3C5KA

Crystal structure of human hdac6 zinc finger domain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
108
structure length
108
Chain Sequence
b'SPLPWCPHLVAVCPIPAAGLDVTQPCGDCGTIQENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYVHHQALLDVKNIAHQNKFGEDMPHPH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone deacetylase 6
publication title Crystal Structure of Human HDAC6 zinc finger domain.
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 29
structure length 108
sequence length 108
ec nomenclature ec 3.5.1.98: Histone deacetylase.
pdb deposition date 2008-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3c5kA00
2VJFA 3U5PA 1FP0A 3MHHA 3M62A 2KWOA 4GB0A 5AIUA 2ECNA 2YQLA 5FEYA 4A0CD 2KWKA 2MA5A 2H0DB 2Y1MA 4MVTA 5B76A 5DKAA 1WIMA 3SOWA 1CHCA 5C13A 3N9PA 2MA6A 2ECIA 2JMDA 3KQIA 5B79A 2LGVA 2ZETC 2JRJA 2HYED 2ECWA 3C6WA 2KWNA 5I3LA 2LGLA 2RI7A 4YADA 2VPEA 3M63A 3GV4A 3N9QA 4V3KC 2KU3A 4R8PK 2L5UA 1WENA 5LKZA 1WILA 2HDPA 1WE9A 2LXHC 3QZVA 1E4UA 5H1VA 2VPGA 5D1MB 4PPEA 4YAXA 2VPBA 1U6GB 2MD7B 4WZ0A 2AN6A 2KGGA 3PURA 2XB1A 1IYMA 2VNFA 2QIZA 2D8SA 1WEEA 4GNGA 2L0BA 3LRQA 1JM7A 2KFTA 4MSXA 4I7BA 2LXPC 5TRBA 1Z2QA 3LQJA 2MD8C 2YURA 3HTKC 4WA6A 4ZQLA 5KH7A 2G45A 2F6JA 2RSDA 3I2DA 3LQIA 3T6RA 3NG2A 2LGGA 3L1XA 3RPGB 1V87A 2M6MA 2LQ6A 2PUYA 5TABA 4YBSA 1LDKC 1WEWA 3ZVZB 5H1UA 2L43A 2E6RA 4N4FA 2Y1NA 1BORA 2E6SA 3SHBA 2VJEA 4WZ2A 3L1ZB 2QICA 4FK5A 1X4IA 4I7CA 2C2LA 4BHWA 1JOCA 4FO9A 1HYIA 2G43A 5LKXA 5TBNA 4S3OC 5B75A 2F6NA 4A4BA 1Z6UA 3LQHA 1WEQA 5AITA 1XWHA 2CKLB 5G04B 2H0DA 4C9ZA 1VYXA 4W4UA 2YHNA 2PNXA 2NAAA 4YABA 5B8DA 5D1KB 3O70A 3N9OA 2CT2A 3L11A 4UP0A 3O33A 2YT5A 1VD4A 3SOUA 2ECGA 2VPDA 4NN2A 4B7YC 4QF3A 3FL2A 3ZYQA 5EYAF 3C5KA 2YSJA 3DPLR 1DVPA 3EB6A 4P5OB 2CSYA 4R7EA 5FB1A 2K16A 3MHSA 4B86C 2JMIA 1X4JA 2UZGA 2MT5A 4Q6FA 2M1RA 5C11A 3ASLA 3O37A 3U5MA 2LV9A 3ZPVE 3KV6A 4BBQA 2LGKA 1WFKA 4IC3A 3U5OA 3IHPA 4AYCB 3HCSA 4L58A 2ECTA 1WEMA 5LKTA 2EODA 3M99A 2KWJA 1WEVA 5G0FA 4N3WA 3KV5A 3ZPV1 1WEUA 2VJFB 3ZNIA 4CCGX 4GNFA 2L75A 4UI9B 3N9NA 4LADB 2FUUA 2XEUA 4LK9A 3O7AA 4PTBA 3PUQA 4GNDA 4A4CA 3N9MA 1MM3A 1WESA 2M85A 2BAYA 2YU4A 3EB5A 4A49A 2FUIA 3ZVYA 4AP4A 4F52B 5FB0A 2MIQA 3HCTA 4YBTA 1F62A 2YYRA 5J3XA 5B77A 3GL6A 4TKPB 2YW8A 4ZDTA 2MUMA 4WZ3B 2K4DA 2YREA 1ZBDB 1T1HA 4CA1A 3RTRB 1K2FA 4GNEA 1N87A 4FIPA 4S3OB 2MNYA 3SOXA 3N9LA 5FERA 5KH3A 2F42A 5D1LB 3V43A 2YHOA 2YQMA 2G6QA 1VFYA 4O64A 4LLBA 5G05B 1LDJB 4L7XA 4QF2A 2CKLA 2L80A 2IDAA 5KH9A 2KIZA 2JMJA 3KNVA 2KR4A 3ZTGA 2I50A 1JM7B 1Z60A 2YUCA 2KREA 2K1JA 5H1TA 3DQVR 2KGIA 2ECVA 5TDRA 4AUQB 4YATA 3T7LA 2M3HA 3U5NA 4YBMA 3PHDA 4YC9A 2QJ0A 4ZUXU 4XI1A 5DINA 2FSAA 3O34A 5TDWA 4AVXA 1WEPA 1G25A 2LRIC 2DX8A 2VP7A 1WEOA 3RPGC 3HCUA 3VK6A 4LJNA 2LN0A 5B78A 3O35A 4V3LC 2OXQC 5LKUA 2KE1A 1RMDA 2CSZA 4I7DA 1X4UA 4LKAA 1WGMA 2Y43A 2ECJA 4R2YA 4UP5A 5JG6A 2EA6A 1HYJA 4AYCA 5H9MA 2EGPA 3O36A 2VJEB 4FJCA 2MNZA 1MM2A 2LDRA 2KYUA 1FBVA 4X3GA 2K17A 4IC2A 2C2VS 2YSMA 5LCWB
chains in the Genus database with same CATH superfamily
2VJFA 3U5PA 1FP0A 3MHHA 5K3QA 3FEHA 3M62A 2KWOA 4GB0A 5AIUA 2ECNA 2YQLA 5FEYA 4A0CD 3T9KA 2KWKA 2MA5A 2H0DB 2Y1MA 4MVTA 5B76A 5DKAA 1WIMA 3SOWA 1CHCA 5C13A 3N9PA 2MA6A 2JUNA 2ECIA 2EGMA 2JMDA 3KQIA 5B79A 2LGVA 2ZETC 3LJUX 2JRJA 2HYED 2ECWA 4H9DA 3C6WA 2KWNA 5I3LA 4Z0OA 2XOCA 2LGLA 2RI7A 4YADA 2VPEA 3M63A 3GV4A 3N9QA 4V3KC 2KU3A 4R8PK 2L5UA 1WENA 5LKZA 1WILA 2P57A 2HDPA 3LDYA 1WE9A 2LXHC 3O47A 3QZVA 1E4UA 5H1VA 2VPGA 5D1MB 4PPEA 4YAXA 2VPBA 1U6GB 2MD7B 4WZ0A 3DWDA 2AN6A 3MDBC 2KGGA 3PURA 2XB1A 1IYMA 2VNFA 2EXUA 2QIZA 2DJAA 2D8SA 1WEEA 4GNGA 2D8UA 2L0BA 3LRQA 1JM7A 3PLWA 2KFTA 4MSXA 4I7BA 2XOZA 2LXPC 5TRBA 1Z2QA 4O62A 3LQJA 2MD8C 2YURA 2JM3A 3HTKC 4WA6A 4ZQLA 2L7PA 5KH7A 2G45A 2F6JA 2RSDA 3I2DA 3LQIA 3T6RA 3NG2A 2LGGA 3L1XA 3RPGB 1V87A 3M7KA 2M6MA 1MBMA 2LQ6A 2PUYA 5TABA 4YBSA 1LDKC 1WEWA 3ZVZB 5H1UA 2L43A 2E6RA 4N4FA 2Y1NA 4QQ4A 3FJUB 1BORA 2E6SA 3SHBA 2VJEA 4WZ2A 3L1ZB 2QICA 4FK5A 1X4IA 2CRRA 4I7CA 2C2LA 4BHWA 4OGCA 1JOCA 3FM8C 4FO9A 1HYIA 2G43A 5LKXA 5TBNA 4S3OC 5B75A 2F6NA 4A4BA 1Z6UA 3LQHA 1WEQA 3KDEC 5AITA 1XWHA 2CKLB 5G04B 2H0DA 4C9ZA 2KKXA 1VYXA 4W4UA 2YHNA 2PNXA 2NAAA 4YABA 5B8DA 5D1KB 3O70A 3N9OA 2CT2A 3L11A 5SVYA 4UP0A 3O33A 2YT5A 1VD4A 3SOUA 2ECGA 2VPDA 4NN2A 4B7YC 4QF3A 4OGEA 3FL2A 3ZYQA 5EYAF 3H7HA 5SVXA 3C5KA 2YSJA 3DPLR 1DVPA 3EB6A 4P5OB 2CSYA 2XP0A 4R7EA 5FB1A 2K16A 2XOYA 3MHSA 4B86C 2JMIA 1X4JA 2UZGA 2IQJA 2MT5A 4Q6FA 2M1RA 5SVIB 5C11A 3ASLA 3O37A 3U5MA 2LV9A 3ZPVE 3KV6A 3FANA 4BBQA 2LGKA 1WFKA 4IC3A 3U5OA 3IHPA 2RR4A 4AYCB 3HCSA 4L58A 2ECTA 3DDTA 1WEMA 5LKTA 2EODA 3M99A 2KWJA 1WEVA 5G0FA 4N3WA 3KV5A 3ZPV1 1WEUA 2VJFB 3ZNIA 4CCGX 4GNFA 2L75A 2DSMA 4UI9B 3N9NA 4LADB 2FUUA 2XEUA 4LK9A 3O7AA 4PTBA 3PUQA 4GNDA 4A4CA 3N9MA 2KKYA 1MM3A 1WESA 2M85A 2BAYA 2YU4A 3EB5A 4A49A 2FUIA 3ZVYA 2B0OE 4AP4A 5FB0A 4F52B 2MIQA 3HCTA 4Z0RA 4YBTA 1F62A 2YYRA 2MKEA 5J3XA 5B77A 3GL6A 4TKPB 2YW8A 4ZDTA 2MUMA 4WZ3B 2M13A 2K4DA 2YREA 1ZBDB 1T1HA 4CA1A 3RTRB 2LAUA 1DCQA 1K2FA 4GNEA 1N87A 4FIPA 4S3OB 2E61A 2MNYA 3N9LA 3SOXA 5FERA 5KH3A 2F42A 5D1LB 3V43A 2YHOA 2FD4A 2YQMA 2G6QA 1VFYA 4O64A 4LLBA 5G05B 1LDJB 4L7XA 4QF2A 2CRWA 2CKLA 3SUBA 2L80A 2IDAA 5KH9A 2KIZA 2JMJA 3KNVA 2KR4A 3ZTGA 2I50A 1JM7B 4F1PA 1Z60A 2YUCA 2KREA 2K1JA 5H1TA 3DQVR 2KGIA 2ECVA 5TDRA 4AUQB 2FFWA 4YATA 3FAOA 3T7LA 2M3HA 3Q1DA 3U5NA 4YBMA 3PHDA 4YC9A 2QJ0A 3JUEA 3LVQE 4ZUXU 4XI1A 5DINA 2FSAA 3O34A 3E2DA 5TDWA 4AVXA 3LVRE 1WEPA 1G25A 2LRIC 2DX8A 2VP7A 2CONA 2CSVA 1WEOA 3RPGC 3HCUA 3VK6A 4LJNA 5SVIA 2LN0A 5B78A 3O35A 4V3LC 2OWAA 2OXQC 5LKUA 2KE1A 1RMDA 2CSZA 4I7DA 1X4UA 4LKAA 1WGMA 2Y43A 2ECJA 4R2YA 4UP5A 5JG6A 2EA6A 1HYJA 4AYCA 5H9MA 2EGPA 3O36A 2YVRA 2VJEB 4FJCA 2MNZA 1MM2A 2LDRA 2KYUA 1FBVA 4X3GA 2K17A 4IC2A 2C2VS 2YSMA 5LCWB
chains in the Genus database with same CATH topology
2VJFA 3U5PA 1FP0A 3MHHA 3M62A 2KWOA 4GB0A 5AIUA 2ECNA 2YQLA 5FEYA 4A0CD 2KWKA 2MA5A 2H0DB 2Y1MA 4MVTA 5B76A 5DKAA 1WIMA 3SOWA 1CHCA 5C13A 3N9PA 2MA6A 2ECIA 2JMDA 3KQIA 5B79A 2LGVA 2ZETC 2JRJA 2HYED 2ECWA 3C6WA 2KWNA 5I3LA 2LGLA 2RI7A 4YADA 2VPEA 3M63A 3GV4A 3N9QA 4V3KC 2KU3A 4R8PK 2L5UA 1WENA 5LKZA 1WILA 2HDPA 1WE9A 2LXHC 3QZVA 1E4UA 5H1VA 2VPGA 5D1MB 4PPEA 4YAXA 2VPBA 1U6GB 2MD7B 4WZ0A 2AN6A 2KGGA 3PURA 2XB1A 1IYMA 2VNFA 2QIZA 2D8SA 1WEEA 4GNGA 2L0BA 3LRQA 1JM7A 2KFTA 4MSXA 4I7BA 2LXPC 5TRBA 1Z2QA 3LQJA 2MD8C 2YURA 3HTKC 4WA6A 4ZQLA 5KH7A 2G45A 2F6JA 2RSDA 3I2DA 3LQIA 3T6RA 3NG2A 2LGGA 3L1XA 3RPGB 1V87A 2M6MA 2LQ6A 2PUYA 5TABA 4YBSA 1LDKC 1WEWA 3ZVZB 5H1UA 2L43A 2E6RA 4N4FA 2Y1NA 1BORA 2E6SA 3SHBA 2VJEA 4WZ2A 3L1ZB 2QICA 4FK5A 1X4IA 4I7CA 2C2LA 4BHWA 1JOCA 4FO9A 1HYIA 2G43A 5LKXA 5TBNA 4S3OC 5B75A 2F6NA 4A4BA 1Z6UA 3LQHA 1WEQA 5AITA 1XWHA 2CKLB 5G04B 2H0DA 4C9ZA 1VYXA 4W4UA 2YHNA 2PNXA 2NAAA 4YABA 5B8DA 5D1KB 3O70A 3N9OA 2CT2A 3L11A 4UP0A 3O33A 2YT5A 1VD4A 3SOUA 2ECGA 2VPDA 4NN2A 4B7YC 4QF3A 3FL2A 3ZYQA 5EYAF 3C5KA 2YSJA 3DPLR 1DVPA 3EB6A 4P5OB 2CSYA 4R7EA 5FB1A 2K16A 3MHSA 4B86C 2JMIA 1X4JA 2UZGA 2MT5A 4Q6FA 2M1RA 5C11A 3ASLA 3O37A 3U5MA 2LV9A 3ZPVE 3KV6A 4BBQA 2LGKA 1WFKA 4IC3A 3U5OA 3IHPA 4AYCB 3HCSA 4L58A 2ECTA 1WEMA 5LKTA 2EODA 3M99A 2KWJA 1WEVA 5G0FA 4N3WA 3KV5A 3ZPV1 1WEUA 2VJFB 3ZNIA 4CCGX 4GNFA 2L75A 4UI9B 3N9NA 4LADB 2FUUA 2XEUA 4LK9A 3O7AA 4PTBA 3PUQA 4GNDA 4A4CA 3N9MA 1MM3A 1WESA 2M85A 2BAYA 2YU4A 3EB5A 4A49A 2FUIA 3ZVYA 4AP4A 4F52B 5FB0A 2MIQA 3HCTA 4YBTA 1F62A 2YYRA 5J3XA 5B77A 3GL6A 4TKPB 2YW8A 4ZDTA 2MUMA 4WZ3B 2K4DA 2YREA 1ZBDB 1T1HA 4CA1A 3RTRB 1K2FA 4GNEA 1N87A 4FIPA 4S3OB 2MNYA 3SOXA 3N9LA 5FERA 5KH3A 2F42A 5D1LB 3V43A 2YHOA 2YQMA 2G6QA 1VFYA 4O64A 4LLBA 5G05B 1LDJB 4L7XA 4QF2A 2CKLA 2L80A 2IDAA 5KH9A 2KIZA 2JMJA 3KNVA 2KR4A 3ZTGA 2I50A 1JM7B 1Z60A 2YUCA 2KREA 2K1JA 5H1TA 3DQVR 2KGIA 2ECVA 5TDRA 4AUQB 4YATA 3T7LA 2M3HA 3U5NA 4YBMA 3PHDA 4YC9A 2QJ0A 4ZUXU 4XI1A 5DINA 2FSAA 3O34A 5TDWA 4AVXA 1WEPA 1G25A 2LRIC 2DX8A 2VP7A 1WEOA 3RPGC 3HCUA 3VK6A 4LJNA 2LN0A 5B78A 3O35A 4V3LC 2OXQC 5LKUA 2KE1A 1RMDA 2CSZA 4I7DA 1X4UA 4LKAA 1WGMA 2Y43A 2ECJA 4R2YA 4UP5A 5JG6A 2EA6A 1HYJA 4AYCA 5H9MA 2EGPA 3O36A 2VJEB 4FJCA 2MNZA 1MM2A 2LDRA 2KYUA 1FBVA 4X3GA 2K17A 4IC2A 2C2VS 2YSMA 5LCWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VJF A;  3U5P A;  1FP0 A;  3MHH A;  3M62 A;  2KWO A;  4GB0 A;  5AIU A;  2ECN A;  2YQL A;  5FEY A;  4A0C D;  2KWK A;  2MA5 A;  2H0D B;  2Y1M A;  4MVT A;  5B76 A;  5DKA A;  1WIM A;  3SOW A;  1CHC A;  5C13 A;  3N9P A;  2MA6 A;  2ECI A;  2JMD A;  3KQI A;  5B79 A;  2LGV A;  2ZET C;  2JRJ A;  2HYE D;  2ECW A;  3C6W A;  2KWN A;  5I3L A;  2LGL A;  2RI7 A;  4YAD A;  2VPE A;  3M63 A;  3GV4 A;  3N9Q A;  4V3K C;  2KU3 A;  4R8P K;  2L5U A;  1WEN A;  5LKZ A;  1WIL A;  2HDP A;  1WE9 A;  2LXH C;  3QZV A;  1E4U A;  5H1V A;  2VPG A;  5D1M B;  4PPE A;  4YAX A;  2VPB A;  1U6G B;  2MD7 B;  4WZ0 A;  2AN6 A;  2KGG A;  3PUR A;  2XB1 A;  1IYM A;  2VNF A;  2QIZ A;  2D8S A;  1WEE A;  4GNG A;  2L0B A;  3LRQ A;  1JM7 A;  2KFT A;  4MSX A;  4I7B A;  2LXP C;  5TRB A;  1Z2Q A;  3LQJ A;  2MD8 C;  2YUR A;  3HTK C;  4WA6 A;  4ZQL A;  5KH7 A;  2G45 A;  2F6J A;  2RSD A;  3I2D A;  3LQI A;  3T6R A;  3NG2 A;  2LGG A;  3L1X A;  3RPG B;  1V87 A;  2M6M A;  2LQ6 A;  2PUY A;  5TAB A;  4YBS A;  1LDK C;  1WEW A;  3ZVZ B;  5H1U A;  2L43 A;  2E6R A;  4N4F A;  2Y1N A;  1BOR A;  2E6S A;  3SHB A;  2VJE A;  4WZ2 A;  3L1Z B;  2QIC A;  4FK5 A;  1X4I A;  4I7C A;  2C2L A;  4BHW A;  1JOC A;  4FO9 A;  1HYI A;  2G43 A;  5LKX A;  5TBN A;  4S3O C;  5B75 A;  2F6N A;  4A4B A;  1Z6U A;  3LQH A;  1WEQ A;  5AIT A;  1XWH A;  2CKL B;  5G04 B;  2H0D A;  4C9Z A;  1VYX A;  4W4U A;  2YHN A;  2PNX A;  2NAA A;  4YAB A;  5B8D A;  5D1K B;  3O70 A;  3N9O A;  2CT2 A;  3L11 A;  4UP0 A;  3O33 A;  2YT5 A;  1VD4 A;  3SOU A;  2ECG A;  2VPD A;  4NN2 A;  4B7Y C;  4QF3 A;  3FL2 A;  3ZYQ A;  5EYA F;  3C5K A;  2YSJ A;  3DPL R;  1DVP A;  3EB6 A;  4P5O B;  2CSY A;  4R7E A;  5FB1 A;  2K16 A;  3MHS A;  4B86 C;  2JMI A;  1X4J A;  2UZG A;  2MT5 A;  4Q6F A;  2M1R A;  5C11 A;  3ASL A;  3O37 A;  3U5M A;  2LV9 A;  3ZPV E;  3KV6 A;  4BBQ A;  2LGK A;  1WFK A;  4IC3 A;  3U5O A;  3IHP A;  4AYC B;  3HCS A;  4L58 A;  2ECT A;  1WEM A;  5LKT A;  2EOD A;  3M99 A;  2KWJ A;  1WEV A;  5G0F A;  4N3W A;  3KV5 A;  3ZPV 1;  1WEU A;  2VJF B;  3ZNI A;  4CCG X;  4GNF A;  2L75 A;  4UI9 B;  3N9N A;  4LAD B;  2FUU A;  2XEU A;  4LK9 A;  3O7A A;  4PTB A;  3PUQ A;  4GND A;  4A4C A;  3N9M A;  1MM3 A;  1WES A;  2M85 A;  2BAY A;  2YU4 A;  3EB5 A;  4A49 A;  2FUI A;  3ZVY A;  4AP4 A;  4F52 B;  5FB0 A;  2MIQ A;  3HCT A;  4YBT A;  1F62 A;  2YYR A;  5J3X A;  5B77 A;  3GL6 A;  4TKP B;  2YW8 A;  4ZDT A;  2MUM A;  4WZ3 B;  2K4D A;  2YRE A;  1ZBD B;  1T1H A;  4CA1 A;  3RTR B;  1K2F A;  4GNE A;  1N87 A;  4FIP A;  4S3O B;  2MNY A;  3SOX A;  3N9L A;  5FER A;  5KH3 A;  2F42 A;  5D1L B;  3V43 A;  2YHO A;  2YQM A;  2G6Q A;  1VFY A;  4O64 A;  4LLB A;  5G05 B;  1LDJ B;  4L7X A;  4QF2 A;  2CKL A;  2L80 A;  2IDA A;  5KH9 A;  2KIZ A;  2JMJ A;  3KNV A;  2KR4 A;  3ZTG A;  2I50 A;  1JM7 B;  1Z60 A;  2YUC A;  2KRE A;  2K1J A;  5H1T A;  3DQV R;  2KGI A;  2ECV A;  5TDR A;  4AUQ B;  4YAT A;  3T7L A;  2M3H A;  3U5N A;  4YBM A;  3PHD A;  4YC9 A;  2QJ0 A;  4ZUX U;  4XI1 A;  5DIN A;  2FSA A;  3O34 A;  5TDW A;  4AVX A;  1WEP A;  1G25 A;  2LRI C;  2DX8 A;  2VP7 A;  1WEO A;  3RPG C;  3HCU A;  3VK6 A;  4LJN A;  2LN0 A;  5B78 A;  3O35 A;  4V3L C;  2OXQ C;  5LKU A;  2KE1 A;  1RMD A;  2CSZ A;  4I7D A;  1X4U A;  4LKA A;  1WGM A;  2Y43 A;  2ECJ A;  4R2Y A;  4UP5 A;  5JG6 A;  2EA6 A;  1HYJ A;  4AYC A;  5H9M A;  2EGP A;  3O36 A;  2VJE B;  4FJC A;  2MNZ A;  1MM2 A;  2LDR A;  2KYU A;  1FBV A;  4X3G A;  2K17 A;  4IC2 A;  2C2V S;  2YSM A;  5LCW B; 
#chains in the Genus database with same CATH topology
 2VJF A;  3U5P A;  1FP0 A;  3MHH A;  5K3Q A;  3FEH A;  3M62 A;  2KWO A;  4GB0 A;  5AIU A;  2ECN A;  2YQL A;  5FEY A;  4A0C D;  3T9K A;  2KWK A;  2MA5 A;  2H0D B;  2Y1M A;  4MVT A;  5B76 A;  5DKA A;  1WIM A;  3SOW A;  1CHC A;  5C13 A;  3N9P A;  2MA6 A;  2JUN A;  2ECI A;  2EGM A;  2JMD A;  3KQI A;  5B79 A;  2LGV A;  2ZET C;  3LJU X;  2JRJ A;  2HYE D;  2ECW A;  4H9D A;  3C6W A;  2KWN A;  5I3L A;  4Z0O A;  2XOC A;  2LGL A;  2RI7 A;  4YAD A;  2VPE A;  3M63 A;  3GV4 A;  3N9Q A;  4V3K C;  2KU3 A;  4R8P K;  2L5U A;  1WEN A;  5LKZ A;  1WIL A;  2P57 A;  2HDP A;  3LDY A;  1WE9 A;  2LXH C;  3O47 A;  3QZV A;  1E4U A;  5H1V A;  2VPG A;  5D1M B;  4PPE A;  4YAX A;  2VPB A;  1U6G B;  2MD7 B;  4WZ0 A;  3DWD A;  2AN6 A;  3MDB C;  2KGG A;  3PUR A;  2XB1 A;  1IYM A;  2VNF A;  2EXU A;  2QIZ A;  2DJA A;  2D8S A;  1WEE A;  4GNG A;  2D8U A;  2L0B A;  3LRQ A;  1JM7 A;  3PLW A;  2KFT A;  4MSX A;  4I7B A;  2XOZ A;  2LXP C;  5TRB A;  1Z2Q A;  4O62 A;  3LQJ A;  2MD8 C;  2YUR A;  2JM3 A;  3HTK C;  4WA6 A;  4ZQL A;  2L7P A;  5KH7 A;  2G45 A;  2F6J A;  2RSD A;  3I2D A;  3LQI A;  3T6R A;  3NG2 A;  2LGG A;  3L1X A;  3RPG B;  1V87 A;  3M7K A;  2M6M A;  1MBM A;  2LQ6 A;  2PUY A;  5TAB A;  4YBS A;  1LDK C;  1WEW A;  3ZVZ B;  5H1U A;  2L43 A;  2E6R A;  4N4F A;  2Y1N A;  4QQ4 A;  3FJU B;  1BOR A;  2E6S A;  3SHB A;  2VJE A;  4WZ2 A;  3L1Z B;  2QIC A;  4FK5 A;  1X4I A;  2CRR A;  4I7C A;  2C2L A;  4BHW A;  4OGC A;  1JOC A;  3FM8 C;  4FO9 A;  1HYI A;  2G43 A;  5LKX A;  5TBN A;  4S3O C;  5B75 A;  2F6N A;  4A4B A;  1Z6U A;  3LQH A;  1WEQ A;  3KDE C;  5AIT A;  1XWH A;  2CKL B;  5G04 B;  2H0D A;  4C9Z A;  2KKX A;  1VYX A;  4W4U A;  2YHN A;  2PNX A;  2NAA A;  4YAB A;  5B8D A;  5D1K B;  3O70 A;  3N9O A;  2CT2 A;  3L11 A;  5SVY A;  4UP0 A;  3O33 A;  2YT5 A;  1VD4 A;  3SOU A;  2ECG A;  2VPD A;  4NN2 A;  4B7Y C;  4QF3 A;  4OGE A;  3FL2 A;  3ZYQ A;  5EYA F;  3H7H A;  5SVX A;  3C5K A;  2YSJ A;  3DPL R;  1DVP A;  3EB6 A;  4P5O B;  2CSY A;  2XP0 A;  4R7E A;  5FB1 A;  2K16 A;  2XOY A;  3MHS A;  4B86 C;  2JMI A;  1X4J A;  2UZG A;  2IQJ A;  2MT5 A;  4Q6F A;  2M1R A;  5SVI B;  5C11 A;  3ASL A;  3O37 A;  3U5M A;  2LV9 A;  3ZPV E;  3KV6 A;  3FAN A;  4BBQ A;  2LGK A;  1WFK A;  4IC3 A;  3U5O A;  3IHP A;  2RR4 A;  4AYC B;  3HCS A;  4L58 A;  2ECT A;  3DDT A;  1WEM A;  5LKT A;  2EOD A;  3M99 A;  2KWJ A;  1WEV A;  5G0F A;  4N3W A;  3KV5 A;  3ZPV 1;  1WEU A;  2VJF B;  3ZNI A;  4CCG X;  4GNF A;  2L75 A;  2DSM A;  4UI9 B;  3N9N A;  4LAD B;  2FUU A;  2XEU A;  4LK9 A;  3O7A A;  4PTB A;  3PUQ A;  4GND A;  4A4C A;  3N9M A;  2KKY A;  1MM3 A;  1WES A;  2M85 A;  2BAY A;  2YU4 A;  3EB5 A;  4A49 A;  2FUI A;  3ZVY A;  2B0O E;  4AP4 A;  5FB0 A;  4F52 B;  2MIQ A;  3HCT A;  4Z0R A;  4YBT A;  1F62 A;  2YYR A;  2MKE A;  5J3X A;  5B77 A;  3GL6 A;  4TKP B;  2YW8 A;  4ZDT A;  2MUM A;  4WZ3 B;  2M13 A;  2K4D A;  2YRE A;  1ZBD B;  1T1H A;  4CA1 A;  3RTR B;  2LAU A;  1DCQ A;  1K2F A;  4GNE A;  1N87 A;  4FIP A;  4S3O B;  2E61 A;  2MNY A;  3N9L A;  3SOX A;  5FER A;  5KH3 A;  2F42 A;  5D1L B;  3V43 A;  2YHO A;  2FD4 A;  2YQM A;  2G6Q A;  1VFY A;  4O64 A;  4LLB A;  5G05 B;  1LDJ B;  4L7X A;  4QF2 A;  2CRW A;  2CKL A;  3SUB A;  2L80 A;  2IDA A;  5KH9 A;  2KIZ A;  2JMJ A;  3KNV A;  2KR4 A;  3ZTG A;  2I50 A;  1JM7 B;  4F1P A;  1Z60 A;  2YUC A;  2KRE A;  2K1J A;  5H1T A;  3DQV R;  2KGI A;  2ECV A;  5TDR A;  4AUQ B;  2FFW A;  4YAT A;  3FAO A;  3T7L A;  2M3H A;  3Q1D A;  3U5N A;  4YBM A;  3PHD A;  4YC9 A;  2QJ0 A;  3JUE A;  3LVQ E;  4ZUX U;  4XI1 A;  5DIN A;  2FSA A;  3O34 A;  3E2D A;  5TDW A;  4AVX A;  3LVR E;  1WEP A;  1G25 A;  2LRI C;  2DX8 A;  2VP7 A;  2CON A;  2CSV A;  1WEO A;  3RPG C;  3HCU A;  3VK6 A;  4LJN A;  5SVI A;  2LN0 A;  5B78 A;  3O35 A;  4V3L C;  2OWA A;  2OXQ C;  5LKU A;  2KE1 A;  1RMD A;  2CSZ A;  4I7D A;  1X4U A;  4LKA A;  1WGM A;  2Y43 A;  2ECJ A;  4R2Y A;  4UP5 A;  5JG6 A;  2EA6 A;  1HYJ A;  4AYC A;  5H9M A;  2EGP A;  3O36 A;  2YVR A;  2VJE B;  4FJC A;  2MNZ A;  1MM2 A;  2LDR A;  2KYU A;  1FBV A;  4X3G A;  2K17 A;  4IC2 A;  2C2V S;  2YSM A;  5LCW B; 
#chains in the Genus database with same CATH homology
 2VJF A;  3U5P A;  1FP0 A;  3MHH A;  3M62 A;  2KWO A;  4GB0 A;  5AIU A;  2ECN A;  2YQL A;  5FEY A;  4A0C D;  2KWK A;  2MA5 A;  2H0D B;  2Y1M A;  4MVT A;  5B76 A;  5DKA A;  1WIM A;  3SOW A;  1CHC A;  5C13 A;  3N9P A;  2MA6 A;  2ECI A;  2JMD A;  3KQI A;  5B79 A;  2LGV A;  2ZET C;  2JRJ A;  2HYE D;  2ECW A;  3C6W A;  2KWN A;  5I3L A;  2LGL A;  2RI7 A;  4YAD A;  2VPE A;  3M63 A;  3GV4 A;  3N9Q A;  4V3K C;  2KU3 A;  4R8P K;  2L5U A;  1WEN A;  5LKZ A;  1WIL A;  2HDP A;  1WE9 A;  2LXH C;  3QZV A;  1E4U A;  5H1V A;  2VPG A;  5D1M B;  4PPE A;  4YAX A;  2VPB A;  1U6G B;  2MD7 B;  4WZ0 A;  2AN6 A;  2KGG A;  3PUR A;  2XB1 A;  1IYM A;  2VNF A;  2QIZ A;  2D8S A;  1WEE A;  4GNG A;  2L0B A;  3LRQ A;  1JM7 A;  2KFT A;  4MSX A;  4I7B A;  2LXP C;  5TRB A;  1Z2Q A;  3LQJ A;  2MD8 C;  2YUR A;  3HTK C;  4WA6 A;  4ZQL A;  5KH7 A;  2G45 A;  2F6J A;  2RSD A;  3I2D A;  3LQI A;  3T6R A;  3NG2 A;  2LGG A;  3L1X A;  3RPG B;  1V87 A;  2M6M A;  2LQ6 A;  2PUY A;  5TAB A;  4YBS A;  1LDK C;  1WEW A;  3ZVZ B;  5H1U A;  2L43 A;  2E6R A;  4N4F A;  2Y1N A;  1BOR A;  2E6S A;  3SHB A;  2VJE A;  4WZ2 A;  3L1Z B;  2QIC A;  4FK5 A;  1X4I A;  4I7C A;  2C2L A;  4BHW A;  1JOC A;  4FO9 A;  1HYI A;  2G43 A;  5LKX A;  5TBN A;  4S3O C;  5B75 A;  2F6N A;  4A4B A;  1Z6U A;  3LQH A;  1WEQ A;  5AIT A;  1XWH A;  2CKL B;  5G04 B;  2H0D A;  4C9Z A;  1VYX A;  4W4U A;  2YHN A;  2PNX A;  2NAA A;  4YAB A;  5B8D A;  5D1K B;  3O70 A;  3N9O A;  2CT2 A;  3L11 A;  4UP0 A;  3O33 A;  2YT5 A;  1VD4 A;  3SOU A;  2ECG A;  2VPD A;  4NN2 A;  4B7Y C;  4QF3 A;  3FL2 A;  3ZYQ A;  5EYA F;  3C5K A;  2YSJ A;  3DPL R;  1DVP A;  3EB6 A;  4P5O B;  2CSY A;  4R7E A;  5FB1 A;  2K16 A;  3MHS A;  4B86 C;  2JMI A;  1X4J A;  2UZG A;  2MT5 A;  4Q6F A;  2M1R A;  5C11 A;  3ASL A;  3O37 A;  3U5M A;  2LV9 A;  3ZPV E;  3KV6 A;  4BBQ A;  2LGK A;  1WFK A;  4IC3 A;  3U5O A;  3IHP A;  4AYC B;  3HCS A;  4L58 A;  2ECT A;  1WEM A;  5LKT A;  2EOD A;  3M99 A;  2KWJ A;  1WEV A;  5G0F A;  4N3W A;  3KV5 A;  3ZPV 1;  1WEU A;  2VJF B;  3ZNI A;  4CCG X;  4GNF A;  2L75 A;  4UI9 B;  3N9N A;  4LAD B;  2FUU A;  2XEU A;  4LK9 A;  3O7A A;  4PTB A;  3PUQ A;  4GND A;  4A4C A;  3N9M A;  1MM3 A;  1WES A;  2M85 A;  2BAY A;  2YU4 A;  3EB5 A;  4A49 A;  2FUI A;  3ZVY A;  4AP4 A;  4F52 B;  5FB0 A;  2MIQ A;  3HCT A;  4YBT A;  1F62 A;  2YYR A;  5J3X A;  5B77 A;  3GL6 A;  4TKP B;  2YW8 A;  4ZDT A;  2MUM A;  4WZ3 B;  2K4D A;  2YRE A;  1ZBD B;  1T1H A;  4CA1 A;  3RTR B;  1K2F A;  4GNE A;  1N87 A;  4FIP A;  4S3O B;  2MNY A;  3SOX A;  3N9L A;  5FER A;  5KH3 A;  2F42 A;  5D1L B;  3V43 A;  2YHO A;  2YQM A;  2G6Q A;  1VFY A;  4O64 A;  4LLB A;  5G05 B;  1LDJ B;  4L7X A;  4QF2 A;  2CKL A;  2L80 A;  2IDA A;  5KH9 A;  2KIZ A;  2JMJ A;  3KNV A;  2KR4 A;  3ZTG A;  2I50 A;  1JM7 B;  1Z60 A;  2YUC A;  2KRE A;  2K1J A;  5H1T A;  3DQV R;  2KGI A;  2ECV A;  5TDR A;  4AUQ B;  4YAT A;  3T7L A;  2M3H A;  3U5N A;  4YBM A;  3PHD A;  4YC9 A;  2QJ0 A;  4ZUX U;  4XI1 A;  5DIN A;  2FSA A;  3O34 A;  5TDW A;  4AVX A;  1WEP A;  1G25 A;  2LRI C;  2DX8 A;  2VP7 A;  1WEO A;  3RPG C;  3HCU A;  3VK6 A;  4LJN A;  2LN0 A;  5B78 A;  3O35 A;  4V3L C;  2OXQ C;  5LKU A;  2KE1 A;  1RMD A;  2CSZ A;  4I7D A;  1X4U A;  4LKA A;  1WGM A;  2Y43 A;  2ECJ A;  4R2Y A;  4UP5 A;  5JG6 A;  2EA6 A;  1HYJ A;  4AYC A;  5H9M A;  2EGP A;  3O36 A;  2VJE B;  4FJC A;  2MNZ A;  1MM2 A;  2LDR A;  2KYU A;  1FBV A;  4X3G A;  2K17 A;  4IC2 A;  2C2V S;  2YSM A;  5LCW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...