M A;  4YAB A;  4GNG A;  4FO9 A;  4PTB A;  3U5M A;  1LDK C;  3U5N A;  4O64 A;  5TRB A;  4PPE A;  4AYC A;  4CA1 A;  2KWN A;  2ECN A;  5KH7 A;  2ECG A;  5KH9 A;  4YBM A;  2FSA A;  5B8D A;  2KFT A;  3M63 A;  4LJN A;  4YAX A;  1K2F A;  2L75 A;  4NN2 A;  3ZVY A;  2MNZ A;  2YQM A;  5G05 B;  4IC3 A;  5C13 A;  4L7X A;  4I7D A;  2F42 A;  2RSD A;  2G45 A;  2KIZ A;  2YRE A;  1X4J A;  2KWO A;  5H1T A;  2EA6 A;  5DIN A;  4FJC A;  1BOR A;  3HCT A;  1WEV A;  2AN6 A;  3ZYQ A;  2MA5 A;  1WEE A;  1MM3 A;  1Z60 A;  3VK6 A;  2LGK A;  2JMD A;  4IC2 A;  4XI1 A;  2C2L A;  4S3O B;  5LKT A;  2OXQ C;  2H0D A;  1WIL A;  4YAT A;  5FER A;  4YC9 A;  3MHH A;  3T6R A;  2FUI A;  5B77 A;  1N87 A;  2G43 A;  4R8P K;  5C11 A;  2E6S A;  2LXH C;  4X3G A;  1WEU A;  1WEN A;  1IYM A;  4QF2 A;  5TAB A;  3SOU A;  1JM7 B;  4ZDT A;  2QIC A;  4GB0 A;  4CCG X;  3EB5 A;  4W4U A;  1FP0 A;  3LQI A;  2Y1N A;  5D1M B;  3KNV A;  4LKA A;  2VP7 A;  3ASL A;  5D1K B;  4B7Y C;  2BAY A;  2YQL A;  1VFY A;  2F6J A;  4GNF A;  4I7C A;  4R2Y A;  3ZVZ B;  2G6Q A;  4WA6 A;  3MHS A;  1G25 A;  3LQJ A;  2KR4 A;  1WGM A;  2XB1 A;  2CSZ A;  2H0D B;  1WES A;  5B75 A;  4A4C A;  4BHW A;  2M1R A;  1WIM A;  4GND A;  2MIQ A;  4LK9 A;  3T7L A;  5G0F A;  2MNY A;  3ZPV 1;  1RMD A;  1WE9 A;  3L1X A;  2LGV A;  3N9N A;  1WFK A;  2KRE A;  1VD4 A;  3NG2 A;  4P5O B;  2M3H A;  3EB6 A;  1WEW A;  1X4I A;  3ZTG A;  2NAA A;  2UZG A;  5LCW B;  4C9Z A;  4YBS A;  4FIP A;  2VJE A;  4YBT A;  3O36 A;  4V3L C;  2KYU A;  3M62 A;  3RPG B;  2DX8 A;  3HCS A;  2ZET C;  2IDA A;  2KE1 A;  2KWJ A;  2VPE A;  3O33 A;  2YSM A;  1WEQ A;  3IHP A;  1LDJ B;  1FBV A;  2RI7 A;  2PNX A;  2E6R A;  1ZBD B;  1JM7 A;  4AYC B;  3QZV A;  5B79 A;  2CKL A;  3LQH A;  5AIT A;  4UI9 B;  2MUM A;  2LV9 A;  1X4U A;  2YHO A;  4A49 A;  4WZ3 B;  2LGL A;  1DVP A;  2ECI A;  4AP4 A;  2LGG A;  4MSX A;  3PHD A;  2CSY A;  2L5U A;  3DQV R;  5FEY A;  2LRI C;  2K17 A;  4A0C D;  2KGI A;  5EYA F;  5G04 B;  5LKX A;  2LQ6 A;  5TDW A;  2VJF B;  2M85 A;  3RTR B;  3M99 A;  4YAD A;  3FL2 A;  1WEO A;  3N9Q A;  4F52 B;  3PUQ A;  2JMI A;  4V3K C;  1Z6U A;  1MM2 A;  3KQI A;  3O37 A;  3KV6 A;  4N4F A;  1XWH A;  2YSJ A;  3L11 A;  2LXP C;  2YW8 A;  4I7B A;  4AUQ B;  2L0B A;  4ZUX U;  3O35 A;  4WZ2 A;  2VJE B;  1T1H A;  4TKP B;  5KH3 A;  1Z2Q A;  2VPG A;  5H9M A;  4Q6F A;  2CKL B;  2HYE D;  2VNF A;  4UP5 A;  2ECJ A;  3PUR A;  3RPG C;  4QF3 A;  2KGG A;  2MT5 A;  3GL6 A;  5I3L A;  5LKZ A;  2MD7 B;  2VPD A;  2D8S A;  2MD8 C;  2MA6 A;  4R7E A;  3N9M A;  4WZ0 A;  3U5P A;  2JRJ A;  2ECV A;  2YYR A;  3SOX A;  5B76 A;  5H1V A;  5LKU A;  2VJF A;  1WEP A;  2F6N A;  3C6W A;  3DPL R;  3ZPV E;  2I50 A;  4A4B A;  2LDR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...