2KE1A

Molecular basis of non-modified histone h3 tail recognition by the first phd finger of autoimmune regulator
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
66
structure length
66
Chain Sequence
GAMAQKNEDECAVCRDGGELICCDGCPRAFHLACLSPPLREIPSGTWRCSSCLQATVQEVQPRAEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Gene regulation
molecule keywords Autoimmune regulator
publication title The solution structure of the first PHD finger of autoimmune regulator in complex with non-modified histone H3 tail reveals the antagonistic role of H3R2 methylation
pubmed doi rcsb
source organism Homo sapiens
total genus 8
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2009-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2ke1A00
3N9MA 3HCSA 3L1XA 1VYXA 2KFTA 2VPGA 5TABA 1WEWA 2QJ0A 4YABA 5LKUA 2MIQA 2YREA 4MVTA 4GB0A 1E4UA 2G43A 2F42A 1F62A 4FJCA 2Y1NA 2YUCA 4F52B 2KU3A 5DINA 1WEMA 2LGKA 3HTKC 5TBNA 2H0DA 2L80A 2XEUA 4W4UA 2G6QA 1WFKA 2MA6A 2YT5A 5B8DA 3L1ZB 2LXHC 2QIZA 3ZVYA 1RMDA 3O33A 4YBMA 5B77A 2ECWA 3EB6A 5FB0A 5LKXA 2YHOA 4N3WA 5B79A 1DVPA 1WGMA 5KH7A 3ZPVE 4YAXA 2ECNA 4R7EA 2YURA 4YADA 3SOUA 5D1LB 3ZPV1 2K1JA 2CSYA 2CKLB 2LXPC 2FUUA 4AYCB 2VPEA 4UI9B 4BHWA 4LLBA 4GNDA 3DQVR 4V3KC 3I2DA 1WIMA 3M62A 2I50A 4CA1A 4I7CA 2IDAA 1LDKC 2LN0A 2Y1MA 1JM7B 2CKLA 2EODA 5H9MA 3O35A 2C2LA 3GV4A 4AYCA 5B76A 2JRJA 3L11A 3U5OA 2LGLA 3SHBA 1WEOA 3C5KA 2KGGA 3GL6A 4S3OB 2YSMA 4WZ3B 4A4BA 4NN2A 5FERA 1WEEA 5G04B 2VPDA 3MHHA 1LDJB 3O70A 3SOXA 2KWKA 1JM7A 2BAYA 2MUMA 2MD7B 1WESA 3HCTA 4GNFA 3MHSA 3SOWA 5TDWA 1CHCA 5TDRA 4AVXA 1N87A 1WEPA 4AP4A 2YQMA 4YBTA 3KQIA 4L7XA 1WE9A 2K16A 5FEYA 2F6JA 2OXQC 5LKZA 2MNZA 2KWNA 2K4DA 1ZBDB 5LKTA 3LQHA 2HYED 1MM2A 2EA6A 3DPLR 3KV6A 3ZYQA 3LRQA 1XWHA 3PUQA 5KH3A 1WEQA 4A4CA 3LQIA 4I7BA 4FO9A 2KWOA 4O64A 3O34A 4BBQA 2MD8C 2F6NA 3U5MA 4FK5A 1K2FA 1VD4A 3M99A 2LRIC 2L5UA 4V3LC 2MA5A 3T6RA 2LGGA 5DKAA 4S3OC 5EYAF 5D1KB 2PUYA 2KIZA 4IC3A 2ECIA 3RTRB 2MNYA 2PNXA 2XB1A 1FP0A 2CT2A 2YW8A 3O36A 5TRBA 1T1HA 1IYMA 3M63A 4PTBA 2C2VS 4FIPA 4ZQLA 1JOCA 2VJFB 3NG2A 2ECTA 3PURA 2LGVA 2EGPA 4AUQB 2D8SA 5H1UA 2ECVA 2Y43A 2JMJA 2JMDA 3U5NA 1WENA 2FUIA 1V87A 2K17A 2YSJA 4CCGX 2RI7A 1MM3A 2QICA 3N9QA 3RPGB 1HYIA 2DX8A 4P5OB 2FSAA 2VP7A 4L58A 4UP0A 3PHDA 5I3LA 4I7DA 2M85A 2E6SA 2VJFA 1Z2QA 4A0CD 2ZETC 5H1TA 5D1MB 1X4JA 4B7YC 4N4FA 2RSDA 1G25A 3O37A 3C6WA 1WEVA 3ZNIA 2LV9A 4C9ZA 3KV5A 4MSXA 4WZ2A 2ECJA 2YQLA 4YBSA 5C13A 1FBVA 1WILA 3KNVA 2M3HA 4LADB 5G0FA 3EB5A 3N9LA 3QZVA 4TKPB 2YU4A 1X4UA 1BORA 2VJEB 2CSZA 2G45A 4QF2A 2KE1A 4WA6A 4WZ0A 1VFYA 5KH9A 2LDRA 2KYUA 3LQJA 3V43A 4GNEA 5AITA 2NAAA 4B86C 2ECGA 2UZGA 1U6GB 4R2YA 2AN6A 2VJEA 3ASLA 1WEUA 2KR4A 2HDPA 3FL2A 4YATA 4A49A 2KWJA 5B78A 3T7LA 3ZVZB 4XI1A 4UP5A 5JG6A 4ZUXU 2L75A 3RPGC 1X4IA 5H1VA 1Z60A 2YHNA 2LQ6A 4LK9A 2L43A 5B75A 4QF3A 5AIUA 4LJNA 3VK6A 1HYJA 1Z6UA 4ZDTA 2KGIA 4PPEA 5FB1A 4IC2A 3O7AA 5C11A 3U5PA 2KREA 2MT5A 2YYRA 2M1RA 5G05B 4YC9A 5J3XA 2VNFA 2M6MA 3N9OA 4R8PK 2VPBA 3ZTGA 2E6RA 5LCWB 3HCUA 3IHPA 3N9NA 4GNGA 4LKAA 4Q6FA 4X3GA 2JMIA 3N9PA 2L0BA 2H0DB
chains in the Genus database with same CATH superfamily
3N9MA 3HCSA 3L1XA 1VYXA 2KFTA 3LVQE 2VPGA 5TABA 1WEWA 2QJ0A 4YABA 5LKUA 2MIQA 2YREA 3FJUB 4MVTA 4GB0A 1E4UA 2FD4A 2L7PA 3DWDA 2G43A 2F42A 1F62A 3H7HA 4FJCA 2Y1NA 2YUCA 4F52B 2KU3A 5DINA 1WEMA 2LGKA 3HTKC 5TBNA 2H0DA 2L80A 2XEUA 4W4UA 2G6QA 1WFKA 2MA6A 2YT5A 5B8DA 3L1ZB 2LXHC 2QIZA 3ZVYA 1RMDA 3O33A 4YBMA 5B77A 2ECWA 3EB6A 5FB0A 5LKXA 2YHOA 4N3WA 2CRRA 5B79A 1DVPA 2CONA 1WGMA 5KH7A 3ZPVE 4YAXA 2ECNA 4R7EA 3KDEC 2YURA 4YADA 3SOUA 5D1LB 3ZPV1 2K1JA 2CSYA 2CKLB 2LXPC 2FUUA 4AYCB 2VPEA 4UI9B 2EGMA 4BHWA 4LLBA 4GNDA 3DQVR 4V3KC 3I2DA 1WIMA 3M62A 4O62A 2I50A 4CA1A 2DSMA 4I7CA 2IDAA 1LDKC 3O47A 2LN0A 2Y1MA 1JM7B 2KKYA 2CKLA 2EODA 5H9MA 3O35A 2C2LA 3GV4A 4Z0OA 4AYCA 2B0OE 5B76A 2JRJA 3L11A 3U5OA 2LGLA 3SHBA 1WEOA 3C5KA 2KGGA 3GL6A 4S3OB 2YSMA 4WZ3B 4A4BA 4NN2A 5FERA 1WEEA 5G04B 2VPDA 3MHHA 3FEHA 2E61A 2P57A 1LDJB 3O70A 3JUEA 3SOXA 2KWKA 2CRWA 1JM7A 2BAYA 2MUMA 2MD7B 2MKEA 1WESA 3HCTA 4GNFA 3MHSA 3SOWA 5TDWA 1CHCA 5TDRA 4AVXA 4OGCA 1N87A 3LVRE 1WEPA 4AP4A 3E2DA 2YQMA 4YBTA 3KQIA 4L7XA 3LJUX 1WE9A 2K16A 5FEYA 2F6JA 2OXQC 5LKZA 2MNZA 2KWNA 2K4DA 1ZBDB 5LKTA 3LQHA 2HYED 1MM2A 2EA6A 3FM8C 3DPLR 5SVXA 3KV6A 3ZYQA 3LRQA 1XWHA 3PUQA 5KH3A 2LAUA 2CSVA 1WEQA 4A4CA 3LQIA 3FAOA 4I7BA 4FO9A 2KWOA 4O64A 2JUNA 3O34A 4BBQA 2MD8C 4OGEA 2F6NA 3U5MA 4FK5A 5SVIB 1K2FA 1VD4A 2XOCA 3M99A 2EXUA 2IQJA 2LRIC 2L5UA 4V3LC 2OWAA 2DJAA 2MA5A 3T6RA 2LGGA 5DKAA 4S3OC 5EYAF 5D1KB 3T9KA 2PUYA 2KIZA 4IC3A 2ECIA 5SVIA 2YVRA 3RTRB 2MNYA 2PNXA 2XB1A 1FP0A 2CT2A 2YW8A 3O36A 5TRBA 1T1HA 1IYMA 3M63A 4PTBA 2C2VS 4FIPA 4ZQLA 1JOCA 2VJFB 3NG2A 2ECTA 3PURA 2LGVA 2EGPA 4AUQB 2D8SA 5H1UA 2ECVA 2Y43A 2JMJA 2JMDA 3U5NA 1WENA 3M7KA 2FUIA 1V87A 2K17A 2YSJA 4CCGX 2RI7A 1MM3A 2QICA 3N9QA 3RPGB 1HYIA 2DX8A 3SUBA 4P5OB 2FSAA 2VP7A 4L58A 1MBMA 4UP0A 3PHDA 5I3LA 2XP0A 4I7DA 2M85A 2E6SA 2VJFA 1Z2QA 4A0CD 2ZETC 5H1TA 5D1MB 1X4JA 4B7YC 4N4FA 2RSDA 1G25A 3O37A 3C6WA 1WEVA 4Z0RA 3ZNIA 2LV9A 4C9ZA 3KV5A 4MSXA 4WZ2A 2ECJA 2YQLA 4YBSA 5C13A 1FBVA 1WILA 2RR4A 3KNVA 2M3HA 2D8UA 4LADB 5G0FA 3EB5A 3N9LA 3QZVA 4TKPB 2YU4A 1X4UA 4F1PA 1BORA 2VJEB 2CSZA 2G45A 1DCQA 4QF2A 2KE1A 4WA6A 4WZ0A 1VFYA 5KH9A 2LDRA 2KYUA 4QQ4A 3LQJA 3V43A 4GNEA 5AITA 3DDTA 2NAAA 4B86C 2ECGA 2UZGA 1U6GB 3LDYA 2XOYA 4R2YA 5K3QA 2AN6A 2VJEA 3ASLA 1WEUA 2KR4A 3MDBC 2HDPA 3FL2A 2KKXA 4YATA 4A49A 2KWJA 2M13A 5B78A 3T7LA 3ZVZB 3PLWA 4XI1A 4UP5A 5JG6A 4ZUXU 2L75A 3RPGC 1X4IA 5H1VA 1Z60A 2YHNA 2LQ6A 4LK9A 2L43A 5B75A 4QF3A 5AIUA 4LJNA 3VK6A 1HYJA 1Z6UA 4H9DA 4ZDTA 2KGIA 4PPEA 5SVYA 5FB1A 4IC2A 2JM3A 3FANA 3O7AA 5C11A 3U5PA 2KREA 2MT5A 2FFWA 2YYRA 2M1RA 5G05B 3Q1DA 4YC9A 5J3XA 2VNFA 2M6MA 3N9OA 4R8PK 2VPBA 2XOZA 2E6RA 3ZTGA 5LCWB 3HCUA 3IHPA 3N9NA 4GNGA 4LKAA 4Q6FA 4X3GA 2JMIA 3N9PA 2L0BA 2H0DB
chains in the Genus database with same CATH topology
3N9MA 3HCSA 3L1XA 1VYXA 2KFTA 2VPGA 5TABA 1WEWA 2QJ0A 4YABA 5LKUA 2MIQA 2YREA 4MVTA 4GB0A 1E4UA 2G43A 2F42A 1F62A 4FJCA 2Y1NA 2YUCA 4F52B 2KU3A 5DINA 1WEMA 2LGKA 3HTKC 5TBNA 2H0DA 2L80A 2XEUA 4W4UA 2G6QA 1WFKA 2MA6A 2YT5A 5B8DA 3L1ZB 2LXHC 2QIZA 3ZVYA 1RMDA 3O33A 4YBMA 5B77A 2ECWA 3EB6A 5FB0A 5LKXA 2YHOA 4N3WA 5B79A 1DVPA 1WGMA 5KH7A 3ZPVE 4YAXA 2ECNA 4R7EA 2YURA 4YADA 3SOUA 5D1LB 3ZPV1 2K1JA 2CSYA 2CKLB 2LXPC 2FUUA 4AYCB 2VPEA 4UI9B 4BHWA 4LLBA 4GNDA 3DQVR 4V3KC 3I2DA 1WIMA 3M62A 2I50A 4CA1A 4I7CA 2IDAA 1LDKC 2LN0A 2Y1MA 1JM7B 2CKLA 2EODA 5H9MA 3O35A 2C2LA 3GV4A 4AYCA 5B76A 2JRJA 3L11A 3U5OA 2LGLA 3SHBA 1WEOA 3C5KA 2KGGA 3GL6A 4S3OB 2YSMA 4WZ3B 4A4BA 4NN2A 5FERA 1WEEA 5G04B 2VPDA 3MHHA 1LDJB 3O70A 3SOXA 2KWKA 1JM7A 2BAYA 2MUMA 2MD7B 1WESA 3HCTA 4GNFA 3MHSA 3SOWA 5TDWA 1CHCA 5TDRA 4AVXA 1N87A 1WEPA 4AP4A 2YQMA 4YBTA 3KQIA 4L7XA 1WE9A 2K16A 5FEYA 2F6JA 2OXQC 5LKZA 2MNZA 2KWNA 2K4DA 1ZBDB 5LKTA 3LQHA 2HYED 1MM2A 2EA6A 3DPLR 3KV6A 3ZYQA 3LRQA 1XWHA 3PUQA 5KH3A 1WEQA 4A4CA 3LQIA 4I7BA 4FO9A 2KWOA 4O64A 3O34A 4BBQA 2MD8C 2F6NA 3U5MA 4FK5A 1K2FA 1VD4A 3M99A 2LRIC 2L5UA 4V3LC 2MA5A 3T6RA 2LGGA 5DKAA 4S3OC 5EYAF 5D1KB 2PUYA 2KIZA 4IC3A 2ECIA 3RTRB 2MNYA 2PNXA 2XB1A 1FP0A 2CT2A 2YW8A 3O36A 5TRBA 1T1HA 1IYMA 3M63A 4PTBA 2C2VS 4FIPA 4ZQLA 1JOCA 2VJFB 3NG2A 2ECTA 3PURA 2LGVA 2EGPA 4AUQB 2D8SA 5H1UA 2ECVA 2Y43A 2JMJA 2JMDA 3U5NA 1WENA 2FUIA 1V87A 2K17A 2YSJA 4CCGX 2RI7A 1MM3A 2QICA 3N9QA 3RPGB 1HYIA 2DX8A 4P5OB 2FSAA 2VP7A 4L58A 4UP0A 3PHDA 5I3LA 4I7DA 2M85A 2E6SA 2VJFA 1Z2QA 4A0CD 2ZETC 5H1TA 5D1MB 1X4JA 4B7YC 4N4FA 2RSDA 1G25A 3O37A 3C6WA 1WEVA 3ZNIA 2LV9A 4C9ZA 3KV5A 4MSXA 4WZ2A 2ECJA 2YQLA 4YBSA 5C13A 1FBVA 1WILA 3KNVA 2M3HA 4LADB 5G0FA 3EB5A 3N9LA 3QZVA 4TKPB 2YU4A 1X4UA 1BORA 2VJEB 2CSZA 2G45A 4QF2A 2KE1A 4WA6A 4WZ0A 1VFYA 5KH9A 2LDRA 2KYUA 3LQJA 3V43A 4GNEA 5AITA 2NAAA 4B86C 2ECGA 2UZGA 1U6GB 4R2YA 2AN6A 2VJEA 3ASLA 1WEUA 2KR4A 2HDPA 3FL2A 4YATA 4A49A 2KWJA 5B78A 3T7LA 3ZVZB 4XI1A 4UP5A 5JG6A 4ZUXU 2L75A 3RPGC 1X4IA 5H1VA 1Z60A 2YHNA 2LQ6A 4LK9A 2L43A 5B75A 4QF3A 5AIUA 4LJNA 3VK6A 1HYJA 1Z6UA 4ZDTA 2KGIA 4PPEA 5FB1A 4IC2A 3O7AA 5C11A 3U5PA 2KREA 2MT5A 2YYRA 2M1RA 5G05B 4YC9A 5J3XA 2VNFA 2M6MA 3N9OA 4R8PK 2VPBA 3ZTGA 2E6RA 5LCWB 3HCUA 3IHPA 3N9NA 4GNGA 4LKAA 4Q6FA 4X3GA 2JMIA 3N9PA 2L0BA 2H0DB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N9M A;  3HCS A;  3L1X A;  1VYX A;  2KFT A;  2VPG A;  5TAB A;  1WEW A;  2QJ0 A;  4YAB A;  5LKU A;  2MIQ A;  2YRE A;  4MVT A;  4GB0 A;  1E4U A;  2G43 A;  2F42 A;  1F62 A;  4FJC A;  2Y1N A;  2YUC A;  4F52 B;  2KU3 A;  5DIN A;  1WEM A;  2LGK A;  3HTK C;  5TBN A;  2H0D A;  2L80 A;  2XEU A;  4W4U A;  2G6Q A;  1WFK A;  2MA6 A;  2YT5 A;  5B8D A;  3L1Z B;  2LXH C;  2QIZ A;  3ZVY A;  1RMD A;  3O33 A;  4YBM A;  5B77 A;  2ECW A;  3EB6 A;  5FB0 A;  5LKX A;  2YHO A;  4N3W A;  5B79 A;  1DVP A;  1WGM A;  5KH7 A;  3ZPV E;  4YAX A;  2ECN A;  4R7E A;  2YUR A;  4YAD A;  3SOU A;  5D1L B;  3ZPV 1;  2K1J A;  2CSY A;  2CKL B;  2LXP C;  2FUU A;  4AYC B;  2VPE A;  4UI9 B;  4BHW A;  4LLB A;  4GND A;  3DQV R;  4V3K C;  3I2D A;  1WIM A;  3M62 A;  2I50 A;  4CA1 A;  4I7C A;  2IDA A;  1LDK C;  2LN0 A;  2Y1M A;  1JM7 B;  2CKL A;  2EOD A;  5H9M A;  3O35 A;  2C2L A;  3GV4 A;  4AYC A;  5B76 A;  2JRJ A;  3L11 A;  3U5O A;  2LGL A;  3SHB A;  1WEO A;  3C5K A;  2KGG A;  3GL6 A;  4S3O B;  2YSM A;  4WZ3 B;  4A4B A;  4NN2 A;  5FER A;  1WEE A;  5G04 B;  2VPD A;  3MHH A;  1LDJ B;  3O70 A;  3SOX A;  2KWK A;  1JM7 A;  2BAY A;  2MUM A;  2MD7 B;  1WES A;  3HCT A;  4GNF A;  3MHS A;  3SOW A;  5TDW A;  1CHC A;  5TDR A;  4AVX A;  1N87 A;  1WEP A;  4AP4 A;  2YQM A;  4YBT A;  3KQI A;  4L7X A;  1WE9 A;  2K16 A;  5FEY A;  2F6J A;  2OXQ C;  5LKZ A;  2MNZ A;  2KWN A;  2K4D A;  1ZBD B;  5LKT A;  3LQH A;  2HYE D;  1MM2 A;  2EA6 A;  3DPL R;  3KV6 A;  3ZYQ A;  3LRQ A;  1XWH A;  3PUQ A;  5KH3 A;  1WEQ A;  4A4C A;  3LQI A;  4I7B A;  4FO9 A;  2KWO A;  4O64 A;  3O34 A;  4BBQ A;  2MD8 C;  2F6N A;  3U5M A;  4FK5 A;  1K2F A;  1VD4 A;  3M99 A;  2LRI C;  2L5U A;  4V3L C;  2MA5 A;  3T6R A;  2LGG A;  5DKA A;  4S3O C;  5EYA F;  5D1K B;  2PUY A;  2KIZ A;  4IC3 A;  2ECI A;  3RTR B;  2MNY A;  2PNX A;  2XB1 A;  1FP0 A;  2CT2 A;  2YW8 A;  3O36 A;  5TRB A;  1T1H A;  1IYM A;  3M63 A;  4PTB A;  2C2V S;  4FIP A;  4ZQL A;  1JOC A;  2VJF B;  3NG2 A;  2ECT A;  3PUR A;  2LGV A;  2EGP A;  4AUQ B;  2D8S A;  5H1U A;  2ECV A;  2Y43 A;  2JMJ A;  2JMD A;  3U5N A;  1WEN A;  2FUI A;  1V87 A;  2K17 A;  2YSJ A;  4CCG X;  2RI7 A;  1MM3 A;  2QIC A;  3N9Q A;  3RPG B;  1HYI A;  2DX8 A;  4P5O B;  2FSA A;  2VP7 A;  4L58 A;  4UP0 A;  3PHD A;  5I3L A;  4I7D A;  2M85 A;  2E6S A;  2VJF A;  1Z2Q A;  4A0C D;  2ZET C;  5H1T A;  5D1M B;  1X4J A;  4B7Y C;  4N4F A;  2RSD A;  1G25 A;  3O37 A;  3C6W A;  1WEV A;  3ZNI A;  2LV9 A;  4C9Z A;  3KV5 A;  4MSX A;  4WZ2 A;  2ECJ A;  2YQL A;  4YBS A;  5C13 A;  1FBV A;  1WIL A;  3KNV A;  2M3H A;  4LAD B;  5G0F A;  3EB5 A;  3N9L A;  3QZV A;  4TKP B;  2YU4 A;  1X4U A;  1BOR A;  2VJE B;  2CSZ A;  2G45 A;  4QF2 A;  2KE1 A;  4WA6 A;  4WZ0 A;  1VFY A;  5KH9 A;  2LDR A;  2KYU A;  3LQJ A;  3V43 A;  4GNE A;  5AIT A;  2NAA A;  4B86 C;  2ECG A;  2UZG A;  1U6G B;  4R2Y A;  2AN6 A;  2VJE A;  3ASL A;  1WEU A;  2KR4 A;  2HDP A;  3FL2 A;  4YAT A;  4A49 A;  2KWJ A;  5B78 A;  3T7L A;  3ZVZ B;  4XI1 A;  4UP5 A;  5JG6 A;  4ZUX U;  2L75 A;  3RPG C;  1X4I A;  5H1V A;  1Z60 A;  2YHN A;  2LQ6 A;  4LK9 A;  2L43 A;  5B75 A;  4QF3 A;  5AIU A;  4LJN A;  3VK6 A;  1HYJ A;  1Z6U A;  4ZDT A;  2KGI A;  4PPE A;  5FB1 A;  4IC2 A;  3O7A A;  5C11 A;  3U5P A;  2KRE A;  2MT5 A;  2YYR A;  2M1R A;  5G05 B;  4YC9 A;  5J3X A;  2VNF A;  2M6M A;  3N9O A;  4R8P K;  2VPB A;  3ZTG A;  2E6R A;  5LCW B;  3HCU A;  3IHP A;  3N9N A;  4GNG A;  4LKA A;  4Q6F A;  4X3G A;  2JMI A;  3N9P A;  2L0B A;  2H0D B; 
#chains in the Genus database with same CATH topology
 3N9M A;  3HCS A;  3L1X A;  1VYX A;  2KFT A;  3LVQ E;  2VPG A;  5TAB A;  1WEW A;  2QJ0 A;  4YAB A;  5LKU A;  2MIQ A;  2YRE A;  3FJU B;  4MVT A;  4GB0 A;  1E4U A;  2FD4 A;  2L7P A;  3DWD A;  2G43 A;  2F42 A;  1F62 A;  3H7H A;  4FJC A;  2Y1N A;  2YUC A;  4F52 B;  2KU3 A;  5DIN A;  1WEM A;  2LGK A;  3HTK C;  5TBN A;  2H0D A;  2L80 A;  2XEU A;  4W4U A;  2G6Q A;  1WFK A;  2MA6 A;  2YT5 A;  5B8D A;  3L1Z B;  2LXH C;  2QIZ A;  3ZVY A;  1RMD A;  3O33 A;  4YBM A;  5B77 A;  2ECW A;  3EB6 A;  5FB0 A;  5LKX A;  2YHO A;  4N3W A;  2CRR A;  5B79 A;  1DVP A;  2CON A;  1WGM A;  5KH7 A;  3ZPV E;  4YAX A;  2ECN A;  4R7E A;  3KDE C;  2YUR A;  4YAD A;  3SOU A;  5D1L B;  3ZPV 1;  2K1J A;  2CSY A;  2CKL B;  2LXP C;  2FUU A;  4AYC B;  2VPE A;  4UI9 B;  2EGM A;  4BHW A;  4LLB A;  4GND A;  3DQV R;  4V3K C;  3I2D A;  1WIM A;  3M62 A;  4O62 A;  2I50 A;  4CA1 A;  2DSM A;  4I7C A;  2IDA A;  1LDK C;  3O47 A;  2LN0 A;  2Y1M A;  1JM7 B;  2KKY A;  2CKL A;  2EOD A;  5H9M A;  3O35 A;  2C2L A;  3GV4 A;  4Z0O A;  4AYC A;  2B0O E;  5B76 A;  2JRJ A;  3L11 A;  3U5O A;  2LGL A;  3SHB A;  1WEO A;  3C5K A;  2KGG A;  3GL6 A;  4S3O B;  2YSM A;  4WZ3 B;  4A4B A;  4NN2 A;  5FER A;  1WEE A;  5G04 B;  2VPD A;  3MHH A;  3FEH A;  2E61 A;  2P57 A;  1LDJ B;  3O70 A;  3JUE A;  3SOX A;  2KWK A;  2CRW A;  1JM7 A;  2BAY A;  2MUM A;  2MD7 B;  2MKE A;  1WES A;  3HCT A;  4GNF A;  3MHS A;  3SOW A;  5TDW A;  1CHC A;  5TDR A;  4AVX A;  4OGC A;  1N87 A;  3LVR E;  1WEP A;  4AP4 A;  3E2D A;  2YQM A;  4YBT A;  3KQI A;  4L7X A;  3LJU X;  1WE9 A;  2K16 A;  5FEY A;  2F6J A;  2OXQ C;  5LKZ A;  2MNZ A;  2KWN A;  2K4D A;  1ZBD B;  5LKT A;  3LQH A;  2HYE D;  1MM2 A;  2EA6 A;  3FM8 C;  3DPL R;  5SVX A;  3KV6 A;  3ZYQ A;  3LRQ A;  1XWH A;  3PUQ A;  5KH3 A;  2LAU A;  2CSV A;  1WEQ A;  4A4C A;  3LQI A;  3FAO A;  4I7B A;  4FO9 A;  2KWO A;  4O64 A;  2JUN A;  3O34 A;  4BBQ A;  2MD8 C;  4OGE A;  2F6N A;  3U5M A;  4FK5 A;  5SVI B;  1K2F A;  1VD4 A;  2XOC A;  3M99 A;  2EXU A;  2IQJ A;  2LRI C;  2L5U A;  4V3L C;  2OWA A;  2DJA A;  2MA5 A;  3T6R A;  2LGG A;  5DKA A;  4S3O C;  5EYA F;  5D1K B;  3T9K A;  2PUY A;  2KIZ A;  4IC3 A;  2ECI A;  5SVI A;  2YVR A;  3RTR B;  2MNY A;  2PNX A;  2XB1 A;  1FP0 A;  2CT2 A;  2YW8 A;  3O36 A;  5TRB A;  1T1H A;  1IYM A;  3M63 A;  4PTB A;  2C2V S;  4FIP A;  4ZQL A;  1JOC A;  2VJF B;  3NG2 A;  2ECT A;  3PUR A;  2LGV A;  2EGP A;  4AUQ B;  2D8S A;  5H1U A;  2ECV A;  2Y43 A;  2JMJ A;  2JMD A;  3U5N A;  1WEN A;  3M7K A;  2FUI A;  1V87 A;  2K17 A;  2YSJ A;  4CCG X;  2RI7 A;  1MM3 A;  2QIC A;  3N9Q A;  3RPG B;  1HYI A;  2DX8 A;  3SUB A;  4P5O B;  2FSA A;  2VP7 A;  4L58 A;  1MBM A;  4UP0 A;  3PHD A;  5I3L A;  2XP0 A;  4I7D A;  2M85 A;  2E6S A;  2VJF A;  1Z2Q A;  4A0C D;  2ZET C;  5H1T A;  5D1M B;  1X4J A;  4B7Y C;  4N4F A;  2RSD A;  1G25 A;  3O37 A;  3C6W A;  1WEV A;  4Z0R A;  3ZNI A;  2LV9 A;  4C9Z A;  3KV5 A;  4MSX A;  4WZ2 A;  2ECJ A;  2YQL A;  4YBS A;  5C13 A;  1FBV A;  1WIL A;  2RR4 A;  3KNV A;  2M3H A;  2D8U A;  4LAD B;  5G0F A;  3EB5 A;  3N9L A;  3QZV A;  4TKP B;  2YU4 A;  1X4U A;  4F1P A;  1BOR A;  2VJE B;  2CSZ A;  2G45 A;  1DCQ A;  4QF2 A;  2KE1 A;  4WA6 A;  4WZ0 A;  1VFY A;  5KH9 A;  2LDR A;  2KYU A;  4QQ4 A;  3LQJ A;  3V43 A;  4GNE A;  5AIT A;  3DDT A;  2NAA A;  4B86 C;  2ECG A;  2UZG A;  1U6G B;  3LDY A;  2XOY A;  4R2Y A;  5K3Q A;  2AN6 A;  2VJE A;  3ASL A;  1WEU A;  2KR4 A;  3MDB C;  2HDP A;  3FL2 A;  2KKX A;  4YAT A;  4A49 A;  2KWJ A;  2M13 A;  5B78 A;  3T7L A;  3ZVZ B;  3PLW A;  4XI1 A;  4UP5 A;  5JG6 A;  4ZUX U;  2L75 A;  3RPG C;  1X4I A;  5H1V A;  1Z60 A;  2YHN A;  2LQ6 A;  4LK9 A;  2L43 A;  5B75 A;  4QF3 A;  5AIU A;  4LJN A;  3VK6 A;  1HYJ A;  1Z6U A;  4H9D A;  4ZDT A;  2KGI A;  4PPE A;  5SVY A;  5FB1 A;  4IC2 A;  2JM3 A;  3FAN A;  3O7A A;  5C11 A;  3U5P A;  2KRE A;  2MT5 A;  2FFW A;  2YYR A;  2M1R A;  5G05 B;  3Q1D A;  4YC9 A;  5J3X A;  2VNF A;  2M6M A;  3N9O A;  4R8P K;  2VPB A;  2XOZ A;  2E6R A;  3ZTG A;  5LCW B;  3HCU A;  3IHP A;  3N9N A;  4GNG A;  4LKA A;  4Q6F A;  4X3G A;  2JMI A;  3N9P A;  2L0B A;  2H0D B; 
#chains in the Genus database with same CATH homology
 3N9M A;  3HCS A;  3L1X A;  1VYX A;  2KFT A;  2VPG A;  5TAB A;  1WEW A;  2QJ0 A;  4YAB A;  5LKU A;  2MIQ A;  2YRE A;  4MVT A;  4GB0 A;  1E4U A;  2G43 A;  2F42 A;  1F62 A;  4FJC A;  2Y1N A;  2YUC A;  4F52 B;  2KU3 A;  5DIN A;  1WEM A;  2LGK A;  3HTK C;  5TBN A;  2H0D A;  2L80 A;  2XEU A;  4W4U A;  2G6Q A;  1WFK A;  2MA6 A;  2YT5 A;  5B8D A;  3L1Z B;  2LXH C;  2QIZ A;  3ZVY A;  1RMD A;  3O33 A;  4YBM A;  5B77 A;  2ECW A;  3EB6 A;  5FB0 A;  5LKX A;  2YHO A;  4N3W A;  5B79 A;  1DVP A;  1WGM A;  5KH7 A;  3ZPV E;  4YAX A;  2ECN A;  4R7E A;  2YUR A;  4YAD A;  3SOU A;  5D1L B;  3ZPV 1;  2K1J A;  2CSY A;  2CKL B;  2LXP C;  2FUU A;  4AYC B;  2VPE A;  4UI9 B;  4BHW A;  4LLB A;  4GND A;  3DQV R;  4V3K C;  3I2D A;  1WIM A;  3M62 A;  2I50 A;  4CA1 A;  4I7C A;  2IDA A;  1LDK C;  2LN0 A;  2Y1M A;  1JM7 B;  2CKL A;  2EOD A;  5H9M A;  3O35 A;  2C2L A;  3GV4 A;  4AYC A;  5B76 A;  2JRJ A;  3L11 A;  3U5O A;  2LGL A;  3SHB A;  1WEO A;  3C5K A;  2KGG A;  3GL6 A;  4S3O B;  2YSM A;  4WZ3 B;  4A4B A;  4NN2 A;  5FER A;  1WEE A;  5G04 B;  2VPD A;  3MHH A;  1LDJ B;  3O70 A;  3SOX A;  2KWK A;  1JM7 A;  2BAY A;  2MUM A;  2MD7 B;  1WES A;  3HCT A;  4GNF A;  3MHS A;  3SOW A;  5TDW A;  1CHC A;  5TDR A;  4AVX A;  1N87 A;  1WEP A;  4AP4 A;  2YQM A;  4YBT A;  3KQI A;  4L7X A;  1WE9 A;  2K16 A;  5FEY A;  2F6J A;  2OXQ C;  5LKZ A;  2MNZ A;  2KWN A;  2K4D A;  1ZBD B;  5LKT A;  3LQH A;  2HYE D;  1MM2 A;  2EA6 A;  3DPL R;  3KV6 A;  3ZYQ A;  3LRQ A;  1XWH A;  3PUQ A;  5KH3 A;  1WEQ A;  4A4C A;  3LQI A;  4I7B A;  4FO9 A;  2KWO A;  4O64 A;  3O34 A;  4BBQ A;  2MD8 C;  2F6N A;  3U5M A;  4FK5 A;  1K2F A;  1VD4 A;  3M99 A;  2LRI C;  2L5U A;  4V3L C;  2MA5 A;  3T6R A;  2LGG A;  5DKA A;  4S3O C;  5EYA F;  5D1K B;  2PUY A;  2KIZ A;  4IC3 A;  2ECI A;  3RTR B;  2MNY A;  2PNX A;  2XB1 A;  1FP0 A;  2CT2 A;  2YW8 A;  3O36 A;  5TRB A;  1T1H A;  1IYM A;  3M63 A;  4PTB A;  2C2V S;  4FIP A;  4ZQL A;  1JOC A;  2VJF B;  3NG2 A;  2ECT A;  3PUR A;  2LGV A;  2EGP A;  4AUQ B;  2D8S A;  5H1U A;  2ECV A;  2Y43 A;  2JMJ A;  2JMD A;  3U5N A;  1WEN A;  2FUI A;  1V87 A;  2K17 A;  2YSJ A;  4CCG X;  2RI7 A;  1MM3 A;  2QIC A;  3N9Q A;  3RPG B;  1HYI A;  2DX8 A;  4P5O B;  2FSA A;  2VP7 A;  4L58 A;  4UP0 A;  3PHD A;  5I3L A;  4I7D A;  2M85 A;  2E6S A;  2VJF A;  1Z2Q A;  4A0C D;  2ZET C;  5H1T A;  5D1M B;  1X4J A;  4B7Y C;  4N4F A;  2RSD A;  1G25 A;  3O37 A;  3C6W A;  1WEV A;  3ZNI A;  2LV9 A;  4C9Z A;  3KV5 A;  4MSX A;  4WZ2 A;  2ECJ A;  2YQL A;  4YBS A;  5C13 A;  1FBV A;  1WIL A;  3KNV A;  2M3H A;  4LAD B;  5G0F A;  3EB5 A;  3N9L A;  3QZV A;  4TKP B;  2YU4 A;  1X4U A;  1BOR A;  2VJE B;  2CSZ A;  2G45 A;  4QF2 A;  2KE1 A;  4WA6 A;  4WZ0 A;  1VFY A;  5KH9 A;  2LDR A;  2KYU A;  3LQJ A;  3V43 A;  4GNE A;  5AIT A;  2NAA A;  4B86 C;  2ECG A;  2UZG A;  1U6G B;  4R2Y A;  2AN6 A;  2VJE A;  3ASL A;  1WEU A;  2KR4 A;  2HDP A;  3FL2 A;  4YAT A;  4A49 A;  2KWJ A;  5B78 A;  3T7L A;  3ZVZ B;  4XI1 A;  4UP5 A;  5JG6 A;  4ZUX U;  2L75 A;  3RPG C;  1X4I A;  5H1V A;  1Z60 A;  2YHN A;  2LQ6 A;  4LK9 A;  2L43 A;  5B75 A;  4QF3 A;  5AIU A;  4LJN A;  3VK6 A;  1HYJ A;  1Z6U A;  4ZDT A;  2KGI A;  4PPE A;  5FB1 A;  4IC2 A;  3O7A A;  5C11 A;  3U5P A;  2KRE A;  2MT5 A;  2YYR A;  2M1R A;  5G05 B;  4YC9 A;  5J3X A;  2VNF A;  2M6M A;  3N9O A;  4R8P K;  2VPB A;  3ZTG A;  2E6R A;  5LCW B;  3HCU A;  3IHP A;  3N9N A;  4GNG A;  4LKA A;  4Q6F A;  4X3G A;  2JMI A;  3N9P A;  2L0B A;  2H0D B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...