1XWHA

Nmr structure of the first phd finger of autoimmune regulator protein (aire1): insights into apeced
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
66
structure length
66
Chain Sequence
GAMAQKNEDECAVCRDGGELICCDGCPRAFHLACLSPPLREIPSGTWRCSSCLQATVQEVQPRAEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Autoimmune regulator
publication title NMR structure of the first PHD finger of autoimmune regulator protein (AIRE1). Insights into autoimmune polyendocrinopathy-candidiasis-ectodermal dystrophy (APECED) disease
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 4
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2004-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1xwhA00
5H1TA 1VD4A 2KFTA 5KH7A 1V87A 2ECGA 3L11A 2PNXA 3DPLR 2EA6A 4NN2A 2KU3A 1JM7A 2YYRA 1MM3A 2ECIA 4FIPA 2FUUA 1G25A 2KREA 1XWHA 5C11A 2YREA 3KQIA 2KWNA 4AP4A 5LKTA 2M1RA 5LKZA 4A0CD 4QF2A 3VK6A 3KV5A 5TDRA 2YUCA 2I50A 4LJNA 5TDWA 3N9LA 3ZPV1 4LLBA 2L43A 2VJFB 2CKLA 2Y1NA 3ZPVE 5AITA 1WEOA 5G0FA 2C2LA 2YW8A 1FP0A 2LN0A 4N3WA 4I7DA 2M85A 4GNEA 5LCWB 2MA5A 3MHHA 3LQIA 1MM2A 2LGLA 2C2VS 5B8DA 2ECVA 5FB0A 3NG2A 2MNZA 5B75A 2VJFA 4A49A 2YSMA 2MD7B 3LQHA 2DX8A 4WA6A 2PUYA 4YBTA 3U5MA 5C13A 3O37A 4IC2A 4R2YA 2KWOA 5KH3A 2F42A 4X3GA 4UI9B 4A4BA 5EYAF 3IHPA 1WIMA 3PURA 4S3OB 1VYXA 2ECTA 4UP0A 1U6GB 2LRIC 4N4FA 3MHSA 1X4UA 2QJ0A 3O34A 4IC3A 4B7YC 2YT5A 2H0DB 3PUQA 4QF3A 1ZBDB 3O33A 2YU4A 5I3LA 2G45A 5B77A 2LQ6A 4V3KC 2E6SA 5LKXA 3L1XA 4B86C 1WEVA 2JMIA 2M6MA 1K2FA 3SHBA 2VP7A 3LRQA 4GNGA 4GB0A 3DQVR 5TABA 2VNFA 2YQLA 3C6WA 1N87A 4L58A 2D8SA 1WEQA 4AUQB 2KR4A 4BBQA 1BORA 3ZYQA 3RTRB 2H0DA 5B78A 4YC9A 5B76A 3GL6A 5H9MA 1WEMA 5G04B 1WILA 2KIZA 1F62A 2HDPA 5AIUA 5DKAA 5DINA 3N9QA 3LQJA 2K1JA 1HYJA 4F52B 2LGKA 1Z60A 2G43A 4YABA 1WEWA 4C9ZA 3EB6A 2Y43A 2LGGA 3ZNIA 3EB5A 4MVTA 2CSYA 2ECJA 2VJEB 2QIZA 4FO9A 4AYCB 2UZGA 5JG6A 2KWKA 1WEPA 2AN6A 2L80A 1X4IA 1T1HA 2F6JA 3KNVA 4I7CA 4FK5A 3T7LA 1LDJB 2MA6A 4GNFA 3QZVA 3RPGB 4CCGX 2YSJA 2G6QA 1WE9A 2HYED 2LXPC 2EGPA 3N9NA 3N9OA 2L0BA 2MUMA 3M63A 3PHDA 2NAAA 3U5OA 2JRJA 4Q6FA 4YADA 2KGGA 4YBMA 2BAYA 4P5OB 3I2DA 4AYCA 1JM7B 2KYUA 3N9PA 3ASLA 1CHCA 5FEYA 1WGMA 3HCTA 2FSAA 4WZ2A 4R7EA 1X4JA 4WZ0A 2KE1A 2K16A 2L5UA 5FB1A 4ZQLA 3SOWA 3FL2A 2K4DA 4O64A 4BHWA 4TKPB 1WEUA 3M62A 2VPGA 4PTBA 1WEEA 2MNYA 4R8PK 1WFKA 2JMJA 5TBNA 4V3LC 1Z6UA 2CKLB 3ZVZB 4ZUXU 3L1ZB 4XI1A 1Z2QA 4YBSA 2ECNA 4GNDA 5D1LB 5B79A 2LV9A 4LKAA 3ZVYA 4PPEA 5H1VA 2VPBA 5TRBA 3U5PA 1WESA 3O70A 2FUIA 3V43A 2CSZA 4LK9A 3ZTGA 5J3XA 4A4CA 4ZDTA 5KH9A 5D1KB 4I7BA 2LGVA 2LXHC 1DVPA 2CT2A 3U5NA 3RPGC 2MIQA 2MT5A 4FJCA 3C5KA 2EODA 1FBVA 2ECWA 2RI7A 3HCUA 5G05B 2VPEA 2YHOA 2QICA 2IDAA 2YHNA 2KGIA 4UP5A 3O36A 2XEUA 5LKUA 4S3OC 2RSDA 3T6RA 3GV4A 5D1MB 3O35A 2ZETC 2YURA 2LDRA 5H1UA 4YAXA 2JMDA 1E4UA 4L7XA 1LDKC 5FERA 4AVXA 1VFYA 2XB1A 1WENA 1JOCA 4LADB 1RMDA 3M99A 2VJEA 1HYIA 4W4UA 4CA1A 3SOUA 2F6NA 3SOXA 2M3HA 3N9MA 4WZ3B 2MD8C 3HTKC 2E6RA 2K17A 4YATA 3KV6A 3O7AA 2OXQC 3HCSA 2Y1MA 4MSXA 2KWJA 2YQMA 2L75A 1IYMA 2VPDA
chains in the Genus database with same CATH superfamily
5H1TA 1VD4A 2KFTA 5KH7A 1V87A 2ECGA 3L11A 2PNXA 3DPLR 2EA6A 4NN2A 3LJUX 2KU3A 1JM7A 2YYRA 4Z0RA 1MM3A 2ECIA 4FIPA 2FUUA 1G25A 2KREA 1XWHA 5C11A 2CRWA 2YREA 3KQIA 2KWNA 4AP4A 5LKTA 2M1RA 5LKZA 4A0CD 4QF2A 3VK6A 3KV5A 5TDRA 2YUCA 2I50A 4LJNA 5TDWA 3N9LA 3LVRE 3ZPV1 4LLBA 2L43A 2VJFB 2CKLA 2Y1NA 2D8UA 1DCQA 3ZPVE 2XOYA 5AITA 1WEOA 4OGCA 5G0FA 2C2LA 2YW8A 1FP0A 2LN0A 3JUEA 4I7DA 4N3WA 2M85A 4GNEA 5LCWB 2MA5A 3MHHA 3LQIA 5SVXA 1MM2A 2LGLA 2C2VS 5B8DA 2ECVA 5FB0A 3NG2A 2MNZA 2CONA 5B75A 2VJFA 2LAUA 4A49A 2YSMA 3E2DA 2MD7B 3LQHA 2DX8A 4WA6A 2PUYA 4YBTA 3U5MA 5C13A 3O37A 2YVRA 4IC2A 4R2YA 2KWOA 5KH3A 2F42A 2L7PA 4X3GA 4UI9B 4A4BA 5EYAF 3IHPA 3T9KA 1WIMA 3PURA 4S3OB 1VYXA 2ECTA 4UP0A 3H7HA 1U6GB 2LRIC 4N4FA 3MHSA 1X4UA 2QJ0A 3O34A 4IC3A 3FEHA 4B7YC 2YT5A 2H0DB 2P57A 3PUQA 4QF3A 1ZBDB 3O33A 2YU4A 3MDBC 5I3LA 2G45A 5B77A 2LQ6A 4V3KC 2E6SA 3O47A 2RR4A 5LKXA 3L1XA 4B86C 1WEVA 2JMIA 2M6MA 1K2FA 3SHBA 3LVQE 2VP7A 3LRQA 4GNGA 4GB0A 3DQVR 5TABA 2VNFA 2YQLA 3C6WA 1N87A 4L58A 2D8SA 1WEQA 4AUQB 2KR4A 4BBQA 1BORA 3ZYQA 3RTRB 2H0DA 5B78A 4YC9A 5SVYA 5B76A 2KKYA 3GL6A 2FD4A 5H9MA 1WEMA 5G04B 3FJUB 1WILA 2KIZA 1F62A 2HDPA 5AIUA 5DKAA 5DINA 4OGEA 3N9QA 3LQJA 2K1JA 1HYJA 4F52B 4Z0OA 2LGKA 1Z60A 2G43A 3FM8C 4YABA 4QQ4A 2M13A 1WEWA 4C9ZA 3EB6A 2EGMA 2Y43A 2LGGA 3ZNIA 3EB5A 4MVTA 2CSYA 2XOCA 2ECJA 2VJEB 2QIZA 4FO9A 4AYCB 2UZGA 5JG6A 2KWKA 1WEPA 2AN6A 2L80A 1X4IA 1T1HA 3SUBA 2F6JA 3KNVA 4I7CA 4FK5A 3T7LA 1LDJB 3LDYA 2MA6A 4GNFA 3QZVA 5SVIB 3RPGB 4CCGX 2YSJA 2G6QA 1WE9A 2KKXA 2HYED 2LXPC 2EGPA 3N9NA 3N9OA 2L0BA 2MUMA 3M63A 3PHDA 3DWDA 2JUNA 2NAAA 3FANA 3U5OA 2JRJA 4Q6FA 3DDTA 4YADA 2B0OE 3KDEC 2KGGA 4YBMA 2BAYA 4P5OB 3I2DA 4AYCA 1JM7B 2DJAA 2JM3A 2KYUA 4F1PA 3N9PA 3ASLA 1CHCA 5FEYA 1WGMA 5SVIA 3HCTA 2FSAA 4WZ2A 4R7EA 2FFWA 1X4JA 4WZ0A 2KE1A 2K16A 2L5UA 5FB1A 4ZQLA 3SOWA 3FL2A 2K4DA 4O64A 2XP0A 4BHWA 4TKPB 1WEUA 3M62A 2CSVA 2VPGA 4PTBA 4O62A 1WEEA 2MNYA 4R8PK 1WFKA 2JMJA 5TBNA 5K3QA 4V3LC 1MBMA 1Z6UA 2CKLB 3ZVZB 4ZUXU 3L1ZB 2XOZA 4XI1A 1Z2QA 4YBSA 3Q1DA 2ECNA 4GNDA 5D1LB 5B79A 2LV9A 2E61A 4LKAA 3ZVYA 4PPEA 5H1VA 2VPBA 5TRBA 4H9DA 2MKEA 3U5PA 1WESA 3O70A 2FUIA 3V43A 2CSZA 4LK9A 3ZTGA 5J3XA 4A4CA 4ZDTA 2DSMA 5KH9A 2EXUA 5D1KB 4I7BA 2LGVA 2LXHC 1DVPA 2CT2A 3U5NA 3RPGC 2MIQA 2MT5A 4FJCA 3C5KA 2IQJA 2EODA 1FBVA 2ECWA 2RI7A 3HCUA 5G05B 2VPEA 2YHOA 2QICA 2IDAA 2YHNA 2KGIA 4UP5A 3O36A 2XEUA 5LKUA 4S3OC 2RSDA 3T6RA 2CRRA 3GV4A 5D1MB 3O35A 2ZETC 2YURA 3M7KA 2LDRA 5H1UA 4YAXA 2JMDA 1E4UA 4L7XA 1LDKC 5FERA 4AVXA 1VFYA 2XB1A 3FAOA 1WENA 1JOCA 3PLWA 4LADB 1RMDA 3M99A 2VJEA 1HYIA 4W4UA 4CA1A 3SOUA 2F6NA 2OWAA 3SOXA 2M3HA 3N9MA 4WZ3B 2MD8C 3HTKC 2E6RA 2K17A 4YATA 3KV6A 3O7AA 2OXQC 3HCSA 2Y1MA 4MSXA 2KWJA 2YQMA 2L75A 1IYMA 2VPDA
chains in the Genus database with same CATH topology
5H1TA 1VD4A 2KFTA 5KH7A 1V87A 2ECGA 3L11A 2PNXA 3DPLR 2EA6A 4NN2A 2KU3A 1JM7A 2YYRA 1MM3A 2ECIA 4FIPA 2FUUA 1G25A 2KREA 1XWHA 5C11A 2YREA 3KQIA 2KWNA 4AP4A 5LKTA 2M1RA 5LKZA 4A0CD 4QF2A 3VK6A 3KV5A 5TDRA 2YUCA 2I50A 4LJNA 5TDWA 3N9LA 3ZPV1 4LLBA 2L43A 2VJFB 2CKLA 2Y1NA 3ZPVE 5AITA 1WEOA 5G0FA 2C2LA 2YW8A 1FP0A 2LN0A 4N3WA 4I7DA 2M85A 4GNEA 5LCWB 2MA5A 3MHHA 3LQIA 1MM2A 2LGLA 2C2VS 5B8DA 2ECVA 5FB0A 3NG2A 2MNZA 5B75A 2VJFA 4A49A 2YSMA 2MD7B 3LQHA 2DX8A 4WA6A 2PUYA 4YBTA 3U5MA 5C13A 3O37A 4IC2A 4R2YA 2KWOA 5KH3A 2F42A 4X3GA 4UI9B 4A4BA 5EYAF 3IHPA 1WIMA 3PURA 4S3OB 1VYXA 2ECTA 4UP0A 1U6GB 2LRIC 4N4FA 3MHSA 1X4UA 2QJ0A 3O34A 4IC3A 4B7YC 2YT5A 2H0DB 3PUQA 4QF3A 1ZBDB 3O33A 2YU4A 5I3LA 2G45A 5B77A 2LQ6A 4V3KC 2E6SA 5LKXA 3L1XA 4B86C 1WEVA 2JMIA 2M6MA 1K2FA 3SHBA 2VP7A 3LRQA 4GNGA 4GB0A 3DQVR 5TABA 2VNFA 2YQLA 3C6WA 1N87A 4L58A 2D8SA 1WEQA 4AUQB 2KR4A 4BBQA 1BORA 3ZYQA 3RTRB 2H0DA 5B78A 4YC9A 5B76A 3GL6A 5H9MA 1WEMA 5G04B 1WILA 2KIZA 1F62A 2HDPA 5AIUA 5DKAA 5DINA 3N9QA 3LQJA 2K1JA 1HYJA 4F52B 2LGKA 1Z60A 2G43A 4YABA 1WEWA 4C9ZA 3EB6A 2Y43A 2LGGA 3ZNIA 3EB5A 4MVTA 2CSYA 2ECJA 2VJEB 2QIZA 4FO9A 4AYCB 2UZGA 5JG6A 2KWKA 1WEPA 2AN6A 2L80A 1X4IA 1T1HA 2F6JA 3KNVA 4I7CA 4FK5A 3T7LA 1LDJB 2MA6A 4GNFA 3QZVA 3RPGB 4CCGX 2YSJA 2G6QA 1WE9A 2HYED 2LXPC 2EGPA 3N9NA 3N9OA 2L0BA 2MUMA 3M63A 3PHDA 2NAAA 3U5OA 2JRJA 4Q6FA 4YADA 2KGGA 4YBMA 2BAYA 4P5OB 3I2DA 4AYCA 1JM7B 2KYUA 3N9PA 3ASLA 1CHCA 5FEYA 1WGMA 3HCTA 2FSAA 4WZ2A 4R7EA 1X4JA 4WZ0A 2KE1A 2K16A 2L5UA 5FB1A 4ZQLA 3SOWA 3FL2A 2K4DA 4O64A 4BHWA 4TKPB 1WEUA 3M62A 2VPGA 4PTBA 1WEEA 2MNYA 4R8PK 1WFKA 2JMJA 5TBNA 4V3LC 1Z6UA 2CKLB 3ZVZB 4ZUXU 3L1ZB 4XI1A 1Z2QA 4YBSA 2ECNA 4GNDA 5D1LB 5B79A 2LV9A 4LKAA 3ZVYA 4PPEA 5H1VA 2VPBA 5TRBA 3U5PA 1WESA 3O70A 2FUIA 3V43A 2CSZA 4LK9A 3ZTGA 5J3XA 4A4CA 4ZDTA 5KH9A 5D1KB 4I7BA 2LGVA 2LXHC 1DVPA 2CT2A 3U5NA 3RPGC 2MIQA 2MT5A 4FJCA 3C5KA 2EODA 1FBVA 2ECWA 2RI7A 3HCUA 5G05B 2VPEA 2YHOA 2QICA 2IDAA 2YHNA 2KGIA 4UP5A 3O36A 2XEUA 5LKUA 4S3OC 2RSDA 3T6RA 3GV4A 5D1MB 3O35A 2ZETC 2YURA 2LDRA 5H1UA 4YAXA 2JMDA 1E4UA 4L7XA 1LDKC 5FERA 4AVXA 1VFYA 2XB1A 1WENA 1JOCA 4LADB 1RMDA 3M99A 2VJEA 1HYIA 4W4UA 4CA1A 3SOUA 2F6NA 3SOXA 2M3HA 3N9MA 4WZ3B 2MD8C 3HTKC 2E6RA 2K17A 4YATA 3KV6A 3O7AA 2OXQC 3HCSA 2Y1MA 4MSXA 2KWJA 2YQMA 2L75A 1IYMA 2VPDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H1T A;  1VD4 A;  2KFT A;  5KH7 A;  1V87 A;  2ECG A;  3L11 A;  2PNX A;  3DPL R;  2EA6 A;  4NN2 A;  2KU3 A;  1JM7 A;  2YYR A;  1MM3 A;  2ECI A;  4FIP A;  2FUU A;  1G25 A;  2KRE A;  1XWH A;  5C11 A;  2YRE A;  3KQI A;  2KWN A;  4AP4 A;  5LKT A;  2M1R A;  5LKZ A;  4A0C D;  4QF2 A;  3VK6 A;  3KV5 A;  5TDR A;  2YUC A;  2I50 A;  4LJN A;  5TDW A;  3N9L A;  3ZPV 1;  4LLB A;  2L43 A;  2VJF B;  2CKL A;  2Y1N A;  3ZPV E;  5AIT A;  1WEO A;  5G0F A;  2C2L A;  2YW8 A;  1FP0 A;  2LN0 A;  4N3W A;  4I7D A;  2M85 A;  4GNE A;  5LCW B;  2MA5 A;  3MHH A;  3LQI A;  1MM2 A;  2LGL A;  2C2V S;  5B8D A;  2ECV A;  5FB0 A;  3NG2 A;  2MNZ A;  5B75 A;  2VJF A;  4A49 A;  2YSM A;  2MD7 B;  3LQH A;  2DX8 A;  4WA6 A;  2PUY A;  4YBT A;  3U5M A;  5C13 A;  3O37 A;  4IC2 A;  4R2Y A;  2KWO A;  5KH3 A;  2F42 A;  4X3G A;  4UI9 B;  4A4B A;  5EYA F;  3IHP A;  1WIM A;  3PUR A;  4S3O B;  1VYX A;  2ECT A;  4UP0 A;  1U6G B;  2LRI C;  4N4F A;  3MHS A;  1X4U A;  2QJ0 A;  3O34 A;  4IC3 A;  4B7Y C;  2YT5 A;  2H0D B;  3PUQ A;  4QF3 A;  1ZBD B;  3O33 A;  2YU4 A;  5I3L A;  2G45 A;  5B77 A;  2LQ6 A;  4V3K C;  2E6S A;  5LKX A;  3L1X A;  4B86 C;  1WEV A;  2JMI A;  2M6M A;  1K2F A;  3SHB A;  2VP7 A;  3LRQ A;  4GNG A;  4GB0 A;  3DQV R;  5TAB A;  2VNF A;  2YQL A;  3C6W A;  1N87 A;  4L58 A;  2D8S A;  1WEQ A;  4AUQ B;  2KR4 A;  4BBQ A;  1BOR A;  3ZYQ A;  3RTR B;  2H0D A;  5B78 A;  4YC9 A;  5B76 A;  3GL6 A;  5H9M A;  1WEM A;  5G04 B;  1WIL A;  2KIZ A;  1F62 A;  2HDP A;  5AIU A;  5DKA A;  5DIN A;  3N9Q A;  3LQJ A;  2K1J A;  1HYJ A;  4F52 B;  2LGK A;  1Z60 A;  2G43 A;  4YAB A;  1WEW A;  4C9Z A;  3EB6 A;  2Y43 A;  2LGG A;  3ZNI A;  3EB5 A;  4MVT A;  2CSY A;  2ECJ A;  2VJE B;  2QIZ A;  4FO9 A;  4AYC B;  2UZG A;  5JG6 A;  2KWK A;  1WEP A;  2AN6 A;  2L80 A;  1X4I A;  1T1H A;  2F6J A;  3KNV A;  4I7C A;  4FK5 A;  3T7L A;  1LDJ B;  2MA6 A;  4GNF A;  3QZV A;  3RPG B;  4CCG X;  2YSJ A;  2G6Q A;  1WE9 A;  2HYE D;  2LXP C;  2EGP A;  3N9N A;  3N9O A;  2L0B A;  2MUM A;  3M63 A;  3PHD A;  2NAA A;  3U5O A;  2JRJ A;  4Q6F A;  4YAD A;  2KGG A;  4YBM A;  2BAY A;  4P5O B;  3I2D A;  4AYC A;  1JM7 B;  2KYU A;  3N9P A;  3ASL A;  1CHC A;  5FEY A;  1WGM A;  3HCT A;  2FSA A;  4WZ2 A;  4R7E A;  1X4J A;  4WZ0 A;  2KE1 A;  2K16 A;  2L5U A;  5FB1 A;  4ZQL A;  3SOW A;  3FL2 A;  2K4D A;  4O64 A;  4BHW A;  4TKP B;  1WEU A;  3M62 A;  2VPG A;  4PTB A;  1WEE A;  2MNY A;  4R8P K;  1WFK A;  2JMJ A;  5TBN A;  4V3L C;  1Z6U A;  2CKL B;  3ZVZ B;  4ZUX U;  3L1Z B;  4XI1 A;  1Z2Q A;  4YBS A;  2ECN A;  4GND A;  5D1L B;  5B79 A;  2LV9 A;  4LKA A;  3ZVY A;  4PPE A;  5H1V A;  2VPB A;  5TRB A;  3U5P A;  1WES A;  3O70 A;  2FUI A;  3V43 A;  2CSZ A;  4LK9 A;  3ZTG A;  5J3X A;  4A4C A;  4ZDT A;  5KH9 A;  5D1K B;  4I7B A;  2LGV A;  2LXH C;  1DVP A;  2CT2 A;  3U5N A;  3RPG C;  2MIQ A;  2MT5 A;  4FJC A;  3C5K A;  2EOD A;  1FBV A;  2ECW A;  2RI7 A;  3HCU A;  5G05 B;  2VPE A;  2YHO A;  2QIC A;  2IDA A;  2YHN A;  2KGI A;  4UP5 A;  3O36 A;  2XEU A;  5LKU A;  4S3O C;  2RSD A;  3T6R A;  3GV4 A;  5D1M B;  3O35 A;  2ZET C;  2YUR A;  2LDR A;  5H1U A;  4YAX A;  2JMD A;  1E4U A;  4L7X A;  1LDK C;  5FER A;  4AVX A;  1VFY A;  2XB1 A;  1WEN A;  1JOC A;  4LAD B;  1RMD A;  3M99 A;  2VJE A;  1HYI A;  4W4U A;  4CA1 A;  3SOU A;  2F6N A;  3SOX A;  2M3H A;  3N9M A;  4WZ3 B;  2MD8 C;  3HTK C;  2E6R A;  2K17 A;  4YAT A;  3KV6 A;  3O7A A;  2OXQ C;  3HCS A;  2Y1M A;  4MSX A;  2KWJ A;  2YQM A;  2L75 A;  1IYM A;  2VPD A; 
#chains in the Genus database with same CATH topology
 5H1T A;  1VD4 A;  2KFT A;  5KH7 A;  1V87 A;  2ECG A;  3L11 A;  2PNX A;  3DPL R;  2EA6 A;  4NN2 A;  3LJU X;  2KU3 A;  1JM7 A;  2YYR A;  4Z0R A;  1MM3 A;  2ECI A;  4FIP A;  2FUU A;  1G25 A;  2KRE A;  1XWH A;  5C11 A;  2CRW A;  2YRE A;  3KQI A;  2KWN A;  4AP4 A;  5LKT A;  2M1R A;  5LKZ A;  4A0C D;  4QF2 A;  3VK6 A;  3KV5 A;  5TDR A;  2YUC A;  2I50 A;  4LJN A;  5TDW A;  3N9L A;  3LVR E;  3ZPV 1;  4LLB A;  2L43 A;  2VJF B;  2CKL A;  2Y1N A;  2D8U A;  1DCQ A;  3ZPV E;  2XOY A;  5AIT A;  1WEO A;  4OGC A;  5G0F A;  2C2L A;  2YW8 A;  1FP0 A;  2LN0 A;  3JUE A;  4I7D A;  4N3W A;  2M85 A;  4GNE A;  5LCW B;  2MA5 A;  3MHH A;  3LQI A;  5SVX A;  1MM2 A;  2LGL A;  2C2V S;  5B8D A;  2ECV A;  5FB0 A;  3NG2 A;  2MNZ A;  2CON A;  5B75 A;  2VJF A;  2LAU A;  4A49 A;  2YSM A;  3E2D A;  2MD7 B;  3LQH A;  2DX8 A;  4WA6 A;  2PUY A;  4YBT A;  3U5M A;  5C13 A;  3O37 A;  2YVR A;  4IC2 A;  4R2Y A;  2KWO A;  5KH3 A;  2F42 A;  2L7P A;  4X3G A;  4UI9 B;  4A4B A;  5EYA F;  3IHP A;  3T9K A;  1WIM A;  3PUR A;  4S3O B;  1VYX A;  2ECT A;  4UP0 A;  3H7H A;  1U6G B;  2LRI C;  4N4F A;  3MHS A;  1X4U A;  2QJ0 A;  3O34 A;  4IC3 A;  3FEH A;  4B7Y C;  2YT5 A;  2H0D B;  2P57 A;  3PUQ A;  4QF3 A;  1ZBD B;  3O33 A;  2YU4 A;  3MDB C;  5I3L A;  2G45 A;  5B77 A;  2LQ6 A;  4V3K C;  2E6S A;  3O47 A;  2RR4 A;  5LKX A;  3L1X A;  4B86 C;  1WEV A;  2JMI A;  2M6M A;  1K2F A;  3SHB A;  3LVQ E;  2VP7 A;  3LRQ A;  4GNG A;  4GB0 A;  3DQV R;  5TAB A;  2VNF A;  2YQL A;  3C6W A;  1N87 A;  4L58 A;  2D8S A;  1WEQ A;  4AUQ B;  2KR4 A;  4BBQ A;  1BOR A;  3ZYQ A;  3RTR B;  2H0D A;  5B78 A;  4YC9 A;  5SVY A;  5B76 A;  2KKY A;  3GL6 A;  2FD4 A;  5H9M A;  1WEM A;  5G04 B;  3FJU B;  1WIL A;  2KIZ A;  1F62 A;  2HDP A;  5AIU A;  5DKA A;  5DIN A;  4OGE A;  3N9Q A;  3LQJ A;  2K1J A;  1HYJ A;  4F52 B;  4Z0O A;  2LGK A;  1Z60 A;  2G43 A;  3FM8 C;  4YAB A;  4QQ4 A;  2M13 A;  1WEW A;  4C9Z A;  3EB6 A;  2EGM A;  2Y43 A;  2LGG A;  3ZNI A;  3EB5 A;  4MVT A;  2CSY A;  2XOC A;  2ECJ A;  2VJE B;  2QIZ A;  4FO9 A;  4AYC B;  2UZG A;  5JG6 A;  2KWK A;  1WEP A;  2AN6 A;  2L80 A;  1X4I A;  1T1H A;  3SUB A;  2F6J A;  3KNV A;  4I7C A;  4FK5 A;  3T7L A;  1LDJ B;  3LDY A;  2MA6 A;  4GNF A;  3QZV A;  5SVI B;  3RPG B;  4CCG X;  2YSJ A;  2G6Q A;  1WE9 A;  2KKX A;  2HYE D;  2LXP C;  2EGP A;  3N9N A;  3N9O A;  2L0B A;  2MUM A;  3M63 A;  3PHD A;  3DWD A;  2JUN A;  2NAA A;  3FAN A;  3U5O A;  2JRJ A;  4Q6F A;  3DDT A;  4YAD A;  2B0O E;  3KDE C;  2KGG A;  4YBM A;  2BAY A;  4P5O B;  3I2D A;  4AYC A;  1JM7 B;  2DJA A;  2JM3 A;  2KYU A;  4F1P A;  3N9P A;  3ASL A;  1CHC A;  5FEY A;  1WGM A;  5SVI A;  3HCT A;  2FSA A;  4WZ2 A;  4R7E A;  2FFW A;  1X4J A;  4WZ0 A;  2KE1 A;  2K16 A;  2L5U A;  5FB1 A;  4ZQL A;  3SOW A;  3FL2 A;  2K4D A;  4O64 A;  2XP0 A;  4BHW A;  4TKP B;  1WEU A;  3M62 A;  2CSV A;  2VPG A;  4PTB A;  4O62 A;  1WEE A;  2MNY A;  4R8P K;  1WFK A;  2JMJ A;  5TBN A;  5K3Q A;  4V3L C;  1MBM A;  1Z6U A;  2CKL B;  3ZVZ B;  4ZUX U;  3L1Z B;  2XOZ A;  4XI1 A;  1Z2Q A;  4YBS A;  3Q1D A;  2ECN A;  4GND A;  5D1L B;  5B79 A;  2LV9 A;  2E61 A;  4LKA A;  3ZVY A;  4PPE A;  5H1V A;  2VPB A;  5TRB A;  4H9D A;  2MKE A;  3U5P A;  1WES A;  3O70 A;  2FUI A;  3V43 A;  2CSZ A;  4LK9 A;  3ZTG A;  5J3X A;  4A4C A;  4ZDT A;  2DSM A;  5KH9 A;  2EXU A;  5D1K B;  4I7B A;  2LGV A;  2LXH C;  1DVP A;  2CT2 A;  3U5N A;  3RPG C;  2MIQ A;  2MT5 A;  4FJC A;  3C5K A;  2IQJ A;  2EOD A;  1FBV A;  2ECW A;  2RI7 A;  3HCU A;  5G05 B;  2VPE A;  2YHO A;  2QIC A;  2IDA A;  2YHN A;  2KGI A;  4UP5 A;  3O36 A;  2XEU A;  5LKU A;  4S3O C;  2RSD A;  3T6R A;  2CRR A;  3GV4 A;  5D1M B;  3O35 A;  2ZET C;  2YUR A;  3M7K A;  2LDR A;  5H1U A;  4YAX A;  2JMD A;  1E4U A;  4L7X A;  1LDK C;  5FER A;  4AVX A;  1VFY A;  2XB1 A;  3FAO A;  1WEN A;  1JOC A;  3PLW A;  4LAD B;  1RMD A;  3M99 A;  2VJE A;  1HYI A;  4W4U A;  4CA1 A;  3SOU A;  2F6N A;  2OWA A;  3SOX A;  2M3H A;  3N9M A;  4WZ3 B;  2MD8 C;  3HTK C;  2E6R A;  2K17 A;  4YAT A;  3KV6 A;  3O7A A;  2OXQ C;  3HCS A;  2Y1M A;  4MSX A;  2KWJ A;  2YQM A;  2L75 A;  1IYM A;  2VPD A; 
#chains in the Genus database with same CATH homology
 5H1T A;  1VD4 A;  2KFT A;  5KH7 A;  1V87 A;  2ECG A;  3L11 A;  2PNX A;  3DPL R;  2EA6 A;  4NN2 A;  2KU3 A;  1JM7 A;  2YYR A;  1MM3 A;  2ECI A;  4FIP A;  2FUU A;  1G25 A;  2KRE A;  1XWH A;  5C11 A;  2YRE A;  3KQI A;  2KWN A;  4AP4 A;  5LKT A;  2M1R A;  5LKZ A;  4A0C D;  4QF2 A;  3VK6 A;  3KV5 A;  5TDR A;  2YUC A;  2I50 A;  4LJN A;  5TDW A;  3N9L A;  3ZPV 1;  4LLB A;  2L43 A;  2VJF B;  2CKL A;  2Y1N A;  3ZPV E;  5AIT A;  1WEO A;  5G0F A;  2C2L A;  2YW8 A;  1FP0 A;  2LN0 A;  4N3W A;  4I7D A;  2M85 A;  4GNE A;  5LCW B;  2MA5 A;  3MHH A;  3LQI A;  1MM2 A;  2LGL A;  2C2V S;  5B8D A;  2ECV A;  5FB0 A;  3NG2 A;  2MNZ A;  5B75 A;  2VJF A;  4A49 A;  2YSM A;  2MD7 B;  3LQH A;  2DX8 A;  4WA6 A;  2PUY A;  4YBT A;  3U5M A;  5C13 A;  3O37 A;  4IC2 A;  4R2Y A;  2KWO A;  5KH3 A;  2F42 A;  4X3G A;  4UI9 B;  4A4B A;  5EYA F;  3IHP A;  1WIM A;  3PUR A;  4S3O B;  1VYX A;  2ECT A;  4UP0 A;  1U6G B;  2LRI C;  4N4F A;  3MHS A;  1X4U A;  2QJ0 A;  3O34 A;  4IC3 A;  4B7Y C;  2YT5 A;  2H0D B;  3PUQ A;  4QF3 A;  1ZBD B;  3O33 A;  2YU4 A;  5I3L A;  2G45 A;  5B77 A;  2LQ6 A;  4V3K C;  2E6S A;  5LKX A;  3L1X A;  4B86 C;  1WEV A;  2JMI A;  2M6M A;  1K2F A;  3SHB A;  2VP7 A;  3LRQ A;  4GNG A;  4GB0 A;  3DQV R;  5TAB A;  2VNF A;  2YQL A;  3C6W A;  1N87 A;  4L58 A;  2D8S A;  1WEQ A;  4AUQ B;  2KR4 A;  4BBQ A;  1BOR A;  3ZYQ A;  3RTR B;  2H0D A;  5B78 A;  4YC9 A;  5B76 A;  3GL6 A;  5H9M A;  1WEM A;  5G04 B;  1WIL A;  2KIZ A;  1F62 A;  2HDP A;  5AIU A;  5DKA A;  5DIN A;  3N9Q A;  3LQJ A;  2K1J A;  1HYJ A;  4F52 B;  2LGK A;  1Z60 A;  2G43 A;  4YAB A;  1WEW A;  4C9Z A;  3EB6 A;  2Y43 A;  2LGG A;  3ZNI A;  3EB5 A;  4MVT A;  2CSY A;  2ECJ A;  2VJE B;  2QIZ A;  4FO9 A;  4AYC B;  2UZG A;  5JG6 A;  2KWK A;  1WEP A;  2AN6 A;  2L80 A;  1X4I A;  1T1H A;  2F6J A;  3KNV A;  4I7C A;  4FK5 A;  3T7L A;  1LDJ B;  2MA6 A;  4GNF A;  3QZV A;  3RPG B;  4CCG X;  2YSJ A;  2G6Q A;  1WE9 A;  2HYE D;  2LXP C;  2EGP A;  3N9N A;  3N9O A;  2L0B A;  2MUM A;  3M63 A;  3PHD A;  2NAA A;  3U5O A;  2JRJ A;  4Q6F A;  4YAD A;  2KGG A;  4YBM A;  2BAY A;  4P5O B;  3I2D A;  4AYC A;  1JM7 B;  2KYU A;  3N9P A;  3ASL A;  1CHC A;  5FEY A;  1WGM A;  3HCT A;  2FSA A;  4WZ2 A;  4R7E A;  1X4J A;  4WZ0 A;  2KE1 A;  2K16 A;  2L5U A;  5FB1 A;  4ZQL A;  3SOW A;  3FL2 A;  2K4D A;  4O64 A;  4BHW A;  4TKP B;  1WEU A;  3M62 A;  2VPG A;  4PTB A;  1WEE A;  2MNY A;  4R8P K;  1WFK A;  2JMJ A;  5TBN A;  4V3L C;  1Z6U A;  2CKL B;  3ZVZ B;  4ZUX U;  3L1Z B;  4XI1 A;  1Z2Q A;  4YBS A;  2ECN A;  4GND A;  5D1L B;  5B79 A;  2LV9 A;  4LKA A;  3ZVY A;  4PPE A;  5H1V A;  2VPB A;  5TRB A;  3U5P A;  1WES A;  3O70 A;  2FUI A;  3V43 A;  2CSZ A;  4LK9 A;  3ZTG A;  5J3X A;  4A4C A;  4ZDT A;  5KH9 A;  5D1K B;  4I7B A;  2LGV A;  2LXH C;  1DVP A;  2CT2 A;  3U5N A;  3RPG C;  2MIQ A;  2MT5 A;  4FJC A;  3C5K A;  2EOD A;  1FBV A;  2ECW A;  2RI7 A;  3HCU A;  5G05 B;  2VPE A;  2YHO A;  2QIC A;  2IDA A;  2YHN A;  2KGI A;  4UP5 A;  3O36 A;  2XEU A;  5LKU A;  4S3O C;  2RSD A;  3T6R A;  3GV4 A;  5D1M B;  3O35 A;  2ZET C;  2YUR A;  2LDR A;  5H1U A;  4YAX A;  2JMD A;  1E4U A;  4L7X A;  1LDK C;  5FER A;  4AVX A;  1VFY A;  2XB1 A;  1WEN A;  1JOC A;  4LAD B;  1RMD A;  3M99 A;  2VJE A;  1HYI A;  4W4U A;  4CA1 A;  3SOU A;  2F6N A;  3SOX A;  2M3H A;  3N9M A;  4WZ3 B;  2MD8 C;  3HTK C;  2E6R A;  2K17 A;  4YAT A;  3KV6 A;  3O7A A;  2OXQ C;  3HCS A;  2Y1M A;  4MSX A;  2KWJ A;  2YQM A;  2L75 A;  1IYM A;  2VPD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...