3C5KA

Crystal structure of human hdac6 zinc finger domain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
108
structure length
108
Chain Sequence
SPLPWCPHLVAVCPIPAAGLDVTQPCGDCGTIQENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYVHHQALLDVKNIAHQNKFGEDMPHPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Human HDAC6 zinc finger domain.
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Histone deacetylase 6
total genus 29
structure length 108
sequence length 108
ec nomenclature ec 3.5.1.98: Histone deacetylase.
pdb deposition date 2008-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3c5kA00
2RSDA 4YABA 1WFKA 4AUQB 5J3XA 5H1TA 2FUUA 5JG6A 4UP5A 2L75A 2VNFA 3PUQA 2JMJA 3N9QA 3L11A 2ECTA 4YBSA 2M1RA 2VJEA 1JM7B 2DX8A 5C13A 3U5NA 2K4DA 2QJ0A 2KREA 2EGPA 2YQLA 4F52B 4IC3A 2LQ6A 4YBMA 3MHSA 2QIZA 3M99A 2JMIA 2Y1NA 2BAYA 2LXHC 1HYJA 2MA5A 3N9OA 2ZETC 3T6RA 5D1LB 2RI7A 4UP0A 4S3OB 4GB0A 3PURA 1VYXA 3SOWA 2CKLB 1LDJB 4C9ZA 2K1JA 5G05B 2F42A 2G45A 4IC2A 3SOUA 5FB0A 2YHOA 4O64A 1JM7A 3LRQA 5H9MA 2JRJA 2VJEB 5AIUA 2YW8A 5TBNA 5DKAA 2CT2A 2VJFB 2KIZA 2D8SA 5LKXA 4R2YA 2YSJA 5H1VA 2LN0A 4AVXA 4MVTA 2ECWA 2KWJA 2KE1A 4L7XA 3O7AA 3DQVR 2YSMA 4FJCA 3PHDA 4LLBA 2EA6A 2MT5A 3VK6A 2L43A 3KNVA 4YADA 3M63A 2H0DB 3QZVA 2MA6A 4GNDA 2OXQC 2YQMA 5LKUA 3C6WA 2KGIA 2C2VS 3GL6A 5FEYA 2M3HA 2XEUA 1LDKC 1WENA 4YC9A 3U5MA 5TABA 2VPDA 1WE9A 2C2LA 2FUIA 5G04B 3RTRB 3KQIA 4BHWA 1Z6UA 2CKLA 3HCTA 4BBQA 2PUYA 2MD8C 3N9MA 3ZVYA 3N9PA 5B75A 2K17A 4R7EA 1WEMA 2CSZA 4AYCA 2UZGA 1WILA 1WEWA 2KWNA 5FERA 4CA1A 3ZTGA 2HDPA 4L58A 2KR4A 1IYMA 3C5KA 4FK5A 4GNGA 3I2DA 4TKPB 2H0DA 1JOCA 2K16A 4WZ2A 4X3GA 1MM2A 1ZBDB 2LRIC 1Z2QA 4A0CD 2YREA 4A4BA 4YATA 2YYRA 4N3WA 1HYIA 1WEPA 5B76A 2MNZA 1V87A 2VPBA 3L1ZB 4MSXA 1DVPA 5D1KB 5B79A 2F6NA 2LDRA 4UI9B 3L1XA 2MD7B 3NG2A 5B78A 2L80A 1WEUA 5TDWA 2Y1MA 1MM3A 2LV9A 4WZ0A 3U5PA 4FIPA 3SOXA 4WA6A 2KWKA 3ZPVE 3MHHA 4V3LC 2FSAA 3LQIA 2MUMA 3EB5A 3O70A 3N9LA 2VPEA 3HTKC 4I7BA 2HYED 3O33A 3N9NA 4LJNA 2VP7A 2JMDA 4WZ3B 5G0FA 2G43A 2VJFA 3ASLA 2EODA 1X4IA 2AN6A 2YT5A 1U6GB 1WEOA 3O35A 4A49A 2KGGA 2ECJA 5FB1A 2KWOA 3HCSA 2YURA 5KH7A 2XB1A 1CHCA 4YAXA 5EYAF 1VD4A 2L5UA 5AITA 3DPLR 1X4JA 1WEEA 4W4UA 3HCUA 4A4CA 3SHBA 3M62A 1VFYA 4XI1A 5B77A 2G6QA 1N87A 2MNYA 3KV5A 4I7CA 4I7DA 1E4UA 2KYUA 3ZVZB 4QF3A 4B86C 5C11A 3LQJA 4QF2A 5I3LA 1F62A 4PPEA 2IDAA 4N4FA 5KH3A 2I50A 2M6MA 4LKAA 1FP0A 2LXPC 3KV6A 4V3KC 2QICA 4P5OB 2F6JA 2Y43A 4FO9A 3O34A 2YHNA 1WGMA 2E6RA 3FL2A 3ZPV1 3ZNIA 2LGLA 2KU3A 5DINA 2E6SA 1XWHA 3GV4A 1T1HA 4NN2A 2YUCA 5D1MB 4GNFA 4LK9A 5LCWB 2ECVA 2LGVA 2MIQA 4B7YC 3O36A 1WEQA 5TRBA 4LADB 2VPGA 1X4UA 3V43A 4ZUXU 5TDRA 2CSYA 2KFTA 2ECIA 4R8PK 2LGGA 5H1UA 3EB6A 3RPGC 2ECGA 1G25A 4GNEA 5LKZA 1Z60A 1RMDA 2LGKA 5LKTA 3T7LA 3LQHA 4Q6FA 3ZYQA 2L0BA 4AP4A 5B8DA 4YBTA 2M85A 3IHPA 2NAAA 3O37A 4PTBA 1WESA 4AYCB 1FBVA 4ZDTA 4CCGX 5KH9A 1WEVA 1WIMA 2PNXA 4ZQLA 2ECNA 2YU4A 1BORA 3RPGB 4S3OC 3U5OA 1K2FA
chains in the Genus database with same CATH superfamily
2RSDA 4YABA 1WFKA 4AUQB 5J3XA 5H1TA 2FUUA 3U5OA 5JG6A 4UP5A 2L75A 2VNFA 3PUQA 2JMJA 3N9QA 3L11A 2ECTA 4YBSA 2M1RA 2VJEA 1JM7B 2DX8A 5C13A 3U5NA 2K4DA 2JUNA 2QJ0A 2KREA 2EGPA 2YQLA 4F52B 4IC3A 2LQ6A 4YBMA 3MHSA 2QIZA 3M99A 2JMIA 2Y1NA 2BAYA 2LXHC 3FJUB 1HYJA 2DSMA 2MA5A 3N9OA 2ZETC 3T6RA 5D1LB 2RI7A 2YVRA 4UP0A 4S3OB 4GB0A 3PURA 1VYXA 3SOWA 2CKLB 1LDJB 4C9ZA 3SUBA 2K1JA 5G05B 2F42A 2G45A 4Z0RA 3JUEA 4IC2A 3SOUA 5FB0A 2YHOA 4O64A 1JM7A 3LRQA 3T9KA 5H9MA 2JRJA 2VJEB 5AIUA 2M13A 2YW8A 2L7PA 5TBNA 3FAOA 5DKAA 2CT2A 2VJFB 2KIZA 3FM8C 2D8SA 5LKXA 4R2YA 2YSJA 4OGEA 5H1VA 2LN0A 4AVXA 4MVTA 2ECWA 2KKXA 2KWJA 2KE1A 4L7XA 3O7AA 3DQVR 2YSMA 4FJCA 3PHDA 4LLBA 2EA6A 2MT5A 3VK6A 2L43A 3KNVA 2EXUA 4YADA 2P57A 3M63A 2H0DB 3QZVA 2MA6A 4Z0OA 4GNDA 2OXQC 2YQMA 5LKUA 3C6WA 2KGIA 2C2VS 3GL6A 4QQ4A 5FEYA 2M3HA 2XEUA 1LDKC 1WENA 4YC9A 3U5MA 3M7KA 5TABA 2VPDA 1WE9A 2C2LA 2FUIA 5SVIA 5G04B 3RTRB 3KQIA 2B0OE 4BHWA 1Z6UA 2CKLA 3HCTA 4BBQA 2IQJA 2PUYA 2MD8C 3N9MA 3ZVYA 3N9PA 5B75A 2K17A 4R7EA 1WEMA 2CSZA 4AYCA 3PLWA 2UZGA 1WILA 1WEWA 2KWNA 5FERA 4CA1A 3ZTGA 2HDPA 2XOCA 3LDYA 4L58A 2KR4A 1IYMA 3C5KA 4FK5A 4GNGA 2XOZA 3I2DA 4TKPB 2H0DA 1JOCA 2K16A 3DWDA 4WZ2A 4X3GA 1MM2A 1ZBDB 2LRIC 2CONA 1Z2QA 4A0CD 4A4BA 4YATA 2YYRA 4N3WA 1HYIA 1WEPA 5B76A 2MNZA 1V87A 2XOYA 2VPBA 3L1ZB 3FANA 4MSXA 1DVPA 5D1KB 5B79A 3Q1DA 3KDEC 2F6NA 2LDRA 4UI9B 3L1XA 2MD7B 3NG2A 5B78A 2L80A 1WEUA 5TDWA 2MKEA 2Y1MA 1MM3A 2LV9A 4WZ0A 2CSVA 3U5PA 4FIPA 3SOXA 4WA6A 2KWKA 2E61A 3ZPVE 3MHHA 4V3LC 2FSAA 2OWAA 3LQIA 2MUMA 3EB5A 3O70A 3N9LA 2VPEA 3HTKC 4O62A 4I7BA 2HYED 3O33A 3N9NA 4LJNA 2VP7A 2JMDA 4WZ3B 5G0FA 2G43A 2CRWA 2VJFA 3ASLA 2EODA 1X4IA 2D8UA 3LVRE 2AN6A 2YT5A 1U6GB 1WEOA 3O35A 4A49A 2KGGA 2ECJA 5FB1A 2KWOA 3HCSA 2YURA 3DDTA 5KH7A 5SVIB 2XB1A 1CHCA 5EYAF 4YAXA 4H9DA 1VD4A 2L5UA 5AITA 3DPLR 1X4JA 1WEEA 4W4UA 3HCUA 4A4CA 3SHBA 3M62A 1VFYA 4XI1A 5B77A 2G6QA 1N87A 2MNYA 2DJAA 3KV5A 4I7CA 3LVQE 4I7DA 1E4UA 2CRRA 2KYUA 3ZVZB 4QF3A 4B86C 5C11A 3LQJA 4QF2A 2FFWA 5I3LA 1F62A 4PPEA 2IDAA 4N4FA 5KH3A 1MBMA 2I50A 2M6MA 4LKAA 1FP0A 2LXPC 3KV6A 4V3KC 2QICA 4P5OB 2F6JA 2Y43A 4F1PA 4FO9A 2JM3A 3O34A 2YHNA 1WGMA 2E6RA 3FL2A 3ZPV1 3ZNIA 2LGLA 2KU3A 5DINA 2RR4A 2E6SA 1XWHA 3GV4A 1T1HA 4NN2A 2YUCA 5D1MB 4GNFA 3MDBC 4LK9A 5LCWB 5SVYA 2ECVA 2LGVA 2MIQA 4B7YC 3O36A 1WEQA 3H7HA 2LAUA 5TRBA 4LADB 2VPGA 1X4UA 2KKYA 3V43A 2EGMA 3LJUX 4ZUXU 5TDRA 2CSYA 5K3QA 2KFTA 2ECIA 4R8PK 2LGGA 5H1UA 3EB6A 5SVXA 3E2DA 3RPGC 2ECGA 1G25A 4GNEA 5LKZA 1Z60A 1RMDA 2LGKA 5LKTA 3T7LA 3LQHA 1DCQA 4Q6FA 3ZYQA 2L0BA 4AP4A 5B8DA 4YBTA 2M85A 3IHPA 2NAAA 3O37A 4PTBA 1WESA 4AYCB 1FBVA 2XP0A 4ZDTA 4CCGX 5KH9A 1WEVA 1WIMA 2PNXA 4OGCA 4ZQLA 2FD4A 2ECNA 3O47A 2YU4A 1BORA 3FEHA 3RPGB 4S3OC 2YREA 1K2FA
chains in the Genus database with same CATH topology
2RSDA 4YABA 1WFKA 4AUQB 5J3XA 5H1TA 2FUUA 5JG6A 4UP5A 2L75A 2VNFA 3PUQA 2JMJA 3N9QA 3L11A 2ECTA 4YBSA 2M1RA 2VJEA 1JM7B 2DX8A 5C13A 3U5NA 2K4DA 2QJ0A 2KREA 2EGPA 2YQLA 4F52B 4IC3A 2LQ6A 4YBMA 3MHSA 2QIZA 3M99A 2JMIA 2Y1NA 2BAYA 2LXHC 1HYJA 2MA5A 3N9OA 2ZETC 3T6RA 5D1LB 2RI7A 4UP0A 4S3OB 4GB0A 3PURA 1VYXA 3SOWA 2CKLB 1LDJB 4C9ZA 2K1JA 5G05B 2F42A 2G45A 4IC2A 3SOUA 5FB0A 2YHOA 4O64A 1JM7A 3LRQA 5H9MA 2JRJA 2VJEB 5AIUA 2YW8A 5TBNA 5DKAA 2CT2A 2VJFB 2KIZA 2D8SA 5LKXA 4R2YA 2YSJA 5H1VA 2LN0A 4AVXA 4MVTA 2ECWA 2KWJA 2KE1A 4L7XA 3O7AA 3DQVR 2YSMA 4FJCA 3PHDA 4LLBA 2EA6A 2MT5A 3VK6A 2L43A 3KNVA 4YADA 3M63A 2H0DB 3QZVA 2MA6A 4GNDA 2OXQC 2YQMA 5LKUA 3C6WA 2KGIA 2C2VS 3GL6A 5FEYA 2M3HA 2XEUA 1LDKC 1WENA 4YC9A 3U5MA 5TABA 2VPDA 1WE9A 2C2LA 2FUIA 5G04B 3RTRB 3KQIA 4BHWA 1Z6UA 2CKLA 3HCTA 4BBQA 2PUYA 2MD8C 3N9MA 3ZVYA 3N9PA 5B75A 2K17A 4R7EA 1WEMA 2CSZA 4AYCA 2UZGA 1WILA 1WEWA 2KWNA 5FERA 4CA1A 3ZTGA 2HDPA 4L58A 2KR4A 1IYMA 3C5KA 4FK5A 4GNGA 3I2DA 4TKPB 2H0DA 1JOCA 2K16A 4WZ2A 4X3GA 1MM2A 1ZBDB 2LRIC 1Z2QA 4A0CD 2YREA 4A4BA 4YATA 2YYRA 4N3WA 1HYIA 1WEPA 5B76A 2MNZA 1V87A 2VPBA 3L1ZB 4MSXA 1DVPA 5D1KB 5B79A 2F6NA 2LDRA 4UI9B 3L1XA 2MD7B 3NG2A 5B78A 2L80A 1WEUA 5TDWA 2Y1MA 1MM3A 2LV9A 4WZ0A 3U5PA 4FIPA 3SOXA 4WA6A 2KWKA 3ZPVE 3MHHA 4V3LC 2FSAA 3LQIA 2MUMA 3EB5A 3O70A 3N9LA 2VPEA 3HTKC 4I7BA 2HYED 3O33A 3N9NA 4LJNA 2VP7A 2JMDA 4WZ3B 5G0FA 2G43A 2VJFA 3ASLA 2EODA 1X4IA 2AN6A 2YT5A 1U6GB 1WEOA 3O35A 4A49A 2KGGA 2ECJA 5FB1A 2KWOA 3HCSA 2YURA 5KH7A 2XB1A 1CHCA 4YAXA 5EYAF 1VD4A 2L5UA 5AITA 3DPLR 1X4JA 1WEEA 4W4UA 3HCUA 4A4CA 3SHBA 3M62A 1VFYA 4XI1A 5B77A 2G6QA 1N87A 2MNYA 3KV5A 4I7CA 4I7DA 1E4UA 2KYUA 3ZVZB 4QF3A 4B86C 5C11A 3LQJA 4QF2A 5I3LA 1F62A 4PPEA 2IDAA 4N4FA 5KH3A 2I50A 2M6MA 4LKAA 1FP0A 2LXPC 3KV6A 4V3KC 2QICA 4P5OB 2F6JA 2Y43A 4FO9A 3O34A 2YHNA 1WGMA 2E6RA 3FL2A 3ZPV1 3ZNIA 2LGLA 2KU3A 5DINA 2E6SA 1XWHA 3GV4A 1T1HA 4NN2A 2YUCA 5D1MB 4GNFA 4LK9A 5LCWB 2ECVA 2LGVA 2MIQA 4B7YC 3O36A 1WEQA 5TRBA 4LADB 2VPGA 1X4UA 3V43A 4ZUXU 5TDRA 2CSYA 2KFTA 2ECIA 4R8PK 2LGGA 5H1UA 3EB6A 3RPGC 2ECGA 1G25A 4GNEA 5LKZA 1Z60A 1RMDA 2LGKA 5LKTA 3T7LA 3LQHA 4Q6FA 3ZYQA 2L0BA 4AP4A 5B8DA 4YBTA 2M85A 3IHPA 2NAAA 3O37A 4PTBA 1WESA 4AYCB 1FBVA 4ZDTA 4CCGX 5KH9A 1WEVA 1WIMA 2PNXA 4ZQLA 2ECNA 2YU4A 1BORA 3RPGB 4S3OC 3U5OA 1K2FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RSD A;  4YAB A;  1WFK A;  4AUQ B;  5J3X A;  5H1T A;  2FUU A;  5JG6 A;  4UP5 A;  2L75 A;  2VNF A;  3PUQ A;  2JMJ A;  3N9Q A;  3L11 A;  2ECT A;  4YBS A;  2M1R A;  2VJE A;  1JM7 B;  2DX8 A;  5C13 A;  3U5N A;  2K4D A;  2QJ0 A;  2KRE A;  2EGP A;  2YQL A;  4F52 B;  4IC3 A;  2LQ6 A;  4YBM A;  3MHS A;  2QIZ A;  3M99 A;  2JMI A;  2Y1N A;  2BAY A;  2LXH C;  1HYJ A;  2MA5 A;  3N9O A;  2ZET C;  3T6R A;  5D1L B;  2RI7 A;  4UP0 A;  4S3O B;  4GB0 A;  3PUR A;  1VYX A;  3SOW A;  2CKL B;  1LDJ B;  4C9Z A;  2K1J A;  5G05 B;  2F42 A;  2G45 A;  4IC2 A;  3SOU A;  5FB0 A;  2YHO A;  4O64 A;  1JM7 A;  3LRQ A;  5H9M A;  2JRJ A;  2VJE B;  5AIU A;  2YW8 A;  5TBN A;  5DKA A;  2CT2 A;  2VJF B;  2KIZ A;  2D8S A;  5LKX A;  4R2Y A;  2YSJ A;  5H1V A;  2LN0 A;  4AVX A;  4MVT A;  2ECW A;  2KWJ A;  2KE1 A;  4L7X A;  3O7A A;  3DQV R;  2YSM A;  4FJC A;  3PHD A;  4LLB A;  2EA6 A;  2MT5 A;  3VK6 A;  2L43 A;  3KNV A;  4YAD A;  3M63 A;  2H0D B;  3QZV A;  2MA6 A;  4GND A;  2OXQ C;  2YQM A;  5LKU A;  3C6W A;  2KGI A;  2C2V S;  3GL6 A;  5FEY A;  2M3H A;  2XEU A;  1LDK C;  1WEN A;  4YC9 A;  3U5M A;  5TAB A;  2VPD A;  1WE9 A;  2C2L A;  2FUI A;  5G04 B;  3RTR B;  3KQI A;  4BHW A;  1Z6U A;  2CKL A;  3HCT A;  4BBQ A;  2PUY A;  2MD8 C;  3N9M A;  3ZVY A;  3N9P A;  5B75 A;  2K17 A;  4R7E A;  1WEM A;  2CSZ A;  4AYC A;  2UZG A;  1WIL A;  1WEW A;  2KWN A;  5FER A;  4CA1 A;  3ZTG A;  2HDP A;  4L58 A;  2KR4 A;  1IYM A;  3C5K A;  4FK5 A;  4GNG A;  3I2D A;  4TKP B;  2H0D A;  1JOC A;  2K16 A;  4WZ2 A;  4X3G A;  1MM2 A;  1ZBD B;  2LRI C;  1Z2Q A;  4A0C D;  2YRE A;  4A4B A;  4YAT A;  2YYR A;  4N3W A;  1HYI A;  1WEP A;  5B76 A;  2MNZ A;  1V87 A;  2VPB A;  3L1Z B;  4MSX A;  1DVP A;  5D1K B;  5B79 A;  2F6N A;  2LDR A;  4UI9 B;  3L1X A;  2MD7 B;  3NG2 A;  5B78 A;  2L80 A;  1WEU A;  5TDW A;  2Y1M A;  1MM3 A;  2LV9 A;  4WZ0 A;  3U5P A;  4FIP A;  3SOX A;  4WA6 A;  2KWK A;  3ZPV E;  3MHH A;  4V3L C;  2FSA A;  3LQI A;  2MUM A;  3EB5 A;  3O70 A;  3N9L A;  2VPE A;  3HTK C;  4I7B A;  2HYE D;  3O33 A;  3N9N A;  4LJN A;  2VP7 A;  2JMD A;  4WZ3 B;  5G0F A;  2G43 A;  2VJF A;  3ASL A;  2EOD A;  1X4I A;  2AN6 A;  2YT5 A;  1U6G B;  1WEO A;  3O35 A;  4A49 A;  2KGG A;  2ECJ A;  5FB1 A;  2KWO A;  3HCS A;  2YUR A;  5KH7 A;  2XB1 A;  1CHC A;  4YAX A;  5EYA F;  1VD4 A;  2L5U A;  5AIT A;  3DPL R;  1X4J A;  1WEE A;  4W4U A;  3HCU A;  4A4C A;  3SHB A;  3M62 A;  1VFY A;  4XI1 A;  5B77 A;  2G6Q A;  1N87 A;  2MNY A;  3KV5 A;  4I7C A;  4I7D A;  1E4U A;  2KYU A;  3ZVZ B;  4QF3 A;  4B86 C;  5C11 A;  3LQJ A;  4QF2 A;  5I3L A;  1F62 A;  4PPE A;  2IDA A;  4N4F A;  5KH3 A;  2I50 A;  2M6M A;  4LKA A;  1FP0 A;  2LXP C;  3KV6 A;  4V3K C;  2QIC A;  4P5O B;  2F6J A;  2Y43 A;  4FO9 A;  3O34 A;  2YHN A;  1WGM A;  2E6R A;  3FL2 A;  3ZPV 1;  3ZNI A;  2LGL A;  2KU3 A;  5DIN A;  2E6S A;  1XWH A;  3GV4 A;  1T1H A;  4NN2 A;  2YUC A;  5D1M B;  4GNF A;  4LK9 A;  5LCW B;  2ECV A;  2LGV A;  2MIQ A;  4B7Y C;  3O36 A;  1WEQ A;  5TRB A;  4LAD B;  2VPG A;  1X4U A;  3V43 A;  4ZUX U;  5TDR A;  2CSY A;  2KFT A;  2ECI A;  4R8P K;  2LGG A;  5H1U A;  3EB6 A;  3RPG C;  2ECG A;  1G25 A;  4GNE A;  5LKZ A;  1Z60 A;  1RMD A;  2LGK A;  5LKT A;  3T7L A;  3LQH A;  4Q6F A;  3ZYQ A;  2L0B A;  4AP4 A;  5B8D A;  4YBT A;  2M85 A;  3IHP A;  2NAA A;  3O37 A;  4PTB A;  1WES A;  4AYC B;  1FBV A;  4ZDT A;  4CCG X;  5KH9 A;  1WEV A;  1WIM A;  2PNX A;  4ZQL A;  2ECN A;  2YU4 A;  1BOR A;  3RPG B;  4S3O C;  3U5O A;  1K2F A; 
#chains in the Genus database with same CATH topology
 2RSD A;  4YAB A;  1WFK A;  4AUQ B;  5J3X A;  5H1T A;  2FUU A;  3U5O A;  5JG6 A;  4UP5 A;  2L75 A;  2VNF A;  3PUQ A;  2JMJ A;  3N9Q A;  3L11 A;  2ECT A;  4YBS A;  2M1R A;  2VJE A;  1JM7 B;  2DX8 A;  5C13 A;  3U5N A;  2K4D A;  2JUN A;  2QJ0 A;  2KRE A;  2EGP A;  2YQL A;  4F52 B;  4IC3 A;  2LQ6 A;  4YBM A;  3MHS A;  2QIZ A;  3M99 A;  2JMI A;  2Y1N A;  2BAY A;  2LXH C;  3FJU B;  1HYJ A;  2DSM A;  2MA5 A;  3N9O A;  2ZET C;  3T6R A;  5D1L B;  2RI7 A;  2YVR A;  4UP0 A;  4S3O B;  4GB0 A;  3PUR A;  1VYX A;  3SOW A;  2CKL B;  1LDJ B;  4C9Z A;  3SUB A;  2K1J A;  5G05 B;  2F42 A;  2G45 A;  4Z0R A;  3JUE A;  4IC2 A;  3SOU A;  5FB0 A;  2YHO A;  4O64 A;  1JM7 A;  3LRQ A;  3T9K A;  5H9M A;  2JRJ A;  2VJE B;  5AIU A;  2M13 A;  2YW8 A;  2L7P A;  5TBN A;  3FAO A;  5DKA A;  2CT2 A;  2VJF B;  2KIZ A;  3FM8 C;  2D8S A;  5LKX A;  4R2Y A;  2YSJ A;  4OGE A;  5H1V A;  2LN0 A;  4AVX A;  4MVT A;  2ECW A;  2KKX A;  2KWJ A;  2KE1 A;  4L7X A;  3O7A A;  3DQV R;  2YSM A;  4FJC A;  3PHD A;  4LLB A;  2EA6 A;  2MT5 A;  3VK6 A;  2L43 A;  3KNV A;  2EXU A;  4YAD A;  2P57 A;  3M63 A;  2H0D B;  3QZV A;  2MA6 A;  4Z0O A;  4GND A;  2OXQ C;  2YQM A;  5LKU A;  3C6W A;  2KGI A;  2C2V S;  3GL6 A;  4QQ4 A;  5FEY A;  2M3H A;  2XEU A;  1LDK C;  1WEN A;  4YC9 A;  3U5M A;  3M7K A;  5TAB A;  2VPD A;  1WE9 A;  2C2L A;  2FUI A;  5SVI A;  5G04 B;  3RTR B;  3KQI A;  2B0O E;  4BHW A;  1Z6U A;  2CKL A;  3HCT A;  4BBQ A;  2IQJ A;  2PUY A;  2MD8 C;  3N9M A;  3ZVY A;  3N9P A;  5B75 A;  2K17 A;  4R7E A;  1WEM A;  2CSZ A;  4AYC A;  3PLW A;  2UZG A;  1WIL A;  1WEW A;  2KWN A;  5FER A;  4CA1 A;  3ZTG A;  2HDP A;  2XOC A;  3LDY A;  4L58 A;  2KR4 A;  1IYM A;  3C5K A;  4FK5 A;  4GNG A;  2XOZ A;  3I2D A;  4TKP B;  2H0D A;  1JOC A;  2K16 A;  3DWD A;  4WZ2 A;  4X3G A;  1MM2 A;  1ZBD B;  2LRI C;  2CON A;  1Z2Q A;  4A0C D;  4A4B A;  4YAT A;  2YYR A;  4N3W A;  1HYI A;  1WEP A;  5B76 A;  2MNZ A;  1V87 A;  2XOY A;  2VPB A;  3L1Z B;  3FAN A;  4MSX A;  1DVP A;  5D1K B;  5B79 A;  3Q1D A;  3KDE C;  2F6N A;  2LDR A;  4UI9 B;  3L1X A;  2MD7 B;  3NG2 A;  5B78 A;  2L80 A;  1WEU A;  5TDW A;  2MKE A;  2Y1M A;  1MM3 A;  2LV9 A;  4WZ0 A;  2CSV A;  3U5P A;  4FIP A;  3SOX A;  4WA6 A;  2KWK A;  2E61 A;  3ZPV E;  3MHH A;  4V3L C;  2FSA A;  2OWA A;  3LQI A;  2MUM A;  3EB5 A;  3O70 A;  3N9L A;  2VPE A;  3HTK C;  4O62 A;  4I7B A;  2HYE D;  3O33 A;  3N9N A;  4LJN A;  2VP7 A;  2JMD A;  4WZ3 B;  5G0F A;  2G43 A;  2CRW A;  2VJF A;  3ASL A;  2EOD A;  1X4I A;  2D8U A;  3LVR E;  2AN6 A;  2YT5 A;  1U6G B;  1WEO A;  3O35 A;  4A49 A;  2KGG A;  2ECJ A;  5FB1 A;  2KWO A;  3HCS A;  2YUR A;  3DDT A;  5KH7 A;  5SVI B;  2XB1 A;  1CHC A;  5EYA F;  4YAX A;  4H9D A;  1VD4 A;  2L5U A;  5AIT A;  3DPL R;  1X4J A;  1WEE A;  4W4U A;  3HCU A;  4A4C A;  3SHB A;  3M62 A;  1VFY A;  4XI1 A;  5B77 A;  2G6Q A;  1N87 A;  2MNY A;  2DJA A;  3KV5 A;  4I7C A;  3LVQ E;  4I7D A;  1E4U A;  2CRR A;  2KYU A;  3ZVZ B;  4QF3 A;  4B86 C;  5C11 A;  3LQJ A;  4QF2 A;  2FFW A;  5I3L A;  1F62 A;  4PPE A;  2IDA A;  4N4F A;  5KH3 A;  1MBM A;  2I50 A;  2M6M A;  4LKA A;  1FP0 A;  2LXP C;  3KV6 A;  4V3K C;  2QIC A;  4P5O B;  2F6J A;  2Y43 A;  4F1P A;  4FO9 A;  2JM3 A;  3O34 A;  2YHN A;  1WGM A;  2E6R A;  3FL2 A;  3ZPV 1;  3ZNI A;  2LGL A;  2KU3 A;  5DIN A;  2RR4 A;  2E6S A;  1XWH A;  3GV4 A;  1T1H A;  4NN2 A;  2YUC A;  5D1M B;  4GNF A;  3MDB C;  4LK9 A;  5LCW B;  5SVY A;  2ECV A;  2LGV A;  2MIQ A;  4B7Y C;  3O36 A;  1WEQ A;  3H7H A;  2LAU A;  5TRB A;  4LAD B;  2VPG A;  1X4U A;  2KKY A;  3V43 A;  2EGM A;  3LJU X;  4ZUX U;  5TDR A;  2CSY A;  5K3Q A;  2KFT A;  2ECI A;  4R8P K;  2LGG A;  5H1U A;  3EB6 A;  5SVX A;  3E2D A;  3RPG C;  2ECG A;  1G25 A;  4GNE A;  5LKZ A;  1Z60 A;  1RMD A;  2LGK A;  5LKT A;  3T7L A;  3LQH A;  1DCQ A;  4Q6F A;  3ZYQ A;  2L0B A;  4AP4 A;  5B8D A;  4YBT A;  2M85 A;  3IHP A;  2NAA A;  3O37 A;  4PTB A;  1WES A;  4AYC B;  1FBV A;  2XP0 A;  4ZDT A;  4CCG X;  5KH9 A;  1WEV A;  1WIM A;  2PNX A;  4OGC A;  4ZQL A;  2FD4 A;  2ECN A;  3O47 A;  2YU4 A;  1BOR A;  3FEH A;  3RPG B;  4S3O C;  2YRE A;  1K2F A; 
#chains in the Genus database with same CATH homology
 2RSD A;  4YAB A;  1WFK A;  4AUQ B;  5J3X A;  5H1T A;  2FUU A;  5JG6 A;  4UP5 A;  2L75 A;  2VNF A;  3PUQ A;  2JMJ A;  3N9Q A;  3L11 A;  2ECT A;  4YBS A;  2M1R A;  2VJE A;  1JM7 B;  2DX8 A;  5C13 A;  3U5N A;  2K4D A;  2QJ0 A;  2KRE A;  2EGP A;  2YQL A;  4F52 B;  4IC3 A;  2LQ6 A;  4YBM A;  3MHS A;  2QIZ A;  3M99 A;  2JMI A;  2Y1N A;  2BAY A;  2LXH C;  1HYJ A;  2MA5 A;  3N9O A;  2ZET C;  3T6R A;  5D1L B;  2RI7 A;  4UP0 A;  4S3O B;  4GB0 A;  3PUR A;  1VYX A;  3SOW A;  2CKL B;  1LDJ B;  4C9Z A;  2K1J A;  5G05 B;  2F42 A;  2G45 A;  4IC2 A;  3SOU A;  5FB0 A;  2YHO A;  4O64 A;  1JM7 A;  3LRQ A;  5H9M A;  2JRJ A;  2VJE B;  5AIU A;  2YW8 A;  5TBN A;  5DKA A;  2CT2 A;  2VJF B;  2KIZ A;  2D8S A;  5LKX A;  4R2Y A;  2YSJ A;  5H1V A;  2LN0 A;  4AVX A;  4MVT A;  2ECW A;  2KWJ A;  2KE1 A;  4L7X A;  3O7A A;  3DQV R;  2YSM A;  4FJC A;  3PHD A;  4LLB A;  2EA6 A;  2MT5 A;  3VK6 A;  2L43 A;  3KNV A;  4YAD A;  3M63 A;  2H0D B;  3QZV A;  2MA6 A;  4GND A;  2OXQ C;  2YQM A;  5LKU A;  3C6W A;  2KGI A;  2C2V S;  3GL6 A;  5FEY A;  2M3H A;  2XEU A;  1LDK C;  1WEN A;  4YC9 A;  3U5M A;  5TAB A;  2VPD A;  1WE9 A;  2C2L A;  2FUI A;  5G04 B;  3RTR B;  3KQI A;  4BHW A;  1Z6U A;  2CKL A;  3HCT A;  4BBQ A;  2PUY A;  2MD8 C;  3N9M A;  3ZVY A;  3N9P A;  5B75 A;  2K17 A;  4R7E A;  1WEM A;  2CSZ A;  4AYC A;  2UZG A;  1WIL A;  1WEW A;  2KWN A;  5FER A;  4CA1 A;  3ZTG A;  2HDP A;  4L58 A;  2KR4 A;  1IYM A;  3C5K A;  4FK5 A;  4GNG A;  3I2D A;  4TKP B;  2H0D A;  1JOC A;  2K16 A;  4WZ2 A;  4X3G A;  1MM2 A;  1ZBD B;  2LRI C;  1Z2Q A;  4A0C D;  2YRE A;  4A4B A;  4YAT A;  2YYR A;  4N3W A;  1HYI A;  1WEP A;  5B76 A;  2MNZ A;  1V87 A;  2VPB A;  3L1Z B;  4MSX A;  1DVP A;  5D1K B;  5B79 A;  2F6N A;  2LDR A;  4UI9 B;  3L1X A;  2MD7 B;  3NG2 A;  5B78 A;  2L80 A;  1WEU A;  5TDW A;  2Y1M A;  1MM3 A;  2LV9 A;  4WZ0 A;  3U5P A;  4FIP A;  3SOX A;  4WA6 A;  2KWK A;  3ZPV E;  3MHH A;  4V3L C;  2FSA A;  3LQI A;  2MUM A;  3EB5 A;  3O70 A;  3N9L A;  2VPE A;  3HTK C;  4I7B A;  2HYE D;  3O33 A;  3N9N A;  4LJN A;  2VP7 A;  2JMD A;  4WZ3 B;  5G0F A;  2G43 A;  2VJF A;  3ASL A;  2EOD A;  1X4I A;  2AN6 A;  2YT5 A;  1U6G B;  1WEO A;  3O35 A;  4A49 A;  2KGG A;  2ECJ A;  5FB1 A;  2KWO A;  3HCS A;  2YUR A;  5KH7 A;  2XB1 A;  1CHC A;  4YAX A;  5EYA F;  1VD4 A;  2L5U A;  5AIT A;  3DPL R;  1X4J A;  1WEE A;  4W4U A;  3HCU A;  4A4C A;  3SHB A;  3M62 A;  1VFY A;  4XI1 A;  5B77 A;  2G6Q A;  1N87 A;  2MNY A;  3KV5 A;  4I7C A;  4I7D A;  1E4U A;  2KYU A;  3ZVZ B;  4QF3 A;  4B86 C;  5C11 A;  3LQJ A;  4QF2 A;  5I3L A;  1F62 A;  4PPE A;  2IDA A;  4N4F A;  5KH3 A;  2I50 A;  2M6M A;  4LKA A;  1FP0 A;  2LXP C;  3KV6 A;  4V3K C;  2QIC A;  4P5O B;  2F6J A;  2Y43 A;  4FO9 A;  3O34 A;  2YHN A;  1WGM A;  2E6R A;  3FL2 A;  3ZPV 1;  3ZNI A;  2LGL A;  2KU3 A;  5DIN A;  2E6S A;  1XWH A;  3GV4 A;  1T1H A;  4NN2 A;  2YUC A;  5D1M B;  4GNF A;  4LK9 A;  5LCW B;  2ECV A;  2LGV A;  2MIQ A;  4B7Y C;  3O36 A;  1WEQ A;  5TRB A;  4LAD B;  2VPG A;  1X4U A;  3V43 A;  4ZUX U;  5TDR A;  2CSY A;  2KFT A;  2ECI A;  4R8P K;  2LGG A;  5H1U A;  3EB6 A;  3RPG C;  2ECG A;  1G25 A;  4GNE A;  5LKZ A;  1Z60 A;  1RMD A;  2LGK A;  5LKT A;  3T7L A;  3LQH A;  4Q6F A;  3ZYQ A;  2L0B A;  4AP4 A;  5B8D A;  4YBT A;  2M85 A;  3IHP A;  2NAA A;  3O37 A;  4PTB A;  1WES A;  4AYC B;  1FBV A;  4ZDT A;  4CCG X;  5KH9 A;  1WEV A;  1WIM A;  2PNX A;  4ZQL A;  2ECN A;  2YU4 A;  1BOR A;  3RPG B;  4S3O C;  3U5O A;  1K2F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...