2K17A

Solution structure of the taf3 phd domain in complex with a h3k4me3 peptide
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
75
structure length
75
Chain Sequence
GSHMAMAYVIRDEWGNQIWICPGCNKPDDGSPMIGCDDCDDWYHWPCVGIMAAPPEEMQWFCPKCANKIKKDKKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords H3K4me3 peptide
publication title Recognition of the H3K4me3 mark by the TAF3-PHD finger
rcsb
source organism Mus musculus
molecule tags Transcription
total genus 10
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2008-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2k17A00
2H0DB 1ZBDB 2VNFA 1Z2QA 3N9NA 2OXQC 3SOUA 5KH3A 2KGIA 2KREA 4YAXA 5B77A 5TDWA 2M3HA 3U5OA 3RTRB 3VK6A 4V3KC 2ECJA 5B76A 5I3LA 2ECIA 5FB0A 1VD4A 2FUIA 2L75A 2YUCA 4S3OB 3ZPV1 1WEQA 2VJFB 3FL2A 4L7XA 2LV9A 3I2DA 4I7CA 3HCTA 4UI9B 4R2YA 5B75A 5EYAF 1WEOA 3LQHA 5G05B 3EB5A 2YQLA 2KWNA 3N9MA 1K2FA 2YT5A 3GV4A 1WEEA 1MM2A 2KWKA 2VPBA 2CT2A 2K1JA 2YHOA 1JM7B 1BORA 5LKXA 2YSJA 2ECGA 2KGGA 3DQVR 4ZQLA 3KNVA 2ECTA 4A4BA 1Z6UA 2C2LA 2IDAA 2L80A 1HYJA 2Y1NA 5LKTA 3HCUA 4QF2A 5B79A 5H1UA 2M85A 2LGKA 2MA5A 2KIZA 4FJCA 4W4UA 2LXHC 4Q6FA 5DKAA 4PPEA 5TRBA 3L1ZB 4GNEA 3MHHA 1WENA 4WZ0A 2VJEB 1U6GB 5D1MB 3NG2A 3KV5A 3PUQA 2QIZA 5KH7A 4WZ2A 1XWHA 2E6SA 1WIMA 2L0BA 3T6RA 4LJNA 5B8DA 5G04B 2VP7A 2JMIA 4ZDTA 2MT5A 4CCGX 3SHBA 1WGMA 4B86C 4V3LC 5D1KB 4YC9A 4YBTA 4WZ3B 1MM3A 1VFYA 1WFKA 5LCWB 4AVXA 2Y43A 4LLBA 4YATA 1V87A 1WEUA 3M63A 1WE9A 4S3OC 3MHSA 1WEPA 4R7EA 4A4CA 3N9PA 2M6MA 3U5MA 3L1XA 5FERA 4N4FA 4YADA 2PNXA 2VPGA 4NN2A 2YREA 4YABA 2MD8C 5LKZA 4CA1A 2K17A 1WILA 1X4JA 2F6NA 3ZYQA 2ZETC 2LGLA 2CKLB 3KQIA 4FO9A 2MNZA 5D1LB 4BBQA 2YSMA 2F42A 4N3WA 3M99A 2KR4A 2XEUA 3ZNIA 4A0CD 2E6RA 3LQJA 2YYRA 3O70A 5LKUA 1IYMA 2Y1MA 2LN0A 1WEMA 2PUYA 2VJFA 1HYIA 4UP0A 2VPEA 3C6WA 4YBSA 2YURA 3PURA 3RPGC 5KH9A 2YW8A 5FB1A 3U5NA 4MVTA 3V43A 3RPGB 4YBMA 3SOWA 5H1VA 2NAAA 5TABA 2ECWA 3O36A 5B78A 2YU4A 1RMDA 3SOXA 3KV6A 1JM7A 3EB6A 2LDRA 4LKAA 2MIQA 2UZGA 2CSYA 2LGGA 4IC3A 2LRIC 2DX8A 1WEVA 1WEWA 3M62A 2K4DA 3ASLA 4AUQB 5AIUA 5C13A 1G25A 4GB0A 4WA6A 1F62A 4GNGA 5AITA 4PTBA 4IC2A 3T7LA 4GNFA 3O33A 4AYCA 2KWJA 5JG6A 4X3GA 2LGVA 3N9OA 2L43A 2KFTA 2RI7A 3O34A 2VJEA 2YQMA 4GNDA 4BHWA 4TKPB 5G0FA 1E4UA 2XB1A 3ZVZB 4FK5A 3O7AA 2LXPC 3ZPVE 2F6JA 2KU3A 4MSXA 2FUUA 2C2VS 4O64A 3U5PA 3LRQA 3N9LA 4XI1A 4C9ZA 2JRJA 2G6QA 2ECNA 1T1HA 4LK9A 1X4UA 2H0DA 2EA6A 2HYED 4QF3A 5FEYA 1X4IA 1JOCA 2MD7B 3ZVYA 2L5UA 2BAYA 2RSDA 3O35A 3L11A 1N87A 5J3XA 5TDRA 2KWOA 4AP4A 4I7DA 1CHCA 4F52B 2ECVA 2MNYA 2KYUA 1LDJB 5H1TA 4P5OB 3O37A 3LQIA 1Z60A 2VPDA 5DINA 2FSAA 5TBNA 1DVPA 2D8SA 2G45A 4FIPA 3HTKC 2HDPA 2CKLA 3N9QA 4I7BA 2QJ0A 2MUMA 2QICA 1LDKC 2K16A 4B7YC 4ZUXU 3HCSA 2EODA 5C11A 1WESA 4AYCB 3GL6A 2MA6A 3IHPA 2KE1A 3ZTGA 2LQ6A 2M1RA 2YHNA 2I50A 3PHDA 4A49A 3QZVA 1FP0A 2AN6A 1VYXA 4L58A 2JMJA 4R8PK 2JMDA 3DPLR 2CSZA 1FBVA 4LADB 2EGPA 2G43A 3C5KA 4UP5A 5H9MA
chains in the Genus database with same CATH superfamily
2H0DB 3PLWA 1ZBDB 2VNFA 1Z2QA 3N9NA 2E61A 2OXQC 3SOUA 5KH3A 2KGIA 2KREA 4YAXA 5B77A 5TDWA 1MBMA 2M3HA 3U5OA 3RTRB 2CSVA 3VK6A 2IQJA 4V3KC 2ECJA 5B76A 5I3LA 2ECIA 5FB0A 1VD4A 2FUIA 2L75A 2YUCA 4S3OB 2RR4A 2CRWA 3ZPV1 1WEQA 2VJFB 3FL2A 4L7XA 2LV9A 3I2DA 4I7CA 3HCTA 4UI9B 4R2YA 5B75A 5EYAF 1WEOA 3LQHA 5G05B 3EB5A 2YQLA 2KWNA 3N9MA 2P57A 1K2FA 2YT5A 3GV4A 1WEEA 1MM2A 2KWKA 3FAOA 2VPBA 2CT2A 2K1JA 2YHOA 4Z0RA 1JM7B 1BORA 5LKXA 2YSJA 2ECGA 2KGGA 3DQVR 4ZQLA 3KNVA 2ECTA 4A4BA 1Z6UA 2C2LA 2IDAA 2L80A 1HYJA 2Y1NA 5LKTA 3HCUA 4QF2A 5B79A 5H1UA 2M85A 2LGKA 2MA5A 2KIZA 4FJCA 2XP0A 2MKEA 4W4UA 2LXHC 4Q6FA 5DKAA 4PPEA 5TRBA 3L1ZB 4GNEA 3MHHA 1WENA 4WZ0A 2VJEB 1U6GB 5D1MB 3NG2A 2CONA 3KV5A 3PUQA 2QIZA 5KH7A 4WZ2A 1XWHA 2L7PA 2E6SA 1WIMA 3KDEC 2L0BA 2XOCA 4O62A 3T6RA 2B0OE 4LJNA 5B8DA 5G04B 2VP7A 2JMIA 4ZDTA 2MT5A 4CCGX 3SHBA 1WGMA 4B86C 4V3LC 5D1KB 4YC9A 4YBTA 4WZ3B 1MM3A 1VFYA 1WFKA 5LCWB 4AVXA 2Y43A 2JUNA 4LLBA 4QQ4A 4YATA 1V87A 1WEUA 3M63A 1WE9A 4S3OC 3MHSA 1WEPA 4R7EA 4A4CA 3N9PA 2M6MA 3U5MA 3L1XA 3SUBA 5FERA 4N4FA 3T9KA 4YADA 2PNXA 2VPGA 4NN2A 2YREA 4YABA 2MD8C 5LKZA 5SVYA 4CA1A 2K17A 1WILA 1X4JA 2F6NA 4OGCA 3ZYQA 2ZETC 2LGLA 2CKLB 5SVXA 3KQIA 4FO9A 2MNZA 5D1LB 2CRRA 4BBQA 2YSMA 2F42A 4N3WA 2KKXA 3M99A 2KR4A 2XEUA 2FD4A 3ZNIA 4A0CD 2E6RA 3LQJA 2YYRA 3O70A 5LKUA 3Q1DA 1IYMA 2Y1MA 2LN0A 1WEMA 3MDBC 2EGMA 2PUYA 2VJFA 1HYIA 3FANA 4UP0A 2VPEA 3C6WA 4YBSA 4H9DA 2YURA 3PURA 3RPGC 5KH9A 2YW8A 5FB1A 3O47A 3U5NA 4MVTA 3V43A 3RPGB 4YBMA 2XOYA 3SOWA 5H1VA 2NAAA 5TABA 2ECWA 3O36A 5B78A 2YU4A 1RMDA 3SOXA 3LVQE 2XOZA 3KV6A 1JM7A 3EB6A 2LDRA 4LKAA 3LJUX 2MIQA 2UZGA 2CSYA 2LGGA 5SVIA 3FEHA 4IC3A 2LRIC 2DX8A 1WEVA 1WEWA 3M62A 2K4DA 3ASLA 4F1PA 3FM8C 4AUQB 5AIUA 5C13A 1G25A 4GB0A 2DSMA 4WA6A 3E2DA 3LDYA 1F62A 4GNGA 5AITA 4PTBA 4IC2A 3T7LA 4GNFA 3O33A 4AYCA 2KWJA 2M13A 5JG6A 4X3GA 2LGVA 3N9OA 2L43A 2KFTA 2RI7A 3O34A 3FJUB 2EXUA 2VJEA 2YQMA 4GNDA 4BHWA 4TKPB 5G0FA 1E4UA 2XB1A 3ZVZB 4FK5A 3O7AA 2LXPC 3ZPVE 2F6JA 2KU3A 3DWDA 4MSXA 2FUUA 2C2VS 4O64A 4Z0OA 3U5PA 3LRQA 3N9LA 4XI1A 3DDTA 4C9ZA 2JRJA 2G6QA 2ECNA 1T1HA 3M7KA 4LK9A 1X4UA 2H0DA 2EA6A 2KKYA 2HYED 4QF3A 5FEYA 1X4IA 1JOCA 2MD7B 3ZVYA 2D8UA 2L5UA 2BAYA 2RSDA 3O35A 2OWAA 3L11A 1N87A 5J3XA 5TDRA 2KWOA 4AP4A 4I7DA 1CHCA 4F52B 2ECVA 2MNYA 2DJAA 2KYUA 1LDJB 5H1TA 5SVIB 4P5OB 3O37A 3LQIA 1Z60A 2VPDA 5DINA 2FSAA 5TBNA 1DVPA 2D8SA 2G45A 4FIPA 3HTKC 2CKLA 2HDPA 3N9QA 4I7BA 5K3QA 2QJ0A 2MUMA 2QICA 1LDKC 2K16A 4B7YC 4ZUXU 3HCSA 2EODA 1DCQA 5C11A 1WESA 2FFWA 4AYCB 2LAUA 3GL6A 2MA6A 3IHPA 2KE1A 3ZTGA 2LQ6A 2M1RA 2YHNA 2I50A 3PHDA 4A49A 3QZVA 1FP0A 2AN6A 1VYXA 4OGEA 4L58A 3LVRE 2JMJA 4R8PK 2YVRA 2JMDA 3JUEA 3DPLR 2JM3A 2CSZA 1FBVA 4LADB 2EGPA 2G43A 3C5KA 4UP5A 3H7HA 5H9MA
chains in the Genus database with same CATH topology
2H0DB 1ZBDB 2VNFA 1Z2QA 3N9NA 2OXQC 3SOUA 5KH3A 2KGIA 2KREA 4YAXA 5B77A 5TDWA 2M3HA 3U5OA 3RTRB 3VK6A 4V3KC 2ECJA 5B76A 5I3LA 2ECIA 5FB0A 1VD4A 2FUIA 2L75A 2YUCA 4S3OB 3ZPV1 1WEQA 2VJFB 3FL2A 4L7XA 2LV9A 3I2DA 4I7CA 3HCTA 4UI9B 4R2YA 5B75A 5EYAF 1WEOA 3LQHA 5G05B 3EB5A 2YQLA 2KWNA 3N9MA 1K2FA 2YT5A 3GV4A 1WEEA 1MM2A 2KWKA 2VPBA 2CT2A 2K1JA 2YHOA 1JM7B 1BORA 5LKXA 2YSJA 2ECGA 2KGGA 3DQVR 4ZQLA 3KNVA 2ECTA 4A4BA 1Z6UA 2C2LA 2IDAA 2L80A 1HYJA 2Y1NA 5LKTA 3HCUA 4QF2A 5B79A 5H1UA 2M85A 2LGKA 2MA5A 2KIZA 4FJCA 4W4UA 2LXHC 4Q6FA 5DKAA 4PPEA 5TRBA 3L1ZB 4GNEA 3MHHA 1WENA 4WZ0A 2VJEB 1U6GB 5D1MB 3NG2A 3KV5A 3PUQA 2QIZA 5KH7A 4WZ2A 1XWHA 2E6SA 1WIMA 2L0BA 3T6RA 4LJNA 5B8DA 5G04B 2VP7A 2JMIA 4ZDTA 2MT5A 4CCGX 3SHBA 1WGMA 4B86C 4V3LC 5D1KB 4YC9A 4YBTA 4WZ3B 1MM3A 1VFYA 1WFKA 5LCWB 4AVXA 2Y43A 4LLBA 4YATA 1V87A 1WEUA 3M63A 1WE9A 4S3OC 3MHSA 1WEPA 4R7EA 4A4CA 3N9PA 2M6MA 3U5MA 3L1XA 5FERA 4N4FA 4YADA 2PNXA 2VPGA 4NN2A 2YREA 4YABA 2MD8C 5LKZA 4CA1A 2K17A 1WILA 1X4JA 2F6NA 3ZYQA 2ZETC 2LGLA 2CKLB 3KQIA 4FO9A 2MNZA 5D1LB 4BBQA 2YSMA 2F42A 4N3WA 3M99A 2KR4A 2XEUA 3ZNIA 4A0CD 2E6RA 3LQJA 2YYRA 3O70A 5LKUA 1IYMA 2Y1MA 2LN0A 1WEMA 2PUYA 2VJFA 1HYIA 4UP0A 2VPEA 3C6WA 4YBSA 2YURA 3PURA 3RPGC 5KH9A 2YW8A 5FB1A 3U5NA 4MVTA 3V43A 3RPGB 4YBMA 3SOWA 5H1VA 2NAAA 5TABA 2ECWA 3O36A 5B78A 2YU4A 1RMDA 3SOXA 3KV6A 1JM7A 3EB6A 2LDRA 4LKAA 2MIQA 2UZGA 2CSYA 2LGGA 4IC3A 2LRIC 2DX8A 1WEVA 1WEWA 3M62A 2K4DA 3ASLA 4AUQB 5AIUA 5C13A 1G25A 4GB0A 4WA6A 1F62A 4GNGA 5AITA 4PTBA 4IC2A 3T7LA 4GNFA 3O33A 4AYCA 2KWJA 5JG6A 4X3GA 2LGVA 3N9OA 2L43A 2KFTA 2RI7A 3O34A 2VJEA 2YQMA 4GNDA 4BHWA 4TKPB 5G0FA 1E4UA 2XB1A 3ZVZB 4FK5A 3O7AA 2LXPC 3ZPVE 2F6JA 2KU3A 4MSXA 2FUUA 2C2VS 4O64A 3U5PA 3LRQA 3N9LA 4XI1A 4C9ZA 2JRJA 2G6QA 2ECNA 1T1HA 4LK9A 1X4UA 2H0DA 2EA6A 2HYED 4QF3A 5FEYA 1X4IA 1JOCA 2MD7B 3ZVYA 2L5UA 2BAYA 2RSDA 3O35A 3L11A 1N87A 5J3XA 5TDRA 2KWOA 4AP4A 4I7DA 1CHCA 4F52B 2ECVA 2MNYA 2KYUA 1LDJB 5H1TA 4P5OB 3O37A 3LQIA 1Z60A 2VPDA 5DINA 2FSAA 5TBNA 1DVPA 2D8SA 2G45A 4FIPA 3HTKC 2HDPA 2CKLA 3N9QA 4I7BA 2QJ0A 2MUMA 2QICA 1LDKC 2K16A 4B7YC 4ZUXU 3HCSA 2EODA 5C11A 1WESA 4AYCB 3GL6A 2MA6A 3IHPA 2KE1A 3ZTGA 2LQ6A 2M1RA 2YHNA 2I50A 3PHDA 4A49A 3QZVA 1FP0A 2AN6A 1VYXA 4L58A 2JMJA 4R8PK 2JMDA 3DPLR 2CSZA 1FBVA 4LADB 2EGPA 2G43A 3C5KA 4UP5A 5H9MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H0D B;  1ZBD B;  2VNF A;  1Z2Q A;  3N9N A;  2OXQ C;  3SOU A;  5KH3 A;  2KGI A;  2KRE A;  4YAX A;  5B77 A;  5TDW A;  2M3H A;  3U5O A;  3RTR B;  3VK6 A;  4V3K C;  2ECJ A;  5B76 A;  5I3L A;  2ECI A;  5FB0 A;  1VD4 A;  2FUI A;  2L75 A;  2YUC A;  4S3O B;  3ZPV 1;  1WEQ A;  2VJF B;  3FL2 A;  4L7X A;  2LV9 A;  3I2D A;  4I7C A;  3HCT A;  4UI9 B;  4R2Y A;  5B75 A;  5EYA F;  1WEO A;  3LQH A;  5G05 B;  3EB5 A;  2YQL A;  2KWN A;  3N9M A;  1K2F A;  2YT5 A;  3GV4 A;  1WEE A;  1MM2 A;  2KWK A;  2VPB A;  2CT2 A;  2K1J A;  2YHO A;  1JM7 B;  1BOR A;  5LKX A;  2YSJ A;  2ECG A;  2KGG A;  3DQV R;  4ZQL A;  3KNV A;  2ECT A;  4A4B A;  1Z6U A;  2C2L A;  2IDA A;  2L80 A;  1HYJ A;  2Y1N A;  5LKT A;  3HCU A;  4QF2 A;  5B79 A;  5H1U A;  2M85 A;  2LGK A;  2MA5 A;  2KIZ A;  4FJC A;  4W4U A;  2LXH C;  4Q6F A;  5DKA A;  4PPE A;  5TRB A;  3L1Z B;  4GNE A;  3MHH A;  1WEN A;  4WZ0 A;  2VJE B;  1U6G B;  5D1M B;  3NG2 A;  3KV5 A;  3PUQ A;  2QIZ A;  5KH7 A;  4WZ2 A;  1XWH A;  2E6S A;  1WIM A;  2L0B A;  3T6R A;  4LJN A;  5B8D A;  5G04 B;  2VP7 A;  2JMI A;  4ZDT A;  2MT5 A;  4CCG X;  3SHB A;  1WGM A;  4B86 C;  4V3L C;  5D1K B;  4YC9 A;  4YBT A;  4WZ3 B;  1MM3 A;  1VFY A;  1WFK A;  5LCW B;  4AVX A;  2Y43 A;  4LLB A;  4YAT A;  1V87 A;  1WEU A;  3M63 A;  1WE9 A;  4S3O C;  3MHS A;  1WEP A;  4R7E A;  4A4C A;  3N9P A;  2M6M A;  3U5M A;  3L1X A;  5FER A;  4N4F A;  4YAD A;  2PNX A;  2VPG A;  4NN2 A;  2YRE A;  4YAB A;  2MD8 C;  5LKZ A;  4CA1 A;  2K17 A;  1WIL A;  1X4J A;  2F6N A;  3ZYQ A;  2ZET C;  2LGL A;  2CKL B;  3KQI A;  4FO9 A;  2MNZ A;  5D1L B;  4BBQ A;  2YSM A;  2F42 A;  4N3W A;  3M99 A;  2KR4 A;  2XEU A;  3ZNI A;  4A0C D;  2E6R A;  3LQJ A;  2YYR A;  3O70 A;  5LKU A;  1IYM A;  2Y1M A;  2LN0 A;  1WEM A;  2PUY A;  2VJF A;  1HYI A;  4UP0 A;  2VPE A;  3C6W A;  4YBS A;  2YUR A;  3PUR A;  3RPG C;  5KH9 A;  2YW8 A;  5FB1 A;  3U5N A;  4MVT A;  3V43 A;  3RPG B;  4YBM A;  3SOW A;  5H1V A;  2NAA A;  5TAB A;  2ECW A;  3O36 A;  5B78 A;  2YU4 A;  1RMD A;  3SOX A;  3KV6 A;  1JM7 A;  3EB6 A;  2LDR A;  4LKA A;  2MIQ A;  2UZG A;  2CSY A;  2LGG A;  4IC3 A;  2LRI C;  2DX8 A;  1WEV A;  1WEW A;  3M62 A;  2K4D A;  3ASL A;  4AUQ B;  5AIU A;  5C13 A;  1G25 A;  4GB0 A;  4WA6 A;  1F62 A;  4GNG A;  5AIT A;  4PTB A;  4IC2 A;  3T7L A;  4GNF A;  3O33 A;  4AYC A;  2KWJ A;  5JG6 A;  4X3G A;  2LGV A;  3N9O A;  2L43 A;  2KFT A;  2RI7 A;  3O34 A;  2VJE A;  2YQM A;  4GND A;  4BHW A;  4TKP B;  5G0F A;  1E4U A;  2XB1 A;  3ZVZ B;  4FK5 A;  3O7A A;  2LXP C;  3ZPV E;  2F6J A;  2KU3 A;  4MSX A;  2FUU A;  2C2V S;  4O64 A;  3U5P A;  3LRQ A;  3N9L A;  4XI1 A;  4C9Z A;  2JRJ A;  2G6Q A;  2ECN A;  1T1H A;  4LK9 A;  1X4U A;  2H0D A;  2EA6 A;  2HYE D;  4QF3 A;  5FEY A;  1X4I A;  1JOC A;  2MD7 B;  3ZVY A;  2L5U A;  2BAY A;  2RSD A;  3O35 A;  3L11 A;  1N87 A;  5J3X A;  5TDR A;  2KWO A;  4AP4 A;  4I7D A;  1CHC A;  4F52 B;  2ECV A;  2MNY A;  2KYU A;  1LDJ B;  5H1T A;  4P5O B;  3O37 A;  3LQI A;  1Z60 A;  2VPD A;  5DIN A;  2FSA A;  5TBN A;  1DVP A;  2D8S A;  2G45 A;  4FIP A;  3HTK C;  2HDP A;  2CKL A;  3N9Q A;  4I7B A;  2QJ0 A;  2MUM A;  2QIC A;  1LDK C;  2K16 A;  4B7Y C;  4ZUX U;  3HCS A;  2EOD A;  5C11 A;  1WES A;  4AYC B;  3GL6 A;  2MA6 A;  3IHP A;  2KE1 A;  3ZTG A;  2LQ6 A;  2M1R A;  2YHN A;  2I50 A;  3PHD A;  4A49 A;  3QZV A;  1FP0 A;  2AN6 A;  1VYX A;  4L58 A;  2JMJ A;  4R8P K;  2JMD A;  3DPL R;  2CSZ A;  1FBV A;  4LAD B;  2EGP A;  2G43 A;  3C5K A;  4UP5 A;  5H9M A; 
#chains in the Genus database with same CATH topology
 2H0D B;  3PLW A;  1ZBD B;  2VNF A;  1Z2Q A;  3N9N A;  2E61 A;  2OXQ C;  3SOU A;  5KH3 A;  2KGI A;  2KRE A;  4YAX A;  5B77 A;  5TDW A;  1MBM A;  2M3H A;  3U5O A;  3RTR B;  2CSV A;  3VK6 A;  2IQJ A;  4V3K C;  2ECJ A;  5B76 A;  5I3L A;  2ECI A;  5FB0 A;  1VD4 A;  2FUI A;  2L75 A;  2YUC A;  4S3O B;  2RR4 A;  2CRW A;  3ZPV 1;  1WEQ A;  2VJF B;  3FL2 A;  4L7X A;  2LV9 A;  3I2D A;  4I7C A;  3HCT A;  4UI9 B;  4R2Y A;  5B75 A;  5EYA F;  1WEO A;  3LQH A;  5G05 B;  3EB5 A;  2YQL A;  2KWN A;  3N9M A;  2P57 A;  1K2F A;  2YT5 A;  3GV4 A;  1WEE A;  1MM2 A;  2KWK A;  3FAO A;  2VPB A;  2CT2 A;  2K1J A;  2YHO A;  4Z0R A;  1JM7 B;  1BOR A;  5LKX A;  2YSJ A;  2ECG A;  2KGG A;  3DQV R;  4ZQL A;  3KNV A;  2ECT A;  4A4B A;  1Z6U A;  2C2L A;  2IDA A;  2L80 A;  1HYJ A;  2Y1N A;  5LKT A;  3HCU A;  4QF2 A;  5B79 A;  5H1U A;  2M85 A;  2LGK A;  2MA5 A;  2KIZ A;  4FJC A;  2XP0 A;  2MKE A;  4W4U A;  2LXH C;  4Q6F A;  5DKA A;  4PPE A;  5TRB A;  3L1Z B;  4GNE A;  3MHH A;  1WEN A;  4WZ0 A;  2VJE B;  1U6G B;  5D1M B;  3NG2 A;  2CON A;  3KV5 A;  3PUQ A;  2QIZ A;  5KH7 A;  4WZ2 A;  1XWH A;  2L7P A;  2E6S A;  1WIM A;  3KDE C;  2L0B A;  2XOC A;  4O62 A;  3T6R A;  2B0O E;  4LJN A;  5B8D A;  5G04 B;  2VP7 A;  2JMI A;  4ZDT A;  2MT5 A;  4CCG X;  3SHB A;  1WGM A;  4B86 C;  4V3L C;  5D1K B;  4YC9 A;  4YBT A;  4WZ3 B;  1MM3 A;  1VFY A;  1WFK A;  5LCW B;  4AVX A;  2Y43 A;  2JUN A;  4LLB A;  4QQ4 A;  4YAT A;  1V87 A;  1WEU A;  3M63 A;  1WE9 A;  4S3O C;  3MHS A;  1WEP A;  4R7E A;  4A4C A;  3N9P A;  2M6M A;  3U5M A;  3L1X A;  3SUB A;  5FER A;  4N4F A;  3T9K A;  4YAD A;  2PNX A;  2VPG A;  4NN2 A;  2YRE A;  4YAB A;  2MD8 C;  5LKZ A;  5SVY A;  4CA1 A;  2K17 A;  1WIL A;  1X4J A;  2F6N A;  4OGC A;  3ZYQ A;  2ZET C;  2LGL A;  2CKL B;  5SVX A;  3KQI A;  4FO9 A;  2MNZ A;  5D1L B;  2CRR A;  4BBQ A;  2YSM A;  2F42 A;  4N3W A;  2KKX A;  3M99 A;  2KR4 A;  2XEU A;  2FD4 A;  3ZNI A;  4A0C D;  2E6R A;  3LQJ A;  2YYR A;  3O70 A;  5LKU A;  3Q1D A;  1IYM A;  2Y1M A;  2LN0 A;  1WEM A;  3MDB C;  2EGM A;  2PUY A;  2VJF A;  1HYI A;  3FAN A;  4UP0 A;  2VPE A;  3C6W A;  4YBS A;  4H9D A;  2YUR A;  3PUR A;  3RPG C;  5KH9 A;  2YW8 A;  5FB1 A;  3O47 A;  3U5N A;  4MVT A;  3V43 A;  3RPG B;  4YBM A;  2XOY A;  3SOW A;  5H1V A;  2NAA A;  5TAB A;  2ECW A;  3O36 A;  5B78 A;  2YU4 A;  1RMD A;  3SOX A;  3LVQ E;  2XOZ A;  3KV6 A;  1JM7 A;  3EB6 A;  2LDR A;  4LKA A;  3LJU X;  2MIQ A;  2UZG A;  2CSY A;  2LGG A;  5SVI A;  3FEH A;  4IC3 A;  2LRI C;  2DX8 A;  1WEV A;  1WEW A;  3M62 A;  2K4D A;  3ASL A;  4F1P A;  3FM8 C;  4AUQ B;  5AIU A;  5C13 A;  1G25 A;  4GB0 A;  2DSM A;  4WA6 A;  3E2D A;  3LDY A;  1F62 A;  4GNG A;  5AIT A;  4PTB A;  4IC2 A;  3T7L A;  4GNF A;  3O33 A;  4AYC A;  2KWJ A;  2M13 A;  5JG6 A;  4X3G A;  2LGV A;  3N9O A;  2L43 A;  2KFT A;  2RI7 A;  3O34 A;  3FJU B;  2EXU A;  2VJE A;  2YQM A;  4GND A;  4BHW A;  4TKP B;  5G0F A;  1E4U A;  2XB1 A;  3ZVZ B;  4FK5 A;  3O7A A;  2LXP C;  3ZPV E;  2F6J A;  2KU3 A;  3DWD A;  4MSX A;  2FUU A;  2C2V S;  4O64 A;  4Z0O A;  3U5P A;  3LRQ A;  3N9L A;  4XI1 A;  3DDT A;  4C9Z A;  2JRJ A;  2G6Q A;  2ECN A;  1T1H A;  3M7K A;  4LK9 A;  1X4U A;  2H0D A;  2EA6 A;  2KKY A;  2HYE D;  4QF3 A;  5FEY A;  1X4I A;  1JOC A;  2MD7 B;  3ZVY A;  2D8U A;  2L5U A;  2BAY A;  2RSD A;  3O35 A;  2OWA A;  3L11 A;  1N87 A;  5J3X A;  5TDR A;  2KWO A;  4AP4 A;  4I7D A;  1CHC A;  4F52 B;  2ECV A;  2MNY A;  2DJA A;  2KYU A;  1LDJ B;  5H1T A;  5SVI B;  4P5O B;  3O37 A;  3LQI A;  1Z60 A;  2VPD A;  5DIN A;  2FSA A;  5TBN A;  1DVP A;  2D8S A;  2G45 A;  4FIP A;  3HTK C;  2CKL A;  2HDP A;  3N9Q A;  4I7B A;  5K3Q A;  2QJ0 A;  2MUM A;  2QIC A;  1LDK C;  2K16 A;  4B7Y C;  4ZUX U;  3HCS A;  2EOD A;  1DCQ A;  5C11 A;  1WES A;  2FFW A;  4AYC B;  2LAU A;  3GL6 A;  2MA6 A;  3IHP A;  2KE1 A;  3ZTG A;  2LQ6 A;  2M1R A;  2YHN A;  2I50 A;  3PHD A;  4A49 A;  3QZV A;  1FP0 A;  2AN6 A;  1VYX A;  4OGE A;  4L58 A;  3LVR E;  2JMJ A;  4R8P K;  2YVR A;  2JMD A;  3JUE A;  3DPL R;  2JM3 A;  2CSZ A;  1FBV A;  4LAD B;  2EGP A;  2G43 A;  3C5K A;  4UP5 A;  3H7H A;  5H9M A; 
#chains in the Genus database with same CATH homology
 2H0D B;  1ZBD B;  2VNF A;  1Z2Q A;  3N9N A;  2OXQ C;  3SOU A;  5KH3 A;  2KGI A;  2KRE A;  4YAX A;  5B77 A;  5TDW A;  2M3H A;  3U5O A;  3RTR B;  3VK6 A;  4V3K C;  2ECJ A;  5B76 A;  5I3L A;  2ECI A;  5FB0 A;  1VD4 A;  2FUI A;  2L75 A;  2YUC A;  4S3O B;  3ZPV 1;  1WEQ A;  2VJF B;  3FL2 A;  4L7X A;  2LV9 A;  3I2D A;  4I7C A;  3HCT A;  4UI9 B;  4R2Y A;  5B75 A;  5EYA F;  1WEO A;  3LQH A;  5G05 B;  3EB5 A;  2YQL A;  2KWN A;  3N9M A;  1K2F A;  2YT5 A;  3GV4 A;  1WEE A;  1MM2 A;  2KWK A;  2VPB A;  2CT2 A;  2K1J A;  2YHO A;  1JM7 B;  1BOR A;  5LKX A;  2YSJ A;  2ECG A;  2KGG A;  3DQV R;  4ZQL A;  3KNV A;  2ECT A;  4A4B A;  1Z6U A;  2C2L A;  2IDA A;  2L80 A;  1HYJ A;  2Y1N A;  5LKT A;  3HCU A;  4QF2 A;  5B79 A;  5H1U A;  2M85 A;  2LGK A;  2MA5 A;  2KIZ A;  4FJC A;  4W4U A;  2LXH C;  4Q6F A;  5DKA A;  4PPE A;  5TRB A;  3L1Z B;  4GNE A;  3MHH A;  1WEN A;  4WZ0 A;  2VJE B;  1U6G B;  5D1M B;  3NG2 A;  3KV5 A;  3PUQ A;  2QIZ A;  5KH7 A;  4WZ2 A;  1XWH A;  2E6S A;  1WIM A;  2L0B A;  3T6R A;  4LJN A;  5B8D A;  5G04 B;  2VP7 A;  2JMI A;  4ZDT A;  2MT5 A;  4CCG X;  3SHB A;  1WGM A;  4B86 C;  4V3L C;  5D1K B;  4YC9 A;  4YBT A;  4WZ3 B;  1MM3 A;  1VFY A;  1WFK A;  5LCW B;  4AVX A;  2Y43 A;  4LLB A;  4YAT A;  1V87 A;  1WEU A;  3M63 A;  1WE9 A;  4S3O C;  3MHS A;  1WEP A;  4R7E A;  4A4C A;  3N9P A;  2M6M A;  3U5M A;  3L1X A;  5FER A;  4N4F A;  4YAD A;  2PNX A;  2VPG A;  4NN2 A;  2YRE A;  4YAB A;  2MD8 C;  5LKZ A;  4CA1 A;  2K17 A;  1WIL A;  1X4J A;  2F6N A;  3ZYQ A;  2ZET C;  2LGL A;  2CKL B;  3KQI A;  4FO9 A;  2MNZ A;  5D1L B;  4BBQ A;  2YSM A;  2F42 A;  4N3W A;  3M99 A;  2KR4 A;  2XEU A;  3ZNI A;  4A0C D;  2E6R A;  3LQJ A;  2YYR A;  3O70 A;  5LKU A;  1IYM A;  2Y1M A;  2LN0 A;  1WEM A;  2PUY A;  2VJF A;  1HYI A;  4UP0 A;  2VPE A;  3C6W A;  4YBS A;  2YUR A;  3PUR A;  3RPG C;  5KH9 A;  2YW8 A;  5FB1 A;  3U5N A;  4MVT A;  3V43 A;  3RPG B;  4YBM A;  3SOW A;  5H1V A;  2NAA A;  5TAB A;  2ECW A;  3O36 A;  5B78 A;  2YU4 A;  1RMD A;  3SOX A;  3KV6 A;  1JM7 A;  3EB6 A;  2LDR A;  4LKA A;  2MIQ A;  2UZG A;  2CSY A;  2LGG A;  4IC3 A;  2LRI C;  2DX8 A;  1WEV A;  1WEW A;  3M62 A;  2K4D A;  3ASL A;  4AUQ B;  5AIU A;  5C13 A;  1G25 A;  4GB0 A;  4WA6 A;  1F62 A;  4GNG A;  5AIT A;  4PTB A;  4IC2 A;  3T7L A;  4GNF A;  3O33 A;  4AYC A;  2KWJ A;  5JG6 A;  4X3G A;  2LGV A;  3N9O A;  2L43 A;  2KFT A;  2RI7 A;  3O34 A;  2VJE A;  2YQM A;  4GND A;  4BHW A;  4TKP B;  5G0F A;  1E4U A;  2XB1 A;  3ZVZ B;  4FK5 A;  3O7A A;  2LXP C;  3ZPV E;  2F6J A;  2KU3 A;  4MSX A;  2FUU A;  2C2V S;  4O64 A;  3U5P A;  3LRQ A;  3N9L A;  4XI1 A;  4C9Z A;  2JRJ A;  2G6Q A;  2ECN A;  1T1H A;  4LK9 A;  1X4U A;  2H0D A;  2EA6 A;  2HYE D;  4QF3 A;  5FEY A;  1X4I A;  1JOC A;  2MD7 B;  3ZVY A;  2L5U A;  2BAY A;  2RSD A;  3O35 A;  3L11 A;  1N87 A;  5J3X A;  5TDR A;  2KWO A;  4AP4 A;  4I7D A;  1CHC A;  4F52 B;  2ECV A;  2MNY A;  2KYU A;  1LDJ B;  5H1T A;  4P5O B;  3O37 A;  3LQI A;  1Z60 A;  2VPD A;  5DIN A;  2FSA A;  5TBN A;  1DVP A;  2D8S A;  2G45 A;  4FIP A;  3HTK C;  2HDP A;  2CKL A;  3N9Q A;  4I7B A;  2QJ0 A;  2MUM A;  2QIC A;  1LDK C;  2K16 A;  4B7Y C;  4ZUX U;  3HCS A;  2EOD A;  5C11 A;  1WES A;  4AYC B;  3GL6 A;  2MA6 A;  3IHP A;  2KE1 A;  3ZTG A;  2LQ6 A;  2M1R A;  2YHN A;  2I50 A;  3PHD A;  4A49 A;  3QZV A;  1FP0 A;  2AN6 A;  1VYX A;  4L58 A;  2JMJ A;  4R8P K;  2JMD A;  3DPL R;  2CSZ A;  1FBV A;  4LAD B;  2EGP A;  2G43 A;  3C5K A;  4UP5 A;  5H9M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...