1XWHA

Nmr structure of the first phd finger of autoimmune regulator protein (aire1): insights into apeced
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
66
structure length
66
Chain Sequence
GAMAQKNEDECAVCRDGGELICCDGCPRAFHLACLSPPLREIPSGTWRCSSCLQATVQEVQPRAEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Autoimmune regulator
publication title NMR structure of the first PHD finger of autoimmune regulator protein (AIRE1). Insights into autoimmune polyendocrinopathy-candidiasis-ectodermal dystrophy (APECED) disease
pubmed doi rcsb
source organism Homo sapiens
total genus 4
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2004-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1xwhA00
2ECGA 1E4UA 5D1LB 3DPLR 4YC9A 4WZ3B 2EGPA 1JM7A 2H0DA 2LGGA 4PTBA 3O36A 5H9MA 5B75A 2EODA 2KE1A 2QJ0A 3T7LA 2L75A 2XEUA 2KU3A 3PUQA 4F52B 2KYUA 5D1MB 2JRJA 5DKAA 4YBTA 3U5PA 4L7XA 2LDRA 2KFTA 2LRIC 3SOUA 2F6JA 2Y43A 2F6NA 5I3LA 2KWKA 1WFKA 2VJEA 2MIQA 5C11A 4BBQA 2ECIA 3C5KA 3SOWA 1WEEA 2CSYA 3KV5A 5J3XA 1WEVA 3L11A 2M3HA 4FK5A 4AYCB 4YATA 1Z60A 4MVTA 1XWHA 1WENA 5LKXA 3O33A 3HCTA 5LCWB 5B79A 2MD7B 2MUMA 2L0BA 1ZBDB 3V43A 1LDJB 1VFYA 4LJNA 2MNYA 3L1XA 2PNXA 4XI1A 5KH9A 4MSXA 2VP7A 3ZPVE 3I2DA 4R7EA 5G05B 2L5UA 2CT2A 3ASLA 4L58A 2YQMA 3T6RA 3ZTGA 2I50A 2FUUA 3C6WA 2VPBA 3N9PA 2KWJA 2FSAA 4UI9B 4ZQLA 5B8DA 4A49A 4N3WA 1G25A 3ZVZB 3O37A 2BAYA 5B78A 2E6SA 3GV4A 2JMJA 5KH7A 2JMIA 1K2FA 3L1ZB 3LQHA 4Q6FA 2MNZA 4V3KC 5DINA 2Y1NA 1FBVA 1Z6UA 2G45A 4GNFA 4O64A 3RTRB 5G04B 3MHHA 3EB5A 3M62A 2LXHC 2YSJA 1WEQA 2CKLA 2IDAA 4R8PK 2RSDA 4GNDA 5AIUA 2F42A 3SHBA 1X4IA 2ECWA 4CA1A 2L80A 3ZYQA 2K1JA 1JM7B 2H0DB 5LKUA 2KGGA 2VPGA 1RMDA 1T1HA 2YYRA 1U6GB 2OXQC 4IC2A 4QF3A 3FL2A 5H1VA 2JMDA 3M99A 2ECJA 2RI7A 5JG6A 3LRQA 5FB1A 4YBMA 2KIZA 1X4UA 1F62A 2VJEB 2AN6A 1DVPA 1CHCA 2D8SA 2M1RA 4C9ZA 3MHSA 2VJFA 1WEPA 1BORA 5H1UA 2EA6A 4ZDTA 3ZVYA 3LQJA 2UZGA 2K16A 2YU4A 2YUCA 5B76A 4FO9A 1WESA 3QZVA 5B77A 4GNEA 3KNVA 2YW8A 2LGKA 2VPDA 4I7DA 2KGIA 5TBNA 5TABA 2YSMA 5KH3A 2C2LA 3GL6A 1VYXA 1WILA 1WIMA 4QF2A 3DQVR 4N4FA 3N9MA 1N87A 2HDPA 1Z2QA 1HYIA 1HYJA 2KR4A 4WZ2A 1FP0A 2QICA 4S3OB 3HTKC 4V3LC 2YT5A 4TKPB 3M63A 4A0CD 5EYAF 2C2VS 3RPGB 4I7CA 2M6MA 3O34A 2DX8A 2YHNA 1WEWA 4AP4A 2VNFA 4P5OB 1WEOA 3N9OA 4AUQB 3EB6A 3PURA 3KQIA 2VPEA 2L43A 1IYMA 3N9NA 2ECVA 2MT5A 4LK9A 3HCSA 2G6QA 4W4UA 2KWNA 2MA5A 2Y1MA 2LV9A 2YREA 4FIPA 5H1TA 4S3OC 2MD8C 4LKAA 3RPGC 4AYCA 3O7AA 5TRBA 1WE9A 3ZPV1 4FJCA 2CKLB 2LN0A 3KV6A 2ZETC 5FB0A 2LQ6A 1X4JA 1VD4A 2G43A 2K17A 4UP0A 3O35A 1JOCA 4AVXA 4YADA 2MA6A 2ECTA 4UP5A 2K4DA 1MM3A 4YAXA 4YBSA 4CCGX 3NG2A 2HYED 2NAAA 3PHDA 1LDKC 5TDRA 3SOXA 2YURA 1WEMA 2LGVA 3ZNIA 3U5MA 3LQIA 4GNGA 4NN2A 2YQLA 4WA6A 3O70A 2KWOA 2FUIA 2VJFB 5LKTA 4A4CA 2LGLA 4BHWA 4I7BA 4B86C 4YABA 3IHPA 2E6RA 2CSZA 4PPEA 3HCUA 1WGMA 2QIZA 4LLBA 3U5OA 4WZ0A 2ECNA 5C13A 4GB0A 5FERA 1WEUA 2KREA 3N9LA 1MM2A 3U5NA 2YHOA 3N9QA 4IC3A 4X3GA 5LKZA 4R2YA 5AITA 4A4BA 2LXPC 2XB1A 2M85A 4B7YC 5TDWA 4ZUXU 2PUYA 3VK6A 1V87A 5G0FA 5FEYA 4LADB 5D1KB
chains in the Genus database with same CATH superfamily
2ECGA 1E4UA 2KKYA 5D1LB 3DPLR 3FANA 3LVQE 4YC9A 4WZ3B 2EGPA 1JM7A 2H0DA 2LGGA 4PTBA 3O36A 5H9MA 5B75A 2EODA 2KE1A 2QJ0A 3T7LA 2L75A 3FAOA 2XEUA 2KU3A 3PUQA 4F52B 2KYUA 2EGMA 5D1MB 2JRJA 2XOYA 3MDBC 5DKAA 4YBTA 5K3QA 3U5PA 4L7XA 2LDRA 2KFTA 2LRIC 2M13A 3SOUA 3LDYA 2F6JA 2Y43A 2F6NA 5I3LA 2KWKA 1WFKA 2IQJA 2MIQA 2VJEA 5C11A 4BBQA 2ECIA 3C5KA 3SOWA 1WEEA 2CSYA 3KV5A 3O47A 5J3XA 1WEVA 3L11A 2M3HA 4FK5A 4AYCB 4YATA 1Z60A 5SVIA 4MVTA 1XWHA 1WENA 5LKXA 3O33A 3HCTA 2B0OE 5LCWB 5B79A 2MD7B 2MUMA 2E61A 1ZBDB 3PLWA 3V43A 1LDJB 3Q1DA 1VFYA 4LJNA 2MNYA 3L1XA 2PNXA 4Z0RA 4XI1A 5KH9A 4MSXA 2VP7A 3ZPVE 3I2DA 2OWAA 4R7EA 3LJUX 5G05B 2L5UA 2CT2A 3SUBA 3ASLA 4L58A 2YQMA 3T6RA 3ZTGA 2I50A 2FUUA 3C6WA 2VPBA 3N9PA 2KWJA 4O62A 2FSAA 4UI9B 4ZQLA 5B8DA 4A49A 4N3WA 1G25A 3T9KA 3ZVZB 3O37A 2BAYA 5B78A 2E6SA 3GV4A 2JMJA 2JUNA 5KH7A 2JMIA 1K2FA 3L1ZB 3LQHA 4Q6FA 2MNZA 4V3KC 5DINA 3FM8C 2Y1NA 1FBVA 1Z6UA 2G45A 4GNFA 4O64A 3RTRB 5G04B 3MHHA 3EB5A 3M62A 2LXHC 2KKXA 2YSJA 1WEQA 2CKLA 2IDAA 3FJUB 4R8PK 2RSDA 4GNDA 5AIUA 2F42A 3SHBA 1X4IA 2ECWA 2CONA 4CA1A 2L80A 3ZYQA 2JM3A 2K1JA 1JM7B 2H0DB 2P57A 5LKUA 2KGGA 2VPGA 2FFWA 1RMDA 2EXUA 1T1HA 2YYRA 1U6GB 2OXQC 4IC2A 3DWDA 4QF3A 3FL2A 5H1VA 2L7PA 2JMDA 3M99A 2ECJA 2RI7A 5JG6A 3LRQA 5FB1A 4YBMA 2KIZA 1X4UA 4F1PA 1F62A 2VJEB 2AN6A 1DVPA 1CHCA 2D8SA 2M1RA 4C9ZA 3MHSA 2VJFA 1WEPA 3FEHA 1BORA 5H1UA 2EA6A 4ZDTA 3ZVYA 3LQJA 2UZGA 2K16A 2YU4A 2YUCA 5SVIB 5B76A 2DJAA 4FO9A 1WESA 3QZVA 5B77A 4GNEA 3KNVA 2YW8A 2LGKA 2VPDA 4I7DA 2KGIA 5TBNA 5TABA 2YSMA 5KH3A 4H9DA 2C2LA 3GL6A 1VYXA 5SVYA 1MBMA 1WILA 1WIMA 4QF2A 3DQVR 4N4FA 3N9MA 1N87A 5D1KB 2HDPA 1Z2QA 1HYIA 1HYJA 2DSMA 2KR4A 2XP0A 2XOCA 4WZ2A 1FP0A 2QICA 4OGEA 4S3OB 3HTKC 4V3LC 2YT5A 4TKPB 3M63A 4A0CD 5EYAF 2C2VS 3RPGB 4I7CA 2M6MA 3O34A 2DX8A 2YHNA 1WEWA 4AP4A 2VNFA 4P5OB 1WEOA 3N9OA 4AUQB 2D8UA 2MKEA 3EB6A 3PURA 3KQIA 2VPEA 2L43A 1IYMA 2FD4A 3N9NA 2ECVA 3M7KA 2MT5A 2YVRA 4LK9A 3HCSA 2G6QA 4W4UA 2KWNA 2MA5A 4QQ4A 2XOZA 2Y1MA 2LV9A 2YREA 4FIPA 5H1TA 4S3OC 2MD8C 3H7HA 4LKAA 3RPGC 4AYCA 3O7AA 2RR4A 5TRBA 1WE9A 3ZPV1 4FJCA 2CKLB 2LN0A 3KV6A 2ZETC 2LAUA 5FB0A 2LQ6A 1X4JA 1VD4A 4Z0OA 4OGCA 2G43A 2K17A 2CSVA 4UP0A 3O35A 1JOCA 4AVXA 4YADA 2MA6A 2ECTA 4UP5A 2K4DA 1MM3A 4YAXA 3LVRE 5SVXA 4YBSA 4CCGX 3NG2A 3JUEA 2HYED 2NAAA 3PHDA 1LDKC 5TDRA 3SOXA 2YURA 1WEMA 2LGVA 1DCQA 3ZNIA 3U5MA 3LQIA 4GNGA 4NN2A 2YQLA 4WA6A 3O70A 2KWOA 2FUIA 2VJFB 5LKTA 3DDTA 3E2DA 4A4CA 2LGLA 4BHWA 2CRWA 2CRRA 4I7BA 4B86C 4YABA 3IHPA 2E6RA 2CSZA 4PPEA 3HCUA 1WGMA 2QIZA 4LLBA 3U5OA 4WZ0A 2ECNA 5C13A 4GB0A 5FERA 1WEUA 2KREA 3N9LA 1MM2A 3U5NA 2YHOA 3N9QA 4IC3A 4X3GA 5LKZA 4R2YA 5AITA 4A4BA 2LXPC 2XB1A 2M85A 4B7YC 5TDWA 3KDEC 4ZUXU 2PUYA 3VK6A 1V87A 5G0FA 5FEYA 4LADB 2L0BA
chains in the Genus database with same CATH topology
2ECGA 1E4UA 5D1LB 3DPLR 4YC9A 4WZ3B 2EGPA 1JM7A 2H0DA 2LGGA 4PTBA 3O36A 5H9MA 5B75A 2EODA 2KE1A 2QJ0A 3T7LA 2L75A 2XEUA 2KU3A 3PUQA 4F52B 2KYUA 5D1MB 2JRJA 5DKAA 4YBTA 3U5PA 4L7XA 2LDRA 2KFTA 2LRIC 3SOUA 2F6JA 2Y43A 2F6NA 5I3LA 2KWKA 1WFKA 2VJEA 2MIQA 5C11A 4BBQA 2ECIA 3C5KA 3SOWA 1WEEA 2CSYA 3KV5A 5J3XA 1WEVA 3L11A 2M3HA 4FK5A 4AYCB 4YATA 1Z60A 4MVTA 1XWHA 1WENA 5LKXA 3O33A 3HCTA 5LCWB 5B79A 2MD7B 2MUMA 2L0BA 1ZBDB 3V43A 1LDJB 1VFYA 4LJNA 2MNYA 3L1XA 2PNXA 4XI1A 5KH9A 4MSXA 2VP7A 3ZPVE 3I2DA 4R7EA 5G05B 2L5UA 2CT2A 3ASLA 4L58A 2YQMA 3T6RA 3ZTGA 2I50A 2FUUA 3C6WA 2VPBA 3N9PA 2KWJA 2FSAA 4UI9B 4ZQLA 5B8DA 4A49A 4N3WA 1G25A 3ZVZB 3O37A 2BAYA 5B78A 2E6SA 3GV4A 2JMJA 5KH7A 2JMIA 1K2FA 3L1ZB 3LQHA 4Q6FA 2MNZA 4V3KC 5DINA 2Y1NA 1FBVA 1Z6UA 2G45A 4GNFA 4O64A 3RTRB 5G04B 3MHHA 3EB5A 3M62A 2LXHC 2YSJA 1WEQA 2CKLA 2IDAA 4R8PK 2RSDA 4GNDA 5AIUA 2F42A 3SHBA 1X4IA 2ECWA 4CA1A 2L80A 3ZYQA 2K1JA 1JM7B 2H0DB 5LKUA 2KGGA 2VPGA 1RMDA 1T1HA 2YYRA 1U6GB 2OXQC 4IC2A 4QF3A 3FL2A 5H1VA 2JMDA 3M99A 2ECJA 2RI7A 5JG6A 3LRQA 5FB1A 4YBMA 2KIZA 1X4UA 1F62A 2VJEB 2AN6A 1DVPA 1CHCA 2D8SA 2M1RA 4C9ZA 3MHSA 2VJFA 1WEPA 1BORA 5H1UA 2EA6A 4ZDTA 3ZVYA 3LQJA 2UZGA 2K16A 2YU4A 2YUCA 5B76A 4FO9A 1WESA 3QZVA 5B77A 4GNEA 3KNVA 2YW8A 2LGKA 2VPDA 4I7DA 2KGIA 5TBNA 5TABA 2YSMA 5KH3A 2C2LA 3GL6A 1VYXA 1WILA 1WIMA 4QF2A 3DQVR 4N4FA 3N9MA 1N87A 2HDPA 1Z2QA 1HYIA 1HYJA 2KR4A 4WZ2A 1FP0A 2QICA 4S3OB 3HTKC 4V3LC 2YT5A 4TKPB 3M63A 4A0CD 5EYAF 2C2VS 3RPGB 4I7CA 2M6MA 3O34A 2DX8A 2YHNA 1WEWA 4AP4A 2VNFA 4P5OB 1WEOA 3N9OA 4AUQB 3EB6A 3PURA 3KQIA 2VPEA 2L43A 1IYMA 3N9NA 2ECVA 2MT5A 4LK9A 3HCSA 2G6QA 4W4UA 2KWNA 2MA5A 2Y1MA 2LV9A 2YREA 4FIPA 5H1TA 4S3OC 2MD8C 4LKAA 3RPGC 4AYCA 3O7AA 5TRBA 1WE9A 3ZPV1 4FJCA 2CKLB 2LN0A 3KV6A 2ZETC 5FB0A 2LQ6A 1X4JA 1VD4A 2G43A 2K17A 4UP0A 3O35A 1JOCA 4AVXA 4YADA 2MA6A 2ECTA 4UP5A 2K4DA 1MM3A 4YAXA 4YBSA 4CCGX 3NG2A 2HYED 2NAAA 3PHDA 1LDKC 5TDRA 3SOXA 2YURA 1WEMA 2LGVA 3ZNIA 3U5MA 3LQIA 4GNGA 4NN2A 2YQLA 4WA6A 3O70A 2KWOA 2FUIA 2VJFB 5LKTA 4A4CA 2LGLA 4BHWA 4I7BA 4B86C 4YABA 3IHPA 2E6RA 2CSZA 4PPEA 3HCUA 1WGMA 2QIZA 4LLBA 3U5OA 4WZ0A 2ECNA 5C13A 4GB0A 5FERA 1WEUA 2KREA 3N9LA 1MM2A 3U5NA 2YHOA 3N9QA 4IC3A 4X3GA 5LKZA 4R2YA 5AITA 4A4BA 2LXPC 2XB1A 2M85A 4B7YC 5TDWA 4ZUXU 2PUYA 3VK6A 1V87A 5G0FA 5FEYA 4LADB 5D1KB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ECG A;  1E4U A;  5D1L B;  3DPL R;  4YC9 A;  4WZ3 B;  2EGP A;  1JM7 A;  2H0D A;  2LGG A;  4PTB A;  3O36 A;  5H9M A;  5B75 A;  2EOD A;  2KE1 A;  2QJ0 A;  3T7L A;  2L75 A;  2XEU A;  2KU3 A;  3PUQ A;  4F52 B;  2KYU A;  5D1M B;  2JRJ A;  5DKA A;  4YBT A;  3U5P A;  4L7X A;  2LDR A;  2KFT A;  2LRI C;  3SOU A;  2F6J A;  2Y43 A;  2F6N A;  5I3L A;  2KWK A;  1WFK A;  2VJE A;  2MIQ A;  5C11 A;  4BBQ A;  2ECI A;  3C5K A;  3SOW A;  1WEE A;  2CSY A;  3KV5 A;  5J3X A;  1WEV A;  3L11 A;  2M3H A;  4FK5 A;  4AYC B;  4YAT A;  1Z60 A;  4MVT A;  1XWH A;  1WEN A;  5LKX A;  3O33 A;  3HCT A;  5LCW B;  5B79 A;  2MD7 B;  2MUM A;  2L0B A;  1ZBD B;  3V43 A;  1LDJ B;  1VFY A;  4LJN A;  2MNY A;  3L1X A;  2PNX A;  4XI1 A;  5KH9 A;  4MSX A;  2VP7 A;  3ZPV E;  3I2D A;  4R7E A;  5G05 B;  2L5U A;  2CT2 A;  3ASL A;  4L58 A;  2YQM A;  3T6R A;  3ZTG A;  2I50 A;  2FUU A;  3C6W A;  2VPB A;  3N9P A;  2KWJ A;  2FSA A;  4UI9 B;  4ZQL A;  5B8D A;  4A49 A;  4N3W A;  1G25 A;  3ZVZ B;  3O37 A;  2BAY A;  5B78 A;  2E6S A;  3GV4 A;  2JMJ A;  5KH7 A;  2JMI A;  1K2F A;  3L1Z B;  3LQH A;  4Q6F A;  2MNZ A;  4V3K C;  5DIN A;  2Y1N A;  1FBV A;  1Z6U A;  2G45 A;  4GNF A;  4O64 A;  3RTR B;  5G04 B;  3MHH A;  3EB5 A;  3M62 A;  2LXH C;  2YSJ A;  1WEQ A;  2CKL A;  2IDA A;  4R8P K;  2RSD A;  4GND A;  5AIU A;  2F42 A;  3SHB A;  1X4I A;  2ECW A;  4CA1 A;  2L80 A;  3ZYQ A;  2K1J A;  1JM7 B;  2H0D B;  5LKU A;  2KGG A;  2VPG A;  1RMD A;  1T1H A;  2YYR A;  1U6G B;  2OXQ C;  4IC2 A;  4QF3 A;  3FL2 A;  5H1V A;  2JMD A;  3M99 A;  2ECJ A;  2RI7 A;  5JG6 A;  3LRQ A;  5FB1 A;  4YBM A;  2KIZ A;  1X4U A;  1F62 A;  2VJE B;  2AN6 A;  1DVP A;  1CHC A;  2D8S A;  2M1R A;  4C9Z A;  3MHS A;  2VJF A;  1WEP A;  1BOR A;  5H1U A;  2EA6 A;  4ZDT A;  3ZVY A;  3LQJ A;  2UZG A;  2K16 A;  2YU4 A;  2YUC A;  5B76 A;  4FO9 A;  1WES A;  3QZV A;  5B77 A;  4GNE A;  3KNV A;  2YW8 A;  2LGK A;  2VPD A;  4I7D A;  2KGI A;  5TBN A;  5TAB A;  2YSM A;  5KH3 A;  2C2L A;  3GL6 A;  1VYX A;  1WIL A;  1WIM A;  4QF2 A;  3DQV R;  4N4F A;  3N9M A;  1N87 A;  2HDP A;  1Z2Q A;  1HYI A;  1HYJ A;  2KR4 A;  4WZ2 A;  1FP0 A;  2QIC A;  4S3O B;  3HTK C;  4V3L C;  2YT5 A;  4TKP B;  3M63 A;  4A0C D;  5EYA F;  2C2V S;  3RPG B;  4I7C A;  2M6M A;  3O34 A;  2DX8 A;  2YHN A;  1WEW A;  4AP4 A;  2VNF A;  4P5O B;  1WEO A;  3N9O A;  4AUQ B;  3EB6 A;  3PUR A;  3KQI A;  2VPE A;  2L43 A;  1IYM A;  3N9N A;  2ECV A;  2MT5 A;  4LK9 A;  3HCS A;  2G6Q A;  4W4U A;  2KWN A;  2MA5 A;  2Y1M A;  2LV9 A;  2YRE A;  4FIP A;  5H1T A;  4S3O C;  2MD8 C;  4LKA A;  3RPG C;  4AYC A;  3O7A A;  5TRB A;  1WE9 A;  3ZPV 1;  4FJC A;  2CKL B;  2LN0 A;  3KV6 A;  2ZET C;  5FB0 A;  2LQ6 A;  1X4J A;  1VD4 A;  2G43 A;  2K17 A;  4UP0 A;  3O35 A;  1JOC A;  4AVX A;  4YAD A;  2MA6 A;  2ECT A;  4UP5 A;  2K4D A;  1MM3 A;  4YAX A;  4YBS A;  4CCG X;  3NG2 A;  2HYE D;  2NAA A;  3PHD A;  1LDK C;  5TDR A;  3SOX A;  2YUR A;  1WEM A;  2LGV A;  3ZNI A;  3U5M A;  3LQI A;  4GNG A;  4NN2 A;  2YQL A;  4WA6 A;  3O70 A;  2KWO A;  2FUI A;  2VJF B;  5LKT A;  4A4C A;  2LGL A;  4BHW A;  4I7B A;  4B86 C;  4YAB A;  3IHP A;  2E6R A;  2CSZ A;  4PPE A;  3HCU A;  1WGM A;  2QIZ A;  4LLB A;  3U5O A;  4WZ0 A;  2ECN A;  5C13 A;  4GB0 A;  5FER A;  1WEU A;  2KRE A;  3N9L A;  1MM2 A;  3U5N A;  2YHO A;  3N9Q A;  4IC3 A;  4X3G A;  5LKZ A;  4R2Y A;  5AIT A;  4A4B A;  2LXP C;  2XB1 A;  2M85 A;  4B7Y C;  5TDW A;  4ZUX U;  2PUY A;  3VK6 A;  1V87 A;  5G0F A;  5FEY A;  4LAD B;  5D1K B; 
#chains in the Genus database with same CATH topology
 2ECG A;  1E4U A;  2KKY A;  5D1L B;  3DPL R;  3FAN A;  3LVQ E;  4YC9 A;  4WZ3 B;  2EGP A;  1JM7 A;  2H0D A;  2LGG A;  4PTB A;  3O36 A;  5H9M A;  5B75 A;  2EOD A;  2KE1 A;  2QJ0 A;  3T7L A;  2L75 A;  3FAO A;  2XEU A;  2KU3 A;  3PUQ A;  4F52 B;  2KYU A;  2EGM A;  5D1M B;  2JRJ A;  2XOY A;  3MDB C;  5DKA A;  4YBT A;  5K3Q A;  3U5P A;  4L7X A;  2LDR A;  2KFT A;  2LRI C;  2M13 A;  3SOU A;  3LDY A;  2F6J A;  2Y43 A;  2F6N A;  5I3L A;  2KWK A;  1WFK A;  2IQJ A;  2MIQ A;  2VJE A;  5C11 A;  4BBQ A;  2ECI A;  3C5K A;  3SOW A;  1WEE A;  2CSY A;  3KV5 A;  3O47 A;  5J3X A;  1WEV A;  3L11 A;  2M3H A;  4FK5 A;  4AYC B;  4YAT A;  1Z60 A;  5SVI A;  4MVT A;  1XWH A;  1WEN A;  5LKX A;  3O33 A;  3HCT A;  2B0O E;  5LCW B;  5B79 A;  2MD7 B;  2MUM A;  2E61 A;  1ZBD B;  3PLW A;  3V43 A;  1LDJ B;  3Q1D A;  1VFY A;  4LJN A;  2MNY A;  3L1X A;  2PNX A;  4Z0R A;  4XI1 A;  5KH9 A;  4MSX A;  2VP7 A;  3ZPV E;  3I2D A;  2OWA A;  4R7E A;  3LJU X;  5G05 B;  2L5U A;  2CT2 A;  3SUB A;  3ASL A;  4L58 A;  2YQM A;  3T6R A;  3ZTG A;  2I50 A;  2FUU A;  3C6W A;  2VPB A;  3N9P A;  2KWJ A;  4O62 A;  2FSA A;  4UI9 B;  4ZQL A;  5B8D A;  4A49 A;  4N3W A;  1G25 A;  3T9K A;  3ZVZ B;  3O37 A;  2BAY A;  5B78 A;  2E6S A;  3GV4 A;  2JMJ A;  2JUN A;  5KH7 A;  2JMI A;  1K2F A;  3L1Z B;  3LQH A;  4Q6F A;  2MNZ A;  4V3K C;  5DIN A;  3FM8 C;  2Y1N A;  1FBV A;  1Z6U A;  2G45 A;  4GNF A;  4O64 A;  3RTR B;  5G04 B;  3MHH A;  3EB5 A;  3M62 A;  2LXH C;  2KKX A;  2YSJ A;  1WEQ A;  2CKL A;  2IDA A;  3FJU B;  4R8P K;  2RSD A;  4GND A;  5AIU A;  2F42 A;  3SHB A;  1X4I A;  2ECW A;  2CON A;  4CA1 A;  2L80 A;  3ZYQ A;  2JM3 A;  2K1J A;  1JM7 B;  2H0D B;  2P57 A;  5LKU A;  2KGG A;  2VPG A;  2FFW A;  1RMD A;  2EXU A;  1T1H A;  2YYR A;  1U6G B;  2OXQ C;  4IC2 A;  3DWD A;  4QF3 A;  3FL2 A;  5H1V A;  2L7P A;  2JMD A;  3M99 A;  2ECJ A;  2RI7 A;  5JG6 A;  3LRQ A;  5FB1 A;  4YBM A;  2KIZ A;  1X4U A;  4F1P A;  1F62 A;  2VJE B;  2AN6 A;  1DVP A;  1CHC A;  2D8S A;  2M1R A;  4C9Z A;  3MHS A;  2VJF A;  1WEP A;  3FEH A;  1BOR A;  5H1U A;  2EA6 A;  4ZDT A;  3ZVY A;  3LQJ A;  2UZG A;  2K16 A;  2YU4 A;  2YUC A;  5SVI B;  5B76 A;  2DJA A;  4FO9 A;  1WES A;  3QZV A;  5B77 A;  4GNE A;  3KNV A;  2YW8 A;  2LGK A;  2VPD A;  4I7D A;  2KGI A;  5TBN A;  5TAB A;  2YSM A;  5KH3 A;  4H9D A;  2C2L A;  3GL6 A;  1VYX A;  5SVY A;  1MBM A;  1WIL A;  1WIM A;  4QF2 A;  3DQV R;  4N4F A;  3N9M A;  1N87 A;  5D1K B;  2HDP A;  1Z2Q A;  1HYI A;  1HYJ A;  2DSM A;  2KR4 A;  2XP0 A;  2XOC A;  4WZ2 A;  1FP0 A;  2QIC A;  4OGE A;  4S3O B;  3HTK C;  4V3L C;  2YT5 A;  4TKP B;  3M63 A;  4A0C D;  5EYA F;  2C2V S;  3RPG B;  4I7C A;  2M6M A;  3O34 A;  2DX8 A;  2YHN A;  1WEW A;  4AP4 A;  2VNF A;  4P5O B;  1WEO A;  3N9O A;  4AUQ B;  2D8U A;  2MKE A;  3EB6 A;  3PUR A;  3KQI A;  2VPE A;  2L43 A;  1IYM A;  2FD4 A;  3N9N A;  2ECV A;  3M7K A;  2MT5 A;  2YVR A;  4LK9 A;  3HCS A;  2G6Q A;  4W4U A;  2KWN A;  2MA5 A;  4QQ4 A;  2XOZ A;  2Y1M A;  2LV9 A;  2YRE A;  4FIP A;  5H1T A;  4S3O C;  2MD8 C;  3H7H A;  4LKA A;  3RPG C;  4AYC A;  3O7A A;  2RR4 A;  5TRB A;  1WE9 A;  3ZPV 1;  4FJC A;  2CKL B;  2LN0 A;  3KV6 A;  2ZET C;  2LAU A;  5FB0 A;  2LQ6 A;  1X4J A;  1VD4 A;  4Z0O A;  4OGC A;  2G43 A;  2K17 A;  2CSV A;  4UP0 A;  3O35 A;  1JOC A;  4AVX A;  4YAD A;  2MA6 A;  2ECT A;  4UP5 A;  2K4D A;  1MM3 A;  4YAX A;  3LVR E;  5SVX A;  4YBS A;  4CCG X;  3NG2 A;  3JUE A;  2HYE D;  2NAA A;  3PHD A;  1LDK C;  5TDR A;  3SOX A;  2YUR A;  1WEM A;  2LGV A;  1DCQ A;  3ZNI A;  3U5M A;  3LQI A;  4GNG A;  4NN2 A;  2YQL A;  4WA6 A;  3O70 A;  2KWO A;  2FUI A;  2VJF B;  5LKT A;  3DDT A;  3E2D A;  4A4C A;  2LGL A;  4BHW A;  2CRW A;  2CRR A;  4I7B A;  4B86 C;  4YAB A;  3IHP A;  2E6R A;  2CSZ A;  4PPE A;  3HCU A;  1WGM A;  2QIZ A;  4LLB A;  3U5O A;  4WZ0 A;  2ECN A;  5C13 A;  4GB0 A;  5FER A;  1WEU A;  2KRE A;  3N9L A;  1MM2 A;  3U5N A;  2YHO A;  3N9Q A;  4IC3 A;  4X3G A;  5LKZ A;  4R2Y A;  5AIT A;  4A4B A;  2LXP C;  2XB1 A;  2M85 A;  4B7Y C;  5TDW A;  3KDE C;  4ZUX U;  2PUY A;  3VK6 A;  1V87 A;  5G0F A;  5FEY A;  4LAD B;  2L0B A; 
#chains in the Genus database with same CATH homology
 2ECG A;  1E4U A;  5D1L B;  3DPL R;  4YC9 A;  4WZ3 B;  2EGP A;  1JM7 A;  2H0D A;  2LGG A;  4PTB A;  3O36 A;  5H9M A;  5B75 A;  2EOD A;  2KE1 A;  2QJ0 A;  3T7L A;  2L75 A;  2XEU A;  2KU3 A;  3PUQ A;  4F52 B;  2KYU A;  5D1M B;  2JRJ A;  5DKA A;  4YBT A;  3U5P A;  4L7X A;  2LDR A;  2KFT A;  2LRI C;  3SOU A;  2F6J A;  2Y43 A;  2F6N A;  5I3L A;  2KWK A;  1WFK A;  2VJE A;  2MIQ A;  5C11 A;  4BBQ A;  2ECI A;  3C5K A;  3SOW A;  1WEE A;  2CSY A;  3KV5 A;  5J3X A;  1WEV A;  3L11 A;  2M3H A;  4FK5 A;  4AYC B;  4YAT A;  1Z60 A;  4MVT A;  1XWH A;  1WEN A;  5LKX A;  3O33 A;  3HCT A;  5LCW B;  5B79 A;  2MD7 B;  2MUM A;  2L0B A;  1ZBD B;  3V43 A;  1LDJ B;  1VFY A;  4LJN A;  2MNY A;  3L1X A;  2PNX A;  4XI1 A;  5KH9 A;  4MSX A;  2VP7 A;  3ZPV E;  3I2D A;  4R7E A;  5G05 B;  2L5U A;  2CT2 A;  3ASL A;  4L58 A;  2YQM A;  3T6R A;  3ZTG A;  2I50 A;  2FUU A;  3C6W A;  2VPB A;  3N9P A;  2KWJ A;  2FSA A;  4UI9 B;  4ZQL A;  5B8D A;  4A49 A;  4N3W A;  1G25 A;  3ZVZ B;  3O37 A;  2BAY A;  5B78 A;  2E6S A;  3GV4 A;  2JMJ A;  5KH7 A;  2JMI A;  1K2F A;  3L1Z B;  3LQH A;  4Q6F A;  2MNZ A;  4V3K C;  5DIN A;  2Y1N A;  1FBV A;  1Z6U A;  2G45 A;  4GNF A;  4O64 A;  3RTR B;  5G04 B;  3MHH A;  3EB5 A;  3M62 A;  2LXH C;  2YSJ A;  1WEQ A;  2CKL A;  2IDA A;  4R8P K;  2RSD A;  4GND A;  5AIU A;  2F42 A;  3SHB A;  1X4I A;  2ECW A;  4CA1 A;  2L80 A;  3ZYQ A;  2K1J A;  1JM7 B;  2H0D B;  5LKU A;  2KGG A;  2VPG A;  1RMD A;  1T1H A;  2YYR A;  1U6G B;  2OXQ C;  4IC2 A;  4QF3 A;  3FL2 A;  5H1V A;  2JMD A;  3M99 A;  2ECJ A;  2RI7 A;  5JG6 A;  3LRQ A;  5FB1 A;  4YBM A;  2KIZ A;  1X4U A;  1F62 A;  2VJE B;  2AN6 A;  1DVP A;  1CHC A;  2D8S A;  2M1R A;  4C9Z A;  3MHS A;  2VJF A;  1WEP A;  1BOR A;  5H1U A;  2EA6 A;  4ZDT A;  3ZVY A;  3LQJ A;  2UZG A;  2K16 A;  2YU4 A;  2YUC A;  5B76 A;  4FO9 A;  1WES A;  3QZV A;  5B77 A;  4GNE A;  3KNV A;  2YW8 A;  2LGK A;  2VPD A;  4I7D A;  2KGI A;  5TBN A;  5TAB A;  2YSM A;  5KH3 A;  2C2L A;  3GL6 A;  1VYX A;  1WIL A;  1WIM A;  4QF2 A;  3DQV R;  4N4F A;  3N9M A;  1N87 A;  2HDP A;  1Z2Q A;  1HYI A;  1HYJ A;  2KR4 A;  4WZ2 A;  1FP0 A;  2QIC A;  4S3O B;  3HTK C;  4V3L C;  2YT5 A;  4TKP B;  3M63 A;  4A0C D;  5EYA F;  2C2V S;  3RPG B;  4I7C A;  2M6M A;  3O34 A;  2DX8 A;  2YHN A;  1WEW A;  4AP4 A;  2VNF A;  4P5O B;  1WEO A;  3N9O A;  4AUQ B;  3EB6 A;  3PUR A;  3KQI A;  2VPE A;  2L43 A;  1IYM A;  3N9N A;  2ECV A;  2MT5 A;  4LK9 A;  3HCS A;  2G6Q A;  4W4U A;  2KWN A;  2MA5 A;  2Y1M A;  2LV9 A;  2YRE A;  4FIP A;  5H1T A;  4S3O C;  2MD8 C;  4LKA A;  3RPG C;  4AYC A;  3O7A A;  5TRB A;  1WE9 A;  3ZPV 1;  4FJC A;  2CKL B;  2LN0 A;  3KV6 A;  2ZET C;  5FB0 A;  2LQ6 A;  1X4J A;  1VD4 A;  2G43 A;  2K17 A;  4UP0 A;  3O35 A;  1JOC A;  4AVX A;  4YAD A;  2MA6 A;  2ECT A;  4UP5 A;  2K4D A;  1MM3 A;  4YAX A;  4YBS A;  4CCG X;  3NG2 A;  2HYE D;  2NAA A;  3PHD A;  1LDK C;  5TDR A;  3SOX A;  2YUR A;  1WEM A;  2LGV A;  3ZNI A;  3U5M A;  3LQI A;  4GNG A;  4NN2 A;  2YQL A;  4WA6 A;  3O70 A;  2KWO A;  2FUI A;  2VJF B;  5LKT A;  4A4C A;  2LGL A;  4BHW A;  4I7B A;  4B86 C;  4YAB A;  3IHP A;  2E6R A;  2CSZ A;  4PPE A;  3HCU A;  1WGM A;  2QIZ A;  4LLB A;  3U5O A;  4WZ0 A;  2ECN A;  5C13 A;  4GB0 A;  5FER A;  1WEU A;  2KRE A;  3N9L A;  1MM2 A;  3U5N A;  2YHO A;  3N9Q A;  4IC3 A;  4X3G A;  5LKZ A;  4R2Y A;  5AIT A;  4A4B A;  2LXP C;  2XB1 A;  2M85 A;  4B7Y C;  5TDW A;  4ZUX U;  2PUY A;  3VK6 A;  1V87 A;  5G0F A;  5FEY A;  4LAD B;  5D1K B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...