3C5KA

Crystal structure of human hdac6 zinc finger domain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
108
structure length
108
Chain Sequence
SPLPWCPHLVAVCPIPAAGLDVTQPCGDCGTIQENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYVHHQALLDVKNIAHQNKFGEDMPHPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Histone deacetylase 6
publication title Crystal Structure of Human HDAC6 zinc finger domain.
rcsb
source organism Homo sapiens
total genus 29
structure length 108
sequence length 108
ec nomenclature ec 3.5.1.98: Histone deacetylase.
pdb deposition date 2008-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3c5kA00
2HDPA 2QICA 2KWKA 2ECNA 3SOUA 2K17A 5TBNA 2MA5A 1Z6UA 4O64A 4AP4A 3MHSA 4B86C 3DQVR 5JG6A 2LRIC 2BAYA 3ZTGA 5B76A 1WEPA 3SOXA 2F6JA 5LKXA 2ECWA 3I2DA 5B79A 1WEQA 2LXHC 3PURA 3KV6A 1JM7A 4ZUXU 2YSJA 5B77A 3DPLR 4FO9A 4PPEA 3FL2A 3SHBA 2KGGA 3ASLA 4A49A 3ZYQA 2LN0A 5C11A 2L0BA 3V43A 2L80A 2EODA 2C2LA 4CCGX 1JM7B 2RSDA 5LKUA 4CA1A 1N87A 1WEMA 5AIUA 2ECJA 3L1ZB 4WZ3B 2VPDA 2CKLA 1JOCA 1WEVA 5G04B 2ECVA 2XEUA 3L1XA 4FJCA 4QF2A 1HYJA 4PTBA 2M85A 2YYRA 2QIZA 2KWOA 1G25A 2D8SA 3PHDA 2LGGA 3VK6A 2KR4A 2YURA 2K16A 4R2YA 4YC9A 4LK9A 2L75A 3ZVZB 5LKZA 4P5OB 4ZDTA 2YSMA 3O34A 4TKPB 4C9ZA 2VJFA 4YBTA 4V3LC 1FP0A 2VP7A 4BHWA 2M6MA 2MD8C 1FBVA 1WGMA 3KQIA 5FB0A 1WILA 2I50A 3O36A 3RTRB 1CHCA 4QF3A 2M1RA 2F42A 3GL6A 3LQHA 2KE1A 4XI1A 1X4IA 2YUCA 2NAAA 4R8PK 2LGLA 2EA6A 3L11A 3N9MA 2H0DA 2Y43A 2G43A 4B7YC 5H1TA 2ECTA 2KWJA 1X4UA 3PUQA 2CT2A 3LRQA 2HYED 3M99A 1DVPA 2K4DA 2H0DB 1V87A 5B75A 3EB5A 4R7EA 4FIPA 1WFKA 4BBQA 2LDRA 5H1UA 4LADB 3GV4A 3M62A 2KGIA 4N4FA 4YATA 4ZQLA 3SOWA 3M63A 2C2VS 2MIQA 5G05B 2KWNA 5D1MB 1BORA 2EGPA 5TRBA 3ZPVE 2AN6A 2G6QA 3U5OA 2JMIA 2L43A 2CSZA 3U5PA 2UZGA 4N3WA 1RMDA 2JRJA 1WEEA 2YQLA 3QZVA 1E4UA 5LCWB 5EYAF 5G0FA 2LQ6A 4A4CA 2YU4A 3N9PA 3O35A 4S3OB 3HTKC 5D1KB 1WESA 4S3OC 2LGVA 2VPEA 2PUYA 3N9QA 4NN2A 1X4JA 2KU3A 3O70A 4AYCA 2ECGA 2YT5A 5KH3A 5KH7A 2JMDA 4YABA 2XB1A 1WE9A 3KV5A 2VPBA 4YAXA 4WZ0A 2MA6A 2FUUA 2MD7B 4AYCB 3NG2A 4Q6FA 3U5NA 3HCSA 2FSAA 1MM2A 1VFYA 1VD4A 2JMJA 3HCTA 3LQIA 3U5MA 5D1LB 1XWHA 2MNYA 5FB1A 2VJEA 2YW8A 4AVXA 5H9MA 5AITA 2MUMA 5KH9A 4I7CA 4GNEA 1K2FA 5TDWA 1VYXA 2Y1MA 2VJEB 4LJNA 4IC2A 4WA6A 2E6SA 2ECIA 5I3LA 1U6GB 5TABA 3ZVYA 3O37A 1LDKC 4UP0A 4I7BA 4YBSA 2KREA 1WIMA 2LXPC 3N9LA 1IYMA 3KNVA 3O33A 3EB6A 3C6WA 3O7AA 4GB0A 3ZPV1 2M3HA 4GNFA 1WEOA 5B78A 2YHNA 2PNXA 2G45A 3ZNIA 2MNZA 3RPGB 1F62A 1LDJB 5C13A 2RI7A 2FUIA 3RPGC 5LKTA 2ZETC 4A4BA 3C5KA 4IC3A 4W4UA 4LLBA 4UP5A 4V3KC 4L7XA 4X3GA 2YREA 2OXQC 2LV9A 2E6RA 1HYIA 2MT5A 2CSYA 4GNGA 4MSXA 5B8DA 2VPGA 2Y1NA 4A0CD 5FEYA 2DX8A 1WENA 5TDRA 4MVTA 4GNDA 4AUQB 2CKLB 1WEUA 4UI9B 1MM3A 2YHOA 4WZ2A 5H1VA 3T7LA 3HCUA 5J3XA 3IHPA 1T1HA 2KIZA 3T6RA 4F52B 4I7DA 2KYUA 1Z2QA 3MHHA 4LKAA 5DINA 4YADA 2K1JA 5FERA 1ZBDB 5DKAA 3LQJA 4FK5A 2IDAA 2KFTA 2YQMA 2L5UA 3N9OA 3N9NA 1Z60A 2F6NA 2VJFB 4L58A 2VNFA 2LGKA 4YBMA 2QJ0A 1WEWA
chains in the Genus database with same CATH superfamily
2HDPA 4O62A 2QICA 2KWKA 2ECNA 2D8UA 3SOUA 2K17A 5TBNA 2MA5A 5SVXA 1Z6UA 4O64A 4AP4A 3MHSA 4B86C 3DQVR 5JG6A 2B0OE 2LRIC 2BAYA 3ZTGA 5B76A 1WEPA 2YVRA 3SOXA 2F6JA 5LKXA 2ECWA 3I2DA 5B79A 1WEQA 2LXHC 3PURA 3KV6A 1JM7A 4ZUXU 2YSJA 5B77A 3DPLR 4FO9A 4PPEA 3FL2A 3SHBA 2KGGA 3ASLA 4A49A 3ZYQA 2LN0A 5C11A 2FD4A 2L0BA 3V43A 3M7KA 2L80A 2EODA 2C2LA 4CCGX 1JM7B 2RSDA 2JUNA 5LKUA 4QQ4A 2P57A 4CA1A 1N87A 1WEMA 5AIUA 2ECJA 3L1ZB 2KKYA 4WZ3B 2VPDA 2CKLA 3FANA 2CSVA 1JOCA 1WEVA 5G04B 2ECVA 2XEUA 3L1XA 4FJCA 4QF2A 1HYJA 4PTBA 2M85A 2YYRA 2QIZA 2KWOA 1G25A 2D8SA 3PHDA 2LAUA 2LGGA 3VK6A 2KR4A 2YURA 2K16A 4R2YA 4YC9A 4LK9A 2L75A 3ZVZB 5LKZA 4P5OB 4ZDTA 2YSMA 3O34A 4TKPB 4C9ZA 2CONA 2VJFA 4YBTA 4V3LC 1FP0A 2VP7A 4BHWA 2M6MA 2MD8C 3H7HA 1FBVA 4F1PA 1WGMA 3KQIA 5FB0A 1WILA 2I50A 3O36A 3RTRB 1CHCA 4QF3A 2M1RA 2F42A 3GL6A 3DWDA 3LQHA 2KE1A 2XP0A 4XI1A 1X4IA 2YUCA 2NAAA 4R8PK 2LGLA 2EA6A 3L11A 2L7PA 3N9MA 1MBMA 2H0DA 2Y43A 2G43A 2FFWA 4B7YC 5H1TA 2ECTA 4OGEA 2KWJA 1X4UA 3PUQA 2CT2A 3LRQA 2HYED 3FEHA 3M99A 1DVPA 2K4DA 2H0DB 1V87A 5B75A 3EB5A 2XOZA 4R7EA 4FIPA 1WFKA 4BBQA 2LDRA 5H1UA 4LADB 2EXUA 3GV4A 3M62A 4Z0RA 2KGIA 4N4FA 4YATA 3LJUX 4ZQLA 3SOWA 3M63A 2C2VS 2MIQA 5G05B 2KWNA 5D1MB 1BORA 2EGPA 5TRBA 3ZPVE 2AN6A 2G6QA 3U5OA 2JMIA 2L43A 2CSZA 3U5PA 2UZGA 4N3WA 1RMDA 3PLWA 2JRJA 1WEEA 5K3QA 2YQLA 3QZVA 1E4UA 5LCWB 4Z0OA 3T9KA 5EYAF 5G0FA 2LQ6A 4A4CA 2YU4A 3N9PA 3O35A 4S3OB 3HTKC 5D1KB 1WESA 5SVIB 4S3OC 2LGVA 2VPEA 2PUYA 3N9QA 4NN2A 1X4JA 2KU3A 3O70A 4AYCA 2ECGA 2EGMA 2YT5A 3LVQE 5KH3A 5KH7A 2JMDA 2JM3A 4YABA 2XB1A 1WE9A 3KV5A 2VPBA 4YAXA 4WZ0A 2MA6A 2FUUA 2MD7B 4AYCB 3NG2A 3O47A 4Q6FA 3U5NA 3HCSA 2FSAA 1MM2A 1VFYA 1VD4A 2CRWA 2JMJA 3HCTA 3JUEA 3LQIA 3U5MA 5D1LB 1XWHA 2MNYA 5FB1A 2VJEA 2YW8A 4AVXA 5H9MA 3DDTA 5AITA 2MUMA 5KH9A 2M13A 2IQJA 4I7CA 4GNEA 1K2FA 5TDWA 1VYXA 2Y1MA 2VJEB 4LJNA 2DSMA 4IC2A 4WA6A 2E6SA 2ECIA 5I3LA 1U6GB 5TABA 3ZVYA 3O37A 1LDKC 4UP0A 4I7BA 5SVYA 3Q1DA 4YBSA 2OWAA 2KREA 1WIMA 2LXPC 3N9LA 3FJUB 1IYMA 3KNVA 4H9DA 3O33A 3KDEC 2CRRA 2MKEA 3EB6A 3C6WA 3O7AA 4GB0A 3ZPV1 2M3HA 4GNFA 1WEOA 2XOYA 4OGCA 5B78A 3MDBC 2YHNA 5SVIA 2PNXA 2G45A 3ZNIA 2MNZA 2RR4A 3RPGB 1F62A 1LDJB 1DCQA 5C13A 2RI7A 2FUIA 3RPGC 5LKTA 3SUBA 2ZETC 2KKXA 4A4BA 3C5KA 4IC3A 4W4UA 4LLBA 4UP5A 4V3KC 4L7XA 4X3GA 2YREA 2OXQC 2LV9A 2E6RA 1HYIA 2MT5A 2CSYA 4GNGA 4MSXA 5B8DA 2VPGA 2Y1NA 4A0CD 5FEYA 2DX8A 1WENA 5TDRA 4MVTA 4GNDA 4AUQB 3FAOA 3LDYA 2CKLB 1WEUA 4UI9B 1MM3A 2YHOA 4WZ2A 5H1VA 3T7LA 3HCUA 5J3XA 3IHPA 1T1HA 2KIZA 3T6RA 4F52B 3LVRE 2XOCA 4I7DA 2E61A 2DJAA 2KYUA 1Z2QA 3MHHA 4LKAA 5DINA 4YADA 3E2DA 2K1JA 5FERA 1ZBDB 5DKAA 3LQJA 4FK5A 2IDAA 2KFTA 2YQMA 2L5UA 3N9OA 3N9NA 1Z60A 3FM8C 2F6NA 2VJFB 4L58A 2VNFA 2LGKA 4YBMA 2QJ0A 1WEWA
chains in the Genus database with same CATH topology
2HDPA 2QICA 2KWKA 2ECNA 3SOUA 2K17A 5TBNA 2MA5A 1Z6UA 4O64A 4AP4A 3MHSA 4B86C 3DQVR 5JG6A 2LRIC 2BAYA 3ZTGA 5B76A 1WEPA 3SOXA 2F6JA 5LKXA 2ECWA 3I2DA 5B79A 1WEQA 2LXHC 3PURA 3KV6A 1JM7A 4ZUXU 2YSJA 5B77A 3DPLR 4FO9A 4PPEA 3FL2A 3SHBA 2KGGA 3ASLA 4A49A 3ZYQA 2LN0A 5C11A 2L0BA 3V43A 2L80A 2EODA 2C2LA 4CCGX 1JM7B 2RSDA 5LKUA 4CA1A 1N87A 1WEMA 5AIUA 2ECJA 3L1ZB 4WZ3B 2VPDA 2CKLA 1JOCA 1WEVA 5G04B 2ECVA 2XEUA 3L1XA 4FJCA 4QF2A 1HYJA 4PTBA 2M85A 2YYRA 2QIZA 2KWOA 1G25A 2D8SA 3PHDA 2LGGA 3VK6A 2KR4A 2YURA 2K16A 4R2YA 4YC9A 4LK9A 2L75A 3ZVZB 5LKZA 4P5OB 4ZDTA 2YSMA 3O34A 4TKPB 4C9ZA 2VJFA 4YBTA 4V3LC 1FP0A 2VP7A 4BHWA 2M6MA 2MD8C 1FBVA 1WGMA 3KQIA 5FB0A 1WILA 2I50A 3O36A 3RTRB 1CHCA 4QF3A 2M1RA 2F42A 3GL6A 3LQHA 2KE1A 4XI1A 1X4IA 2YUCA 2NAAA 4R8PK 2LGLA 2EA6A 3L11A 3N9MA 2H0DA 2Y43A 2G43A 4B7YC 5H1TA 2ECTA 2KWJA 1X4UA 3PUQA 2CT2A 3LRQA 2HYED 3M99A 1DVPA 2K4DA 2H0DB 1V87A 5B75A 3EB5A 4R7EA 4FIPA 1WFKA 4BBQA 2LDRA 5H1UA 4LADB 3GV4A 3M62A 2KGIA 4N4FA 4YATA 4ZQLA 3SOWA 3M63A 2C2VS 2MIQA 5G05B 2KWNA 5D1MB 1BORA 2EGPA 5TRBA 3ZPVE 2AN6A 2G6QA 3U5OA 2JMIA 2L43A 2CSZA 3U5PA 2UZGA 4N3WA 1RMDA 2JRJA 1WEEA 2YQLA 3QZVA 1E4UA 5LCWB 5EYAF 5G0FA 2LQ6A 4A4CA 2YU4A 3N9PA 3O35A 4S3OB 3HTKC 5D1KB 1WESA 4S3OC 2LGVA 2VPEA 2PUYA 3N9QA 4NN2A 1X4JA 2KU3A 3O70A 4AYCA 2ECGA 2YT5A 5KH3A 5KH7A 2JMDA 4YABA 2XB1A 1WE9A 3KV5A 2VPBA 4YAXA 4WZ0A 2MA6A 2FUUA 2MD7B 4AYCB 3NG2A 4Q6FA 3U5NA 3HCSA 2FSAA 1MM2A 1VFYA 1VD4A 2JMJA 3HCTA 3LQIA 3U5MA 5D1LB 1XWHA 2MNYA 5FB1A 2VJEA 2YW8A 4AVXA 5H9MA 5AITA 2MUMA 5KH9A 4I7CA 4GNEA 1K2FA 5TDWA 1VYXA 2Y1MA 2VJEB 4LJNA 4IC2A 4WA6A 2E6SA 2ECIA 5I3LA 1U6GB 5TABA 3ZVYA 3O37A 1LDKC 4UP0A 4I7BA 4YBSA 2KREA 1WIMA 2LXPC 3N9LA 1IYMA 3KNVA 3O33A 3EB6A 3C6WA 3O7AA 4GB0A 3ZPV1 2M3HA 4GNFA 1WEOA 5B78A 2YHNA 2PNXA 2G45A 3ZNIA 2MNZA 3RPGB 1F62A 1LDJB 5C13A 2RI7A 2FUIA 3RPGC 5LKTA 2ZETC 4A4BA 3C5KA 4IC3A 4W4UA 4LLBA 4UP5A 4V3KC 4L7XA 4X3GA 2YREA 2OXQC 2LV9A 2E6RA 1HYIA 2MT5A 2CSYA 4GNGA 4MSXA 5B8DA 2VPGA 2Y1NA 4A0CD 5FEYA 2DX8A 1WENA 5TDRA 4MVTA 4GNDA 4AUQB 2CKLB 1WEUA 4UI9B 1MM3A 2YHOA 4WZ2A 5H1VA 3T7LA 3HCUA 5J3XA 3IHPA 1T1HA 2KIZA 3T6RA 4F52B 4I7DA 2KYUA 1Z2QA 3MHHA 4LKAA 5DINA 4YADA 2K1JA 5FERA 1ZBDB 5DKAA 3LQJA 4FK5A 2IDAA 2KFTA 2YQMA 2L5UA 3N9OA 3N9NA 1Z60A 2F6NA 2VJFB 4L58A 2VNFA 2LGKA 4YBMA 2QJ0A 1WEWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HDP A;  2QIC A;  2KWK A;  2ECN A;  3SOU A;  2K17 A;  5TBN A;  2MA5 A;  1Z6U A;  4O64 A;  4AP4 A;  3MHS A;  4B86 C;  3DQV R;  5JG6 A;  2LRI C;  2BAY A;  3ZTG A;  5B76 A;  1WEP A;  3SOX A;  2F6J A;  5LKX A;  2ECW A;  3I2D A;  5B79 A;  1WEQ A;  2LXH C;  3PUR A;  3KV6 A;  1JM7 A;  4ZUX U;  2YSJ A;  5B77 A;  3DPL R;  4FO9 A;  4PPE A;  3FL2 A;  3SHB A;  2KGG A;  3ASL A;  4A49 A;  3ZYQ A;  2LN0 A;  5C11 A;  2L0B A;  3V43 A;  2L80 A;  2EOD A;  2C2L A;  4CCG X;  1JM7 B;  2RSD A;  5LKU A;  4CA1 A;  1N87 A;  1WEM A;  5AIU A;  2ECJ A;  3L1Z B;  4WZ3 B;  2VPD A;  2CKL A;  1JOC A;  1WEV A;  5G04 B;  2ECV A;  2XEU A;  3L1X A;  4FJC A;  4QF2 A;  1HYJ A;  4PTB A;  2M85 A;  2YYR A;  2QIZ A;  2KWO A;  1G25 A;  2D8S A;  3PHD A;  2LGG A;  3VK6 A;  2KR4 A;  2YUR A;  2K16 A;  4R2Y A;  4YC9 A;  4LK9 A;  2L75 A;  3ZVZ B;  5LKZ A;  4P5O B;  4ZDT A;  2YSM A;  3O34 A;  4TKP B;  4C9Z A;  2VJF A;  4YBT A;  4V3L C;  1FP0 A;  2VP7 A;  4BHW A;  2M6M A;  2MD8 C;  1FBV A;  1WGM A;  3KQI A;  5FB0 A;  1WIL A;  2I50 A;  3O36 A;  3RTR B;  1CHC A;  4QF3 A;  2M1R A;  2F42 A;  3GL6 A;  3LQH A;  2KE1 A;  4XI1 A;  1X4I A;  2YUC A;  2NAA A;  4R8P K;  2LGL A;  2EA6 A;  3L11 A;  3N9M A;  2H0D A;  2Y43 A;  2G43 A;  4B7Y C;  5H1T A;  2ECT A;  2KWJ A;  1X4U A;  3PUQ A;  2CT2 A;  3LRQ A;  2HYE D;  3M99 A;  1DVP A;  2K4D A;  2H0D B;  1V87 A;  5B75 A;  3EB5 A;  4R7E A;  4FIP A;  1WFK A;  4BBQ A;  2LDR A;  5H1U A;  4LAD B;  3GV4 A;  3M62 A;  2KGI A;  4N4F A;  4YAT A;  4ZQL A;  3SOW A;  3M63 A;  2C2V S;  2MIQ A;  5G05 B;  2KWN A;  5D1M B;  1BOR A;  2EGP A;  5TRB A;  3ZPV E;  2AN6 A;  2G6Q A;  3U5O A;  2JMI A;  2L43 A;  2CSZ A;  3U5P A;  2UZG A;  4N3W A;  1RMD A;  2JRJ A;  1WEE A;  2YQL A;  3QZV A;  1E4U A;  5LCW B;  5EYA F;  5G0F A;  2LQ6 A;  4A4C A;  2YU4 A;  3N9P A;  3O35 A;  4S3O B;  3HTK C;  5D1K B;  1WES A;  4S3O C;  2LGV A;  2VPE A;  2PUY A;  3N9Q A;  4NN2 A;  1X4J A;  2KU3 A;  3O70 A;  4AYC A;  2ECG A;  2YT5 A;  5KH3 A;  5KH7 A;  2JMD A;  4YAB A;  2XB1 A;  1WE9 A;  3KV5 A;  2VPB A;  4YAX A;  4WZ0 A;  2MA6 A;  2FUU A;  2MD7 B;  4AYC B;  3NG2 A;  4Q6F A;  3U5N A;  3HCS A;  2FSA A;  1MM2 A;  1VFY A;  1VD4 A;  2JMJ A;  3HCT A;  3LQI A;  3U5M A;  5D1L B;  1XWH A;  2MNY A;  5FB1 A;  2VJE A;  2YW8 A;  4AVX A;  5H9M A;  5AIT A;  2MUM A;  5KH9 A;  4I7C A;  4GNE A;  1K2F A;  5TDW A;  1VYX A;  2Y1M A;  2VJE B;  4LJN A;  4IC2 A;  4WA6 A;  2E6S A;  2ECI A;  5I3L A;  1U6G B;  5TAB A;  3ZVY A;  3O37 A;  1LDK C;  4UP0 A;  4I7B A;  4YBS A;  2KRE A;  1WIM A;  2LXP C;  3N9L A;  1IYM A;  3KNV A;  3O33 A;  3EB6 A;  3C6W A;  3O7A A;  4GB0 A;  3ZPV 1;  2M3H A;  4GNF A;  1WEO A;  5B78 A;  2YHN A;  2PNX A;  2G45 A;  3ZNI A;  2MNZ A;  3RPG B;  1F62 A;  1LDJ B;  5C13 A;  2RI7 A;  2FUI A;  3RPG C;  5LKT A;  2ZET C;  4A4B A;  3C5K A;  4IC3 A;  4W4U A;  4LLB A;  4UP5 A;  4V3K C;  4L7X A;  4X3G A;  2YRE A;  2OXQ C;  2LV9 A;  2E6R A;  1HYI A;  2MT5 A;  2CSY A;  4GNG A;  4MSX A;  5B8D A;  2VPG A;  2Y1N A;  4A0C D;  5FEY A;  2DX8 A;  1WEN A;  5TDR A;  4MVT A;  4GND A;  4AUQ B;  2CKL B;  1WEU A;  4UI9 B;  1MM3 A;  2YHO A;  4WZ2 A;  5H1V A;  3T7L A;  3HCU A;  5J3X A;  3IHP A;  1T1H A;  2KIZ A;  3T6R A;  4F52 B;  4I7D A;  2KYU A;  1Z2Q A;  3MHH A;  4LKA A;  5DIN A;  4YAD A;  2K1J A;  5FER A;  1ZBD B;  5DKA A;  3LQJ A;  4FK5 A;  2IDA A;  2KFT A;  2YQM A;  2L5U A;  3N9O A;  3N9N A;  1Z60 A;  2F6N A;  2VJF B;  4L58 A;  2VNF A;  2LGK A;  4YBM A;  2QJ0 A;  1WEW A; 
#chains in the Genus database with same CATH topology
 2HDP A;  4O62 A;  2QIC A;  2KWK A;  2ECN A;  2D8U A;  3SOU A;  2K17 A;  5TBN A;  2MA5 A;  5SVX A;  1Z6U A;  4O64 A;  4AP4 A;  3MHS A;  4B86 C;  3DQV R;  5JG6 A;  2B0O E;  2LRI C;  2BAY A;  3ZTG A;  5B76 A;  1WEP A;  2YVR A;  3SOX A;  2F6J A;  5LKX A;  2ECW A;  3I2D A;  5B79 A;  1WEQ A;  2LXH C;  3PUR A;  3KV6 A;  1JM7 A;  4ZUX U;  2YSJ A;  5B77 A;  3DPL R;  4FO9 A;  4PPE A;  3FL2 A;  3SHB A;  2KGG A;  3ASL A;  4A49 A;  3ZYQ A;  2LN0 A;  5C11 A;  2FD4 A;  2L0B A;  3V43 A;  3M7K A;  2L80 A;  2EOD A;  2C2L A;  4CCG X;  1JM7 B;  2RSD A;  2JUN A;  5LKU A;  4QQ4 A;  2P57 A;  4CA1 A;  1N87 A;  1WEM A;  5AIU A;  2ECJ A;  3L1Z B;  2KKY A;  4WZ3 B;  2VPD A;  2CKL A;  3FAN A;  2CSV A;  1JOC A;  1WEV A;  5G04 B;  2ECV A;  2XEU A;  3L1X A;  4FJC A;  4QF2 A;  1HYJ A;  4PTB A;  2M85 A;  2YYR A;  2QIZ A;  2KWO A;  1G25 A;  2D8S A;  3PHD A;  2LAU A;  2LGG A;  3VK6 A;  2KR4 A;  2YUR A;  2K16 A;  4R2Y A;  4YC9 A;  4LK9 A;  2L75 A;  3ZVZ B;  5LKZ A;  4P5O B;  4ZDT A;  2YSM A;  3O34 A;  4TKP B;  4C9Z A;  2CON A;  2VJF A;  4YBT A;  4V3L C;  1FP0 A;  2VP7 A;  4BHW A;  2M6M A;  2MD8 C;  3H7H A;  1FBV A;  4F1P A;  1WGM A;  3KQI A;  5FB0 A;  1WIL A;  2I50 A;  3O36 A;  3RTR B;  1CHC A;  4QF3 A;  2M1R A;  2F42 A;  3GL6 A;  3DWD A;  3LQH A;  2KE1 A;  2XP0 A;  4XI1 A;  1X4I A;  2YUC A;  2NAA A;  4R8P K;  2LGL A;  2EA6 A;  3L11 A;  2L7P A;  3N9M A;  1MBM A;  2H0D A;  2Y43 A;  2G43 A;  2FFW A;  4B7Y C;  5H1T A;  2ECT A;  4OGE A;  2KWJ A;  1X4U A;  3PUQ A;  2CT2 A;  3LRQ A;  2HYE D;  3FEH A;  3M99 A;  1DVP A;  2K4D A;  2H0D B;  1V87 A;  5B75 A;  3EB5 A;  2XOZ A;  4R7E A;  4FIP A;  1WFK A;  4BBQ A;  2LDR A;  5H1U A;  4LAD B;  2EXU A;  3GV4 A;  3M62 A;  4Z0R A;  2KGI A;  4N4F A;  4YAT A;  3LJU X;  4ZQL A;  3SOW A;  3M63 A;  2C2V S;  2MIQ A;  5G05 B;  2KWN A;  5D1M B;  1BOR A;  2EGP A;  5TRB A;  3ZPV E;  2AN6 A;  2G6Q A;  3U5O A;  2JMI A;  2L43 A;  2CSZ A;  3U5P A;  2UZG A;  4N3W A;  1RMD A;  3PLW A;  2JRJ A;  1WEE A;  5K3Q A;  2YQL A;  3QZV A;  1E4U A;  5LCW B;  4Z0O A;  3T9K A;  5EYA F;  5G0F A;  2LQ6 A;  4A4C A;  2YU4 A;  3N9P A;  3O35 A;  4S3O B;  3HTK C;  5D1K B;  1WES A;  5SVI B;  4S3O C;  2LGV A;  2VPE A;  2PUY A;  3N9Q A;  4NN2 A;  1X4J A;  2KU3 A;  3O70 A;  4AYC A;  2ECG A;  2EGM A;  2YT5 A;  3LVQ E;  5KH3 A;  5KH7 A;  2JMD A;  2JM3 A;  4YAB A;  2XB1 A;  1WE9 A;  3KV5 A;  2VPB A;  4YAX A;  4WZ0 A;  2MA6 A;  2FUU A;  2MD7 B;  4AYC B;  3NG2 A;  3O47 A;  4Q6F A;  3U5N A;  3HCS A;  2FSA A;  1MM2 A;  1VFY A;  1VD4 A;  2CRW A;  2JMJ A;  3HCT A;  3JUE A;  3LQI A;  3U5M A;  5D1L B;  1XWH A;  2MNY A;  5FB1 A;  2VJE A;  2YW8 A;  4AVX A;  5H9M A;  3DDT A;  5AIT A;  2MUM A;  5KH9 A;  2M13 A;  2IQJ A;  4I7C A;  4GNE A;  1K2F A;  5TDW A;  1VYX A;  2Y1M A;  2VJE B;  4LJN A;  2DSM A;  4IC2 A;  4WA6 A;  2E6S A;  2ECI A;  5I3L A;  1U6G B;  5TAB A;  3ZVY A;  3O37 A;  1LDK C;  4UP0 A;  4I7B A;  5SVY A;  3Q1D A;  4YBS A;  2OWA A;  2KRE A;  1WIM A;  2LXP C;  3N9L A;  3FJU B;  1IYM A;  3KNV A;  4H9D A;  3O33 A;  3KDE C;  2CRR A;  2MKE A;  3EB6 A;  3C6W A;  3O7A A;  4GB0 A;  3ZPV 1;  2M3H A;  4GNF A;  1WEO A;  2XOY A;  4OGC A;  5B78 A;  3MDB C;  2YHN A;  5SVI A;  2PNX A;  2G45 A;  3ZNI A;  2MNZ A;  2RR4 A;  3RPG B;  1F62 A;  1LDJ B;  1DCQ A;  5C13 A;  2RI7 A;  2FUI A;  3RPG C;  5LKT A;  3SUB A;  2ZET C;  2KKX A;  4A4B A;  3C5K A;  4IC3 A;  4W4U A;  4LLB A;  4UP5 A;  4V3K C;  4L7X A;  4X3G A;  2YRE A;  2OXQ C;  2LV9 A;  2E6R A;  1HYI A;  2MT5 A;  2CSY A;  4GNG A;  4MSX A;  5B8D A;  2VPG A;  2Y1N A;  4A0C D;  5FEY A;  2DX8 A;  1WEN A;  5TDR A;  4MVT A;  4GND A;  4AUQ B;  3FAO A;  3LDY A;  2CKL B;  1WEU A;  4UI9 B;  1MM3 A;  2YHO A;  4WZ2 A;  5H1V A;  3T7L A;  3HCU A;  5J3X A;  3IHP A;  1T1H A;  2KIZ A;  3T6R A;  4F52 B;  3LVR E;  2XOC A;  4I7D A;  2E61 A;  2DJA A;  2KYU A;  1Z2Q A;  3MHH A;  4LKA A;  5DIN A;  4YAD A;  3E2D A;  2K1J A;  5FER A;  1ZBD B;  5DKA A;  3LQJ A;  4FK5 A;  2IDA A;  2KFT A;  2YQM A;  2L5U A;  3N9O A;  3N9N A;  1Z60 A;  3FM8 C;  2F6N A;  2VJF B;  4L58 A;  2VNF A;  2LGK A;  4YBM A;  2QJ0 A;  1WEW A; 
#chains in the Genus database with same CATH homology
 2HDP A;  2QIC A;  2KWK A;  2ECN A;  3SOU A;  2K17 A;  5TBN A;  2MA5 A;  1Z6U A;  4O64 A;  4AP4 A;  3MHS A;  4B86 C;  3DQV R;  5JG6 A;  2LRI C;  2BAY A;  3ZTG A;  5B76 A;  1WEP A;  3SOX A;  2F6J A;  5LKX A;  2ECW A;  3I2D A;  5B79 A;  1WEQ A;  2LXH C;  3PUR A;  3KV6 A;  1JM7 A;  4ZUX U;  2YSJ A;  5B77 A;  3DPL R;  4FO9 A;  4PPE A;  3FL2 A;  3SHB A;  2KGG A;  3ASL A;  4A49 A;  3ZYQ A;  2LN0 A;  5C11 A;  2L0B A;  3V43 A;  2L80 A;  2EOD A;  2C2L A;  4CCG X;  1JM7 B;  2RSD A;  5LKU A;  4CA1 A;  1N87 A;  1WEM A;  5AIU A;  2ECJ A;  3L1Z B;  4WZ3 B;  2VPD A;  2CKL A;  1JOC A;  1WEV A;  5G04 B;  2ECV A;  2XEU A;  3L1X A;  4FJC A;  4QF2 A;  1HYJ A;  4PTB A;  2M85 A;  2YYR A;  2QIZ A;  2KWO A;  1G25 A;  2D8S A;  3PHD A;  2LGG A;  3VK6 A;  2KR4 A;  2YUR A;  2K16 A;  4R2Y A;  4YC9 A;  4LK9 A;  2L75 A;  3ZVZ B;  5LKZ A;  4P5O B;  4ZDT A;  2YSM A;  3O34 A;  4TKP B;  4C9Z A;  2VJF A;  4YBT A;  4V3L C;  1FP0 A;  2VP7 A;  4BHW A;  2M6M A;  2MD8 C;  1FBV A;  1WGM A;  3KQI A;  5FB0 A;  1WIL A;  2I50 A;  3O36 A;  3RTR B;  1CHC A;  4QF3 A;  2M1R A;  2F42 A;  3GL6 A;  3LQH A;  2KE1 A;  4XI1 A;  1X4I A;  2YUC A;  2NAA A;  4R8P K;  2LGL A;  2EA6 A;  3L11 A;  3N9M A;  2H0D A;  2Y43 A;  2G43 A;  4B7Y C;  5H1T A;  2ECT A;  2KWJ A;  1X4U A;  3PUQ A;  2CT2 A;  3LRQ A;  2HYE D;  3M99 A;  1DVP A;  2K4D A;  2H0D B;  1V87 A;  5B75 A;  3EB5 A;  4R7E A;  4FIP A;  1WFK A;  4BBQ A;  2LDR A;  5H1U A;  4LAD B;  3GV4 A;  3M62 A;  2KGI A;  4N4F A;  4YAT A;  4ZQL A;  3SOW A;  3M63 A;  2C2V S;  2MIQ A;  5G05 B;  2KWN A;  5D1M B;  1BOR A;  2EGP A;  5TRB A;  3ZPV E;  2AN6 A;  2G6Q A;  3U5O A;  2JMI A;  2L43 A;  2CSZ A;  3U5P A;  2UZG A;  4N3W A;  1RMD A;  2JRJ A;  1WEE A;  2YQL A;  3QZV A;  1E4U A;  5LCW B;  5EYA F;  5G0F A;  2LQ6 A;  4A4C A;  2YU4 A;  3N9P A;  3O35 A;  4S3O B;  3HTK C;  5D1K B;  1WES A;  4S3O C;  2LGV A;  2VPE A;  2PUY A;  3N9Q A;  4NN2 A;  1X4J A;  2KU3 A;  3O70 A;  4AYC A;  2ECG A;  2YT5 A;  5KH3 A;  5KH7 A;  2JMD A;  4YAB A;  2XB1 A;  1WE9 A;  3KV5 A;  2VPB A;  4YAX A;  4WZ0 A;  2MA6 A;  2FUU A;  2MD7 B;  4AYC B;  3NG2 A;  4Q6F A;  3U5N A;  3HCS A;  2FSA A;  1MM2 A;  1VFY A;  1VD4 A;  2JMJ A;  3HCT A;  3LQI A;  3U5M A;  5D1L B;  1XWH A;  2MNY A;  5FB1 A;  2VJE A;  2YW8 A;  4AVX A;  5H9M A;  5AIT A;  2MUM A;  5KH9 A;  4I7C A;  4GNE A;  1K2F A;  5TDW A;  1VYX A;  2Y1M A;  2VJE B;  4LJN A;  4IC2 A;  4WA6 A;  2E6S A;  2ECI A;  5I3L A;  1U6G B;  5TAB A;  3ZVY A;  3O37 A;  1LDK C;  4UP0 A;  4I7B A;  4YBS A;  2KRE A;  1WIM A;  2LXP C;  3N9L A;  1IYM A;  3KNV A;  3O33 A;  3EB6 A;  3C6W A;  3O7A A;  4GB0 A;  3ZPV 1;  2M3H A;  4GNF A;  1WEO A;  5B78 A;  2YHN A;  2PNX A;  2G45 A;  3ZNI A;  2MNZ A;  3RPG B;  1F62 A;  1LDJ B;  5C13 A;  2RI7 A;  2FUI A;  3RPG C;  5LKT A;  2ZET C;  4A4B A;  3C5K A;  4IC3 A;  4W4U A;  4LLB A;  4UP5 A;  4V3K C;  4L7X A;  4X3G A;  2YRE A;  2OXQ C;  2LV9 A;  2E6R A;  1HYI A;  2MT5 A;  2CSY A;  4GNG A;  4MSX A;  5B8D A;  2VPG A;  2Y1N A;  4A0C D;  5FEY A;  2DX8 A;  1WEN A;  5TDR A;  4MVT A;  4GND A;  4AUQ B;  2CKL B;  1WEU A;  4UI9 B;  1MM3 A;  2YHO A;  4WZ2 A;  5H1V A;  3T7L A;  3HCU A;  5J3X A;  3IHP A;  1T1H A;  2KIZ A;  3T6R A;  4F52 B;  4I7D A;  2KYU A;  1Z2Q A;  3MHH A;  4LKA A;  5DIN A;  4YAD A;  2K1J A;  5FER A;  1ZBD B;  5DKA A;  3LQJ A;  4FK5 A;  2IDA A;  2KFT A;  2YQM A;  2L5U A;  3N9O A;  3N9N A;  1Z60 A;  2F6N A;  2VJF B;  4L58 A;  2VNF A;  2LGK A;  4YBM A;  2QJ0 A;  1WEW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...