3C5KA

Crystal structure of human hdac6 zinc finger domain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
108
structure length
108
Chain Sequence
SPLPWCPHLVAVCPIPAAGLDVTQPCGDCGTIQENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYVHHQALLDVKNIAHQNKFGEDMPHPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone deacetylase 6
publication title Crystal Structure of Human HDAC6 zinc finger domain.
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 29
structure length 108
sequence length 108
ec nomenclature ec 3.5.1.98: Histone deacetylase.
pdb deposition date 2008-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3c5kA00
4GNGA 2L5UA 1V87A 1FP0A 4TKPB 2F42A 1Z60A 4N4FA 2Y1NA 2KGGA 2C2LA 4GNFA 2F6JA 5C11A 4GNEA 2M3HA 2Y1MA 3LQJA 3HCTA 4UP0A 3QZVA 3T7LA 3GL6A 1HYJA 4FK5A 2ECWA 1VYXA 4A49A 2LQ6A 1WENA 5TBNA 4MSXA 2YREA 2LDRA 2K16A 4X3GA 1T1HA 4N3WA 4AP4A 1CHCA 5TRBA 4QF2A 4UI9B 4YATA 4ZQLA 5I3LA 4LLBA 1JM7A 4B86C 3VK6A 1VD4A 4BHWA 2YUCA 3DPLR 2MNZA 2AN6A 2HDPA 4YBTA 2XEUA 3KV5A 4I7CA 2BAYA 5KH9A 2LXHC 3O7AA 3V43A 5B79A 4YABA 1FBVA 5G04B 2KIZA 2G43A 3N9NA 1WGMA 5FERA 5DINA 2MNYA 2LGVA 3N9QA 2MIQA 2VP7A 4YAXA 2YQLA 2KWNA 2KWKA 3T6RA 2ECTA 3DQVR 2EODA 4WZ3B 4MVTA 2QJ0A 2ECNA 1WFKA 3ZPVE 4WA6A 4L7XA 4LK9A 3EB5A 2HYED 4CA1A 4R8PK 3O35A 2VJEA 3EB6A 3U5PA 2LGKA 1XWHA 4AUQB 2CKLA 2UZGA 4FJCA 2K4DA 2MUMA 3SOXA 4A4BA 4S3OB 2MD8C 1E4UA 5EYAF 3N9OA 2DX8A 1ZBDB 2F6NA 2C2VS 2RSDA 4WZ0A 5J3XA 4L58A 4AYCB 2CSZA 3RPGB 3ZTGA 3FL2A 1MM2A 2VPGA 3HTKC 2VJFB 2KE1A 2CSYA 5AIUA 4LADB 4UP5A 3ASLA 2L43A 2LRIC 2JRJA 3PURA 5TDRA 4S3OC 1K2FA 4I7DA 2H0DB 1Z6UA 5B76A 5D1LB 3RTRB 3RPGC 2D8SA 3KNVA 2VPEA 5FB1A 1WEWA 2LXPC 5LKTA 2JMDA 3KV6A 2VNFA 4V3LC 2QICA 5AITA 3ZVYA 1F62A 5G05B 1X4UA 4AVXA 2I50A 1WEUA 3HCUA 5TABA 4R7EA 3SOUA 2KWOA 3U5NA 1BORA 4YBMA 5KH3A 2YU4A 2L0BA 5D1MB 1DVPA 2M6MA 2KGIA 1WEEA 5JG6A 4ZDTA 2YHOA 2YURA 4CCGX 1LDKC 5KH7A 3M99A 2FUIA 3ZNIA 4WZ2A 2ECGA 3N9LA 1VFYA 5G0FA 3SHBA 2PNXA 4QF3A 4W4UA 2KFTA 2NAAA 1RMDA 3SOWA 2LGLA 3MHHA 2CT2A 1X4JA 1WILA 3L11A 4O64A 2YT5A 2MA6A 1WEOA 1JM7B 5LKUA 1G25A 5H1VA 5H1TA 3PHDA 3HCSA 1U6GB 4FO9A 3LQIA 4ZUXU 2L80A 5C13A 4YC9A 1WEMA 2YQMA 2EA6A 2OXQC 2JMJA 2KWJA 4P5OB 2E6SA 3U5MA 2G6QA 2K1JA 3LQHA 4XI1A 1WEPA 4F52B 3O34A 5B78A 4B7YC 5B77A 2IDAA 2K17A 3O70A 2VPBA 4LJNA 3U5OA 5H1UA 2YSJA 1X4IA 3ZVZB 4AYCA 2YW8A 1LDJB 2G45A 1IYMA 1WE9A 3I2DA 4IC2A 2Y43A 3O36A 1JOCA 2XB1A 4PPEA 2EGPA 2YSMA 3KQIA 2E6RA 2VJFA 4PTBA 1WIMA 1N87A 2VPDA 2MT5A 1WESA 2LN0A 2FSAA 3L1ZB 2VJEB 5LKXA 4FIPA 2KREA 2YYRA 2ECIA 3N9MA 2RI7A 2CKLB 4R2YA 5FEYA 3NG2A 2LGGA 3GV4A 2PUYA 4GB0A 5DKAA 3O37A 2KYUA 4NN2A 2H0DA 1Z2QA 1MM3A 4LKAA 3MHSA 2L75A 3IHPA 2ECJA 2ZETC 3N9PA 3L1XA 3ZYQA 4C9ZA 1WEVA 4YBSA 2M1RA 4I7BA 5B75A 5B8DA 2M85A 4BBQA 3C5KA 3M62A 4YADA 2YHNA 3C6WA 4GNDA 2FUUA 2JMIA 3PUQA 4IC3A 4A4CA 3ZPV1 3M63A 1HYIA 1WEQA 2MD7B 2QIZA 5TDWA 5D1KB 5FB0A 2KU3A 5LKZA 2KR4A 5H9MA 4Q6FA 4V3KC 2ECVA 2LV9A 4A0CD 5LCWB 3LRQA 3O33A 2MA5A
chains in the Genus database with same CATH superfamily
4GNGA 2L5UA 1V87A 1FP0A 4TKPB 4QQ4A 2F42A 5SVYA 1Z60A 2D8UA 4N4FA 2Y1NA 3JUEA 2KGGA 2C2LA 4GNFA 2F6JA 3FAOA 5C11A 4GNEA 3FM8C 2M3HA 2Y1MA 3LQJA 3HCTA 4UP0A 3QZVA 3T7LA 3GL6A 1HYJA 4FK5A 2ECWA 1VYXA 4A49A 2LQ6A 1WENA 5TBNA 4MSXA 2L7PA 2YREA 4OGEA 3E2DA 2FD4A 2LDRA 2MKEA 2XP0A 2K16A 4X3GA 1T1HA 4N3WA 4AP4A 1CHCA 5TRBA 4QF2A 4UI9B 4YATA 4ZQLA 5I3LA 4LLBA 1JM7A 2E61A 4B86C 3VK6A 3M7KA 1VD4A 4BHWA 2XOYA 2YUCA 3DPLR 2MNZA 2AN6A 2HDPA 4YBTA 4O62A 2XEUA 3PLWA 3KV5A 4I7CA 1DCQA 2BAYA 5KH9A 2LXHC 3FANA 3O7AA 2YVRA 3Q1DA 3V43A 5B79A 3H7HA 4YABA 1FBVA 5G04B 2EGMA 2KIZA 2G43A 3LVQE 3N9NA 1WGMA 5FERA 2DSMA 5DINA 2MNYA 2LGVA 3N9QA 2MIQA 2VP7A 2LAUA 4YAXA 2YQLA 2KWNA 2KWKA 3T6RA 2ECTA 3DQVR 2EODA 4WZ3B 4MVTA 2QJ0A 2ECNA 1WFKA 3ZPVE 4WA6A 4L7XA 4LK9A 3EB5A 2HYED 4CA1A 4R8PK 3O35A 2VJEA 3EB6A 3U5PA 2LGKA 1XWHA 2CSVA 4AUQB 5SVIA 2CKLA 2UZGA 4FJCA 2K4DA 2MUMA 3MDBC 3SOXA 4A4BA 4S3OB 2MD8C 1E4UA 2DJAA 5EYAF 3N9OA 2DX8A 1ZBDB 2F6NA 2C2VS 2RSDA 2XOZA 3DDTA 4WZ0A 5J3XA 4L58A 4AYCB 2IQJA 2CSZA 3RPGB 3ZTGA 3FL2A 1MM2A 2VPGA 3HTKC 2RR4A 2VJFB 4H9DA 2KE1A 2CSYA 5AIUA 4LADB 4UP5A 3ASLA 2L43A 4Z0RA 2LRIC 2JRJA 3PURA 5TDRA 3LJUX 4S3OC 1K2FA 4I7DA 3FJUB 2H0DB 1Z6UA 5B76A 5D1LB 2CONA 3FEHA 3RTRB 3RPGC 4F1PA 2D8SA 2CRWA 3KNVA 2VPEA 5FB1A 1WEWA 2LXPC 5LKTA 3O47A 2JMDA 3KV6A 2VNFA 4V3LC 2QICA 5AITA 3ZVYA 1F62A 5G05B 4Z0OA 1X4UA 5K3QA 4AVXA 2I50A 1WEUA 3HCUA 5TABA 4R7EA 3SOUA 2KWOA 3U5NA 1BORA 4YBMA 5KH3A 2YU4A 2L0BA 5D1MB 3LDYA 1DVPA 2M6MA 2KGIA 1WEEA 5JG6A 4ZDTA 2YHOA 2YURA 4CCGX 2P57A 1LDKC 5KH7A 3M99A 2FUIA 3ZNIA 4WZ2A 2ECGA 3N9LA 1VFYA 5G0FA 3SHBA 2PNXA 4QF3A 4W4UA 2KFTA 2NAAA 1RMDA 3SOWA 2LGLA 1MBMA 2EXUA 3LVRE 3MHHA 3SUBA 2CT2A 1X4JA 1WILA 3T9KA 4OGCA 2OWAA 3L11A 4O64A 2YT5A 2MA6A 2M13A 1WEOA 1JM7B 5LKUA 1G25A 5H1VA 5H1TA 3PHDA 3HCSA 1U6GB 4FO9A 3LQIA 4ZUXU 2L80A 5C13A 4YC9A 1WEMA 2YQMA 2EA6A 2OXQC 2JMJA 2KWJA 4P5OB 2E6SA 3U5MA 2G6QA 2K1JA 3LQHA 4XI1A 1WEPA 4F52B 3O34A 5B78A 4B7YC 5B77A 2IDAA 2K17A 3O70A 2VPBA 2B0OE 4LJNA 3U5OA 5H1UA 2YSJA 1X4IA 3ZVZB 4AYCA 2YW8A 1LDJB 2G45A 1IYMA 1WE9A 3I2DA 4IC2A 2Y43A 3O36A 1JOCA 2JUNA 2XB1A 4PPEA 2EGPA 2YSMA 3KQIA 2E6RA 2VJFA 4PTBA 1WIMA 1N87A 2KKXA 2VPDA 2MT5A 1WESA 2LN0A 2FSAA 3L1ZB 2VJEB 5LKXA 4FIPA 2KREA 2YYRA 2ECIA 3N9MA 2RI7A 2CKLB 4R2YA 5SVIB 5FEYA 3NG2A 2LGGA 3GV4A 2PUYA 4GB0A 5DKAA 3O37A 2KYUA 4NN2A 2H0DA 1Z2QA 3KDEC 1MM3A 2FFWA 4LKAA 3MHSA 2L75A 3IHPA 2ECJA 2ZETC 3N9PA 3L1XA 3ZYQA 4C9ZA 1WEVA 4YBSA 2M1RA 3DWDA 4I7BA 5B8DA 5B75A 2M85A 4BBQA 3C5KA 3M62A 4YADA 2YHNA 3C6WA 4GNDA 2FUUA 2JMIA 3PUQA 4IC3A 2XOCA 4A4CA 2JM3A 3ZPV1 3M63A 1HYIA 1WEQA 2MD7B 2QIZA 5SVXA 5TDWA 5D1KB 5FB0A 2KU3A 5LKZA 2KKYA 2KR4A 5H9MA 4Q6FA 4V3KC 2ECVA 2LV9A 2CRRA 4A0CD 5LCWB 3LRQA 3O33A 2MA5A
chains in the Genus database with same CATH topology
4GNGA 2L5UA 1V87A 1FP0A 4TKPB 2F42A 1Z60A 4N4FA 2Y1NA 2KGGA 2C2LA 4GNFA 2F6JA 5C11A 4GNEA 2M3HA 2Y1MA 3LQJA 3HCTA 4UP0A 3QZVA 3T7LA 3GL6A 1HYJA 4FK5A 2ECWA 1VYXA 4A49A 2LQ6A 1WENA 5TBNA 4MSXA 2YREA 2LDRA 2K16A 4X3GA 1T1HA 4N3WA 4AP4A 1CHCA 5TRBA 4QF2A 4UI9B 4YATA 4ZQLA 5I3LA 4LLBA 1JM7A 4B86C 3VK6A 1VD4A 4BHWA 2YUCA 3DPLR 2MNZA 2AN6A 2HDPA 4YBTA 2XEUA 3KV5A 4I7CA 2BAYA 5KH9A 2LXHC 3O7AA 3V43A 5B79A 4YABA 1FBVA 5G04B 2KIZA 2G43A 3N9NA 1WGMA 5FERA 5DINA 2MNYA 2LGVA 3N9QA 2MIQA 2VP7A 4YAXA 2YQLA 2KWNA 2KWKA 3T6RA 2ECTA 3DQVR 2EODA 4WZ3B 4MVTA 2QJ0A 2ECNA 1WFKA 3ZPVE 4WA6A 4L7XA 4LK9A 3EB5A 2HYED 4CA1A 4R8PK 3O35A 2VJEA 3EB6A 3U5PA 2LGKA 1XWHA 4AUQB 2CKLA 2UZGA 4FJCA 2K4DA 2MUMA 3SOXA 4A4BA 4S3OB 2MD8C 1E4UA 5EYAF 3N9OA 2DX8A 1ZBDB 2F6NA 2C2VS 2RSDA 4WZ0A 5J3XA 4L58A 4AYCB 2CSZA 3RPGB 3ZTGA 3FL2A 1MM2A 2VPGA 3HTKC 2VJFB 2KE1A 2CSYA 5AIUA 4LADB 4UP5A 3ASLA 2L43A 2LRIC 2JRJA 3PURA 5TDRA 4S3OC 1K2FA 4I7DA 2H0DB 1Z6UA 5B76A 5D1LB 3RTRB 3RPGC 2D8SA 3KNVA 2VPEA 5FB1A 1WEWA 2LXPC 5LKTA 2JMDA 3KV6A 2VNFA 4V3LC 2QICA 5AITA 3ZVYA 1F62A 5G05B 1X4UA 4AVXA 2I50A 1WEUA 3HCUA 5TABA 4R7EA 3SOUA 2KWOA 3U5NA 1BORA 4YBMA 5KH3A 2YU4A 2L0BA 5D1MB 1DVPA 2M6MA 2KGIA 1WEEA 5JG6A 4ZDTA 2YHOA 2YURA 4CCGX 1LDKC 5KH7A 3M99A 2FUIA 3ZNIA 4WZ2A 2ECGA 3N9LA 1VFYA 5G0FA 3SHBA 2PNXA 4QF3A 4W4UA 2KFTA 2NAAA 1RMDA 3SOWA 2LGLA 3MHHA 2CT2A 1X4JA 1WILA 3L11A 4O64A 2YT5A 2MA6A 1WEOA 1JM7B 5LKUA 1G25A 5H1VA 5H1TA 3PHDA 3HCSA 1U6GB 4FO9A 3LQIA 4ZUXU 2L80A 5C13A 4YC9A 1WEMA 2YQMA 2EA6A 2OXQC 2JMJA 2KWJA 4P5OB 2E6SA 3U5MA 2G6QA 2K1JA 3LQHA 4XI1A 1WEPA 4F52B 3O34A 5B78A 4B7YC 5B77A 2IDAA 2K17A 3O70A 2VPBA 4LJNA 3U5OA 5H1UA 2YSJA 1X4IA 3ZVZB 4AYCA 2YW8A 1LDJB 2G45A 1IYMA 1WE9A 3I2DA 4IC2A 2Y43A 3O36A 1JOCA 2XB1A 4PPEA 2EGPA 2YSMA 3KQIA 2E6RA 2VJFA 4PTBA 1WIMA 1N87A 2VPDA 2MT5A 1WESA 2LN0A 2FSAA 3L1ZB 2VJEB 5LKXA 4FIPA 2KREA 2YYRA 2ECIA 3N9MA 2RI7A 2CKLB 4R2YA 5FEYA 3NG2A 2LGGA 3GV4A 2PUYA 4GB0A 5DKAA 3O37A 2KYUA 4NN2A 2H0DA 1Z2QA 1MM3A 4LKAA 3MHSA 2L75A 3IHPA 2ECJA 2ZETC 3N9PA 3L1XA 3ZYQA 4C9ZA 1WEVA 4YBSA 2M1RA 4I7BA 5B75A 5B8DA 2M85A 4BBQA 3C5KA 3M62A 4YADA 2YHNA 3C6WA 4GNDA 2FUUA 2JMIA 3PUQA 4IC3A 4A4CA 3ZPV1 3M63A 1HYIA 1WEQA 2MD7B 2QIZA 5TDWA 5D1KB 5FB0A 2KU3A 5LKZA 2KR4A 5H9MA 4Q6FA 4V3KC 2ECVA 2LV9A 4A0CD 5LCWB 3LRQA 3O33A 2MA5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GNG A;  2L5U A;  1V87 A;  1FP0 A;  4TKP B;  2F42 A;  1Z60 A;  4N4F A;  2Y1N A;  2KGG A;  2C2L A;  4GNF A;  2F6J A;  5C11 A;  4GNE A;  2M3H A;  2Y1M A;  3LQJ A;  3HCT A;  4UP0 A;  3QZV A;  3T7L A;  3GL6 A;  1HYJ A;  4FK5 A;  2ECW A;  1VYX A;  4A49 A;  2LQ6 A;  1WEN A;  5TBN A;  4MSX A;  2YRE A;  2LDR A;  2K16 A;  4X3G A;  1T1H A;  4N3W A;  4AP4 A;  1CHC A;  5TRB A;  4QF2 A;  4UI9 B;  4YAT A;  4ZQL A;  5I3L A;  4LLB A;  1JM7 A;  4B86 C;  3VK6 A;  1VD4 A;  4BHW A;  2YUC A;  3DPL R;  2MNZ A;  2AN6 A;  2HDP A;  4YBT A;  2XEU A;  3KV5 A;  4I7C A;  2BAY A;  5KH9 A;  2LXH C;  3O7A A;  3V43 A;  5B79 A;  4YAB A;  1FBV A;  5G04 B;  2KIZ A;  2G43 A;  3N9N A;  1WGM A;  5FER A;  5DIN A;  2MNY A;  2LGV A;  3N9Q A;  2MIQ A;  2VP7 A;  4YAX A;  2YQL A;  2KWN A;  2KWK A;  3T6R A;  2ECT A;  3DQV R;  2EOD A;  4WZ3 B;  4MVT A;  2QJ0 A;  2ECN A;  1WFK A;  3ZPV E;  4WA6 A;  4L7X A;  4LK9 A;  3EB5 A;  2HYE D;  4CA1 A;  4R8P K;  3O35 A;  2VJE A;  3EB6 A;  3U5P A;  2LGK A;  1XWH A;  4AUQ B;  2CKL A;  2UZG A;  4FJC A;  2K4D A;  2MUM A;  3SOX A;  4A4B A;  4S3O B;  2MD8 C;  1E4U A;  5EYA F;  3N9O A;  2DX8 A;  1ZBD B;  2F6N A;  2C2V S;  2RSD A;  4WZ0 A;  5J3X A;  4L58 A;  4AYC B;  2CSZ A;  3RPG B;  3ZTG A;  3FL2 A;  1MM2 A;  2VPG A;  3HTK C;  2VJF B;  2KE1 A;  2CSY A;  5AIU A;  4LAD B;  4UP5 A;  3ASL A;  2L43 A;  2LRI C;  2JRJ A;  3PUR A;  5TDR A;  4S3O C;  1K2F A;  4I7D A;  2H0D B;  1Z6U A;  5B76 A;  5D1L B;  3RTR B;  3RPG C;  2D8S A;  3KNV A;  2VPE A;  5FB1 A;  1WEW A;  2LXP C;  5LKT A;  2JMD A;  3KV6 A;  2VNF A;  4V3L C;  2QIC A;  5AIT A;  3ZVY A;  1F62 A;  5G05 B;  1X4U A;  4AVX A;  2I50 A;  1WEU A;  3HCU A;  5TAB A;  4R7E A;  3SOU A;  2KWO A;  3U5N A;  1BOR A;  4YBM A;  5KH3 A;  2YU4 A;  2L0B A;  5D1M B;  1DVP A;  2M6M A;  2KGI A;  1WEE A;  5JG6 A;  4ZDT A;  2YHO A;  2YUR A;  4CCG X;  1LDK C;  5KH7 A;  3M99 A;  2FUI A;  3ZNI A;  4WZ2 A;  2ECG A;  3N9L A;  1VFY A;  5G0F A;  3SHB A;  2PNX A;  4QF3 A;  4W4U A;  2KFT A;  2NAA A;  1RMD A;  3SOW A;  2LGL A;  3MHH A;  2CT2 A;  1X4J A;  1WIL A;  3L11 A;  4O64 A;  2YT5 A;  2MA6 A;  1WEO A;  1JM7 B;  5LKU A;  1G25 A;  5H1V A;  5H1T A;  3PHD A;  3HCS A;  1U6G B;  4FO9 A;  3LQI A;  4ZUX U;  2L80 A;  5C13 A;  4YC9 A;  1WEM A;  2YQM A;  2EA6 A;  2OXQ C;  2JMJ A;  2KWJ A;  4P5O B;  2E6S A;  3U5M A;  2G6Q A;  2K1J A;  3LQH A;  4XI1 A;  1WEP A;  4F52 B;  3O34 A;  5B78 A;  4B7Y C;  5B77 A;  2IDA A;  2K17 A;  3O70 A;  2VPB A;  4LJN A;  3U5O A;  5H1U A;  2YSJ A;  1X4I A;  3ZVZ B;  4AYC A;  2YW8 A;  1LDJ B;  2G45 A;  1IYM A;  1WE9 A;  3I2D A;  4IC2 A;  2Y43 A;  3O36 A;  1JOC A;  2XB1 A;  4PPE A;  2EGP A;  2YSM A;  3KQI A;  2E6R A;  2VJF A;  4PTB A;  1WIM A;  1N87 A;  2VPD A;  2MT5 A;  1WES A;  2LN0 A;  2FSA A;  3L1Z B;  2VJE B;  5LKX A;  4FIP A;  2KRE A;  2YYR A;  2ECI A;  3N9M A;  2RI7 A;  2CKL B;  4R2Y A;  5FEY A;  3NG2 A;  2LGG A;  3GV4 A;  2PUY A;  4GB0 A;  5DKA A;  3O37 A;  2KYU A;  4NN2 A;  2H0D A;  1Z2Q A;  1MM3 A;  4LKA A;  3MHS A;  2L75 A;  3IHP A;  2ECJ A;  2ZET C;  3N9P A;  3L1X A;  3ZYQ A;  4C9Z A;  1WEV A;  4YBS A;  2M1R A;  4I7B A;  5B75 A;  5B8D A;  2M85 A;  4BBQ A;  3C5K A;  3M62 A;  4YAD A;  2YHN A;  3C6W A;  4GND A;  2FUU A;  2JMI A;  3PUQ A;  4IC3 A;  4A4C A;  3ZPV 1;  3M63 A;  1HYI A;  1WEQ A;  2MD7 B;  2QIZ A;  5TDW A;  5D1K B;  5FB0 A;  2KU3 A;  5LKZ A;  2KR4 A;  5H9M A;  4Q6F A;  4V3K C;  2ECV A;  2LV9 A;  4A0C D;  5LCW B;  3LRQ A;  3O33 A;  2MA5 A; 
#chains in the Genus database with same CATH topology
 4GNG A;  2L5U A;  1V87 A;  1FP0 A;  4TKP B;  4QQ4 A;  2F42 A;  5SVY A;  1Z60 A;  2D8U A;  4N4F A;  2Y1N A;  3JUE A;  2KGG A;  2C2L A;  4GNF A;  2F6J A;  3FAO A;  5C11 A;  4GNE A;  3FM8 C;  2M3H A;  2Y1M A;  3LQJ A;  3HCT A;  4UP0 A;  3QZV A;  3T7L A;  3GL6 A;  1HYJ A;  4FK5 A;  2ECW A;  1VYX A;  4A49 A;  2LQ6 A;  1WEN A;  5TBN A;  4MSX A;  2L7P A;  2YRE A;  4OGE A;  3E2D A;  2FD4 A;  2LDR A;  2MKE A;  2XP0 A;  2K16 A;  4X3G A;  1T1H A;  4N3W A;  4AP4 A;  1CHC A;  5TRB A;  4QF2 A;  4UI9 B;  4YAT A;  4ZQL A;  5I3L A;  4LLB A;  1JM7 A;  2E61 A;  4B86 C;  3VK6 A;  3M7K A;  1VD4 A;  4BHW A;  2XOY A;  2YUC A;  3DPL R;  2MNZ A;  2AN6 A;  2HDP A;  4YBT A;  4O62 A;  2XEU A;  3PLW A;  3KV5 A;  4I7C A;  1DCQ A;  2BAY A;  5KH9 A;  2LXH C;  3FAN A;  3O7A A;  2YVR A;  3Q1D A;  3V43 A;  5B79 A;  3H7H A;  4YAB A;  1FBV A;  5G04 B;  2EGM A;  2KIZ A;  2G43 A;  3LVQ E;  3N9N A;  1WGM A;  5FER A;  2DSM A;  5DIN A;  2MNY A;  2LGV A;  3N9Q A;  2MIQ A;  2VP7 A;  2LAU A;  4YAX A;  2YQL A;  2KWN A;  2KWK A;  3T6R A;  2ECT A;  3DQV R;  2EOD A;  4WZ3 B;  4MVT A;  2QJ0 A;  2ECN A;  1WFK A;  3ZPV E;  4WA6 A;  4L7X A;  4LK9 A;  3EB5 A;  2HYE D;  4CA1 A;  4R8P K;  3O35 A;  2VJE A;  3EB6 A;  3U5P A;  2LGK A;  1XWH A;  2CSV A;  4AUQ B;  5SVI A;  2CKL A;  2UZG A;  4FJC A;  2K4D A;  2MUM A;  3MDB C;  3SOX A;  4A4B A;  4S3O B;  2MD8 C;  1E4U A;  2DJA A;  5EYA F;  3N9O A;  2DX8 A;  1ZBD B;  2F6N A;  2C2V S;  2RSD A;  2XOZ A;  3DDT A;  4WZ0 A;  5J3X A;  4L58 A;  4AYC B;  2IQJ A;  2CSZ A;  3RPG B;  3ZTG A;  3FL2 A;  1MM2 A;  2VPG A;  3HTK C;  2RR4 A;  2VJF B;  4H9D A;  2KE1 A;  2CSY A;  5AIU A;  4LAD B;  4UP5 A;  3ASL A;  2L43 A;  4Z0R A;  2LRI C;  2JRJ A;  3PUR A;  5TDR A;  3LJU X;  4S3O C;  1K2F A;  4I7D A;  3FJU B;  2H0D B;  1Z6U A;  5B76 A;  5D1L B;  2CON A;  3FEH A;  3RTR B;  3RPG C;  4F1P A;  2D8S A;  2CRW A;  3KNV A;  2VPE A;  5FB1 A;  1WEW A;  2LXP C;  5LKT A;  3O47 A;  2JMD A;  3KV6 A;  2VNF A;  4V3L C;  2QIC A;  5AIT A;  3ZVY A;  1F62 A;  5G05 B;  4Z0O A;  1X4U A;  5K3Q A;  4AVX A;  2I50 A;  1WEU A;  3HCU A;  5TAB A;  4R7E A;  3SOU A;  2KWO A;  3U5N A;  1BOR A;  4YBM A;  5KH3 A;  2YU4 A;  2L0B A;  5D1M B;  3LDY A;  1DVP A;  2M6M A;  2KGI A;  1WEE A;  5JG6 A;  4ZDT A;  2YHO A;  2YUR A;  4CCG X;  2P57 A;  1LDK C;  5KH7 A;  3M99 A;  2FUI A;  3ZNI A;  4WZ2 A;  2ECG A;  3N9L A;  1VFY A;  5G0F A;  3SHB A;  2PNX A;  4QF3 A;  4W4U A;  2KFT A;  2NAA A;  1RMD A;  3SOW A;  2LGL A;  1MBM A;  2EXU A;  3LVR E;  3MHH A;  3SUB A;  2CT2 A;  1X4J A;  1WIL A;  3T9K A;  4OGC A;  2OWA A;  3L11 A;  4O64 A;  2YT5 A;  2MA6 A;  2M13 A;  1WEO A;  1JM7 B;  5LKU A;  1G25 A;  5H1V A;  5H1T A;  3PHD A;  3HCS A;  1U6G B;  4FO9 A;  3LQI A;  4ZUX U;  2L80 A;  5C13 A;  4YC9 A;  1WEM A;  2YQM A;  2EA6 A;  2OXQ C;  2JMJ A;  2KWJ A;  4P5O B;  2E6S A;  3U5M A;  2G6Q A;  2K1J A;  3LQH A;  4XI1 A;  1WEP A;  4F52 B;  3O34 A;  5B78 A;  4B7Y C;  5B77 A;  2IDA A;  2K17 A;  3O70 A;  2VPB A;  2B0O E;  4LJN A;  3U5O A;  5H1U A;  2YSJ A;  1X4I A;  3ZVZ B;  4AYC A;  2YW8 A;  1LDJ B;  2G45 A;  1IYM A;  1WE9 A;  3I2D A;  4IC2 A;  2Y43 A;  3O36 A;  1JOC A;  2JUN A;  2XB1 A;  4PPE A;  2EGP A;  2YSM A;  3KQI A;  2E6R A;  2VJF A;  4PTB A;  1WIM A;  1N87 A;  2KKX A;  2VPD A;  2MT5 A;  1WES A;  2LN0 A;  2FSA A;  3L1Z B;  2VJE B;  5LKX A;  4FIP A;  2KRE A;  2YYR A;  2ECI A;  3N9M A;  2RI7 A;  2CKL B;  4R2Y A;  5SVI B;  5FEY A;  3NG2 A;  2LGG A;  3GV4 A;  2PUY A;  4GB0 A;  5DKA A;  3O37 A;  2KYU A;  4NN2 A;  2H0D A;  1Z2Q A;  3KDE C;  1MM3 A;  2FFW A;  4LKA A;  3MHS A;  2L75 A;  3IHP A;  2ECJ A;  2ZET C;  3N9P A;  3L1X A;  3ZYQ A;  4C9Z A;  1WEV A;  4YBS A;  2M1R A;  3DWD A;  4I7B A;  5B8D A;  5B75 A;  2M85 A;  4BBQ A;  3C5K A;  3M62 A;  4YAD A;  2YHN A;  3C6W A;  4GND A;  2FUU A;  2JMI A;  3PUQ A;  4IC3 A;  2XOC A;  4A4C A;  2JM3 A;  3ZPV 1;  3M63 A;  1HYI A;  1WEQ A;  2MD7 B;  2QIZ A;  5SVX A;  5TDW A;  5D1K B;  5FB0 A;  2KU3 A;  5LKZ A;  2KKY A;  2KR4 A;  5H9M A;  4Q6F A;  4V3K C;  2ECV A;  2LV9 A;  2CRR A;  4A0C D;  5LCW B;  3LRQ A;  3O33 A;  2MA5 A; 
#chains in the Genus database with same CATH homology
 4GNG A;  2L5U A;  1V87 A;  1FP0 A;  4TKP B;  2F42 A;  1Z60 A;  4N4F A;  2Y1N A;  2KGG A;  2C2L A;  4GNF A;  2F6J A;  5C11 A;  4GNE A;  2M3H A;  2Y1M A;  3LQJ A;  3HCT A;  4UP0 A;  3QZV A;  3T7L A;  3GL6 A;  1HYJ A;  4FK5 A;  2ECW A;  1VYX A;  4A49 A;  2LQ6 A;  1WEN A;  5TBN A;  4MSX A;  2YRE A;  2LDR A;  2K16 A;  4X3G A;  1T1H A;  4N3W A;  4AP4 A;  1CHC A;  5TRB A;  4QF2 A;  4UI9 B;  4YAT A;  4ZQL A;  5I3L A;  4LLB A;  1JM7 A;  4B86 C;  3VK6 A;  1VD4 A;  4BHW A;  2YUC A;  3DPL R;  2MNZ A;  2AN6 A;  2HDP A;  4YBT A;  2XEU A;  3KV5 A;  4I7C A;  2BAY A;  5KH9 A;  2LXH C;  3O7A A;  3V43 A;  5B79 A;  4YAB A;  1FBV A;  5G04 B;  2KIZ A;  2G43 A;  3N9N A;  1WGM A;  5FER A;  5DIN A;  2MNY A;  2LGV A;  3N9Q A;  2MIQ A;  2VP7 A;  4YAX A;  2YQL A;  2KWN A;  2KWK A;  3T6R A;  2ECT A;  3DQV R;  2EOD A;  4WZ3 B;  4MVT A;  2QJ0 A;  2ECN A;  1WFK A;  3ZPV E;  4WA6 A;  4L7X A;  4LK9 A;  3EB5 A;  2HYE D;  4CA1 A;  4R8P K;  3O35 A;  2VJE A;  3EB6 A;  3U5P A;  2LGK A;  1XWH A;  4AUQ B;  2CKL A;  2UZG A;  4FJC A;  2K4D A;  2MUM A;  3SOX A;  4A4B A;  4S3O B;  2MD8 C;  1E4U A;  5EYA F;  3N9O A;  2DX8 A;  1ZBD B;  2F6N A;  2C2V S;  2RSD A;  4WZ0 A;  5J3X A;  4L58 A;  4AYC B;  2CSZ A;  3RPG B;  3ZTG A;  3FL2 A;  1MM2 A;  2VPG A;  3HTK C;  2VJF B;  2KE1 A;  2CSY A;  5AIU A;  4LAD B;  4UP5 A;  3ASL A;  2L43 A;  2LRI C;  2JRJ A;  3PUR A;  5TDR A;  4S3O C;  1K2F A;  4I7D A;  2H0D B;  1Z6U A;  5B76 A;  5D1L B;  3RTR B;  3RPG C;  2D8S A;  3KNV A;  2VPE A;  5FB1 A;  1WEW A;  2LXP C;  5LKT A;  2JMD A;  3KV6 A;  2VNF A;  4V3L C;  2QIC A;  5AIT A;  3ZVY A;  1F62 A;  5G05 B;  1X4U A;  4AVX A;  2I50 A;  1WEU A;  3HCU A;  5TAB A;  4R7E A;  3SOU A;  2KWO A;  3U5N A;  1BOR A;  4YBM A;  5KH3 A;  2YU4 A;  2L0B A;  5D1M B;  1DVP A;  2M6M A;  2KGI A;  1WEE A;  5JG6 A;  4ZDT A;  2YHO A;  2YUR A;  4CCG X;  1LDK C;  5KH7 A;  3M99 A;  2FUI A;  3ZNI A;  4WZ2 A;  2ECG A;  3N9L A;  1VFY A;  5G0F A;  3SHB A;  2PNX A;  4QF3 A;  4W4U A;  2KFT A;  2NAA A;  1RMD A;  3SOW A;  2LGL A;  3MHH A;  2CT2 A;  1X4J A;  1WIL A;  3L11 A;  4O64 A;  2YT5 A;  2MA6 A;  1WEO A;  1JM7 B;  5LKU A;  1G25 A;  5H1V A;  5H1T A;  3PHD A;  3HCS A;  1U6G B;  4FO9 A;  3LQI A;  4ZUX U;  2L80 A;  5C13 A;  4YC9 A;  1WEM A;  2YQM A;  2EA6 A;  2OXQ C;  2JMJ A;  2KWJ A;  4P5O B;  2E6S A;  3U5M A;  2G6Q A;  2K1J A;  3LQH A;  4XI1 A;  1WEP A;  4F52 B;  3O34 A;  5B78 A;  4B7Y C;  5B77 A;  2IDA A;  2K17 A;  3O70 A;  2VPB A;  4LJN A;  3U5O A;  5H1U A;  2YSJ A;  1X4I A;  3ZVZ B;  4AYC A;  2YW8 A;  1LDJ B;  2G45 A;  1IYM A;  1WE9 A;  3I2D A;  4IC2 A;  2Y43 A;  3O36 A;  1JOC A;  2XB1 A;  4PPE A;  2EGP A;  2YSM A;  3KQI A;  2E6R A;  2VJF A;  4PTB A;  1WIM A;  1N87 A;  2VPD A;  2MT5 A;  1WES A;  2LN0 A;  2FSA A;  3L1Z B;  2VJE B;  5LKX A;  4FIP A;  2KRE A;  2YYR A;  2ECI A;  3N9M A;  2RI7 A;  2CKL B;  4R2Y A;  5FEY A;  3NG2 A;  2LGG A;  3GV4 A;  2PUY A;  4GB0 A;  5DKA A;  3O37 A;  2KYU A;  4NN2 A;  2H0D A;  1Z2Q A;  1MM3 A;  4LKA A;  3MHS A;  2L75 A;  3IHP A;  2ECJ A;  2ZET C;  3N9P A;  3L1X A;  3ZYQ A;  4C9Z A;  1WEV A;  4YBS A;  2M1R A;  4I7B A;  5B75 A;  5B8D A;  2M85 A;  4BBQ A;  3C5K A;  3M62 A;  4YAD A;  2YHN A;  3C6W A;  4GND A;  2FUU A;  2JMI A;  3PUQ A;  4IC3 A;  4A4C A;  3ZPV 1;  3M63 A;  1HYI A;  1WEQ A;  2MD7 B;  2QIZ A;  5TDW A;  5D1K B;  5FB0 A;  2KU3 A;  5LKZ A;  2KR4 A;  5H9M A;  4Q6F A;  4V3K C;  2ECV A;  2LV9 A;  4A0C D;  5LCW B;  3LRQ A;  3O33 A;  2MA5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...