2K17A

Solution structure of the taf3 phd domain in complex with a h3k4me3 peptide
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
75
structure length
75
Chain Sequence
GSHMAMAYVIRDEWGNQIWICPGCNKPDDGSPMIGCDDCDDWYHWPCVGIMAAPPEEMQWFCPKCANKIKKDKKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Recognition of the H3K4me3 mark by the TAF3-PHD finger
rcsb
source organism Mus musculus
molecule tags Transcription
molecule keywords H3K4me3 peptide
total genus 10
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2008-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2k17A00
2LXPC 4GNDA 1WEWA 3M62A 3I2DA 1WILA 5LKTA 4FO9A 3U5OA 4YBSA 5H9MA 2CKLA 3U5NA 2G6QA 3U5PA 4A0CD 1MM2A 5I3LA 2LN0A 3C5KA 4GB0A 2DX8A 1N87A 3QZVA 3KQIA 2PNXA 3N9NA 2JMDA 5FB0A 3RTRB 1WENA 5G04B 3ASLA 4W4UA 4I7DA 2VPDA 2ECGA 1ZBDB 1T1HA 2JMIA 2VPGA 2FSAA 3PURA 4S3OC 2I50A 3SHBA 3HCUA 2M3HA 1LDKC 4TKPB 1RMDA 2PUYA 5AIUA 3MHSA 1HYIA 2OXQC 2KWKA 3IHPA 3L1ZB 5KH3A 5TDWA 2XEUA 3ZPVE 3EB5A 1WEPA 2ECVA 3ZYQA 2KWOA 1VYXA 3ZNIA 3M99A 4O64A 4R8PK 3PHDA 4NN2A 1K2FA 2YHNA 3FL2A 1FBVA 2HYED 4MSXA 4AP4A 3ZPV1 5FB1A 3SOUA 4UI9B 5FEYA 2YYRA 2L75A 4S3OB 2F6JA 4AYCA 1WE9A 2VPEA 2YUCA 4XI1A 1BORA 4QF3A 2AN6A 2ECNA 5D1MB 4WZ3B 2ZETC 2K4DA 4BHWA 3DPLR 4A4CA 5D1LB 2F6NA 1MM3A 2D8SA 2CT2A 4CCGX 1IYMA 2YU4A 1VFYA 1WEMA 3RPGB 2LGGA 3O7AA 4P5OB 2E6SA 2M1RA 3GV4A 1JM7A 4MVTA 5B77A 3DQVR 2RI7A 5B8DA 2KWNA 2JRJA 4GNGA 5H1UA 2VNFA 2L43A 5B76A 3N9OA 1DVPA 1VD4A 2LRIC 5LKXA 1G25A 3SOWA 5G0FA 1X4UA 2KGIA 2LGVA 4IC2A 4ZQLA 2LV9A 2C2VS 3KV6A 4GNFA 4UP0A 5D1KB 3V43A 2MIQA 2QJ0A 2L80A 4LJNA 4FJCA 4AVXA 2F42A 4B7YC 2CSZA 4YATA 5KH7A 2HDPA 2XB1A 5C13A 4N3WA 2Y1NA 3O35A 4Q6FA 2C2LA 2YSMA 5LKUA 2FUIA 4PPEA 2RSDA 2KYUA 2EA6A 1WESA 4ZDTA 2BAYA 1WEOA 2ECWA 4YBTA 3ZTGA 1WEQA 3L11A 3LQHA 4BBQA 3T7LA 2CSYA 3N9LA 2KGGA 2FUUA 3KV5A 1X4JA 3PUQA 4WZ2A 1WFKA 2YT5A 4LK9A 4FK5A 3T6RA 2YW8A 3N9QA 4C9ZA 4LADB 4I7CA 4LKAA 2YURA 2VJEB 3O70A 2VPBA 5TABA 2MT5A 4YABA 3N9PA 1FP0A 2YHOA 5DINA 5LKZA 3U5MA 1WEEA 2H0DA 2KR4A 3EB6A 2L5UA 5B75A 5EYAF 3LRQA 4CA1A 2LDRA 3O36A 2MNZA 2YREA 2KIZA 1HYJA 2H0DB 1F62A 2VJFB 2YQMA 2KE1A 3LQIA 5J3XA 2VP7A 2M85A 4N4FA 2LQ6A 4QF2A 3VK6A 4YAXA 4F52B 4YADA 2L0BA 2VJFA 2ECIA 2KFTA 3HTKC 1Z6UA 3MHHA 5JG6A 2G43A 4FIPA 3ZVYA 5B78A 1XWHA 3SOXA 2YSJA 3N9MA 5H1TA 3O33A 5B79A 4AYCB 1Z2QA 4YBMA 5TBNA 4IC3A 2QICA 3HCTA 1V87A 1X4IA 3KNVA 4X3GA 2VJEA 1WIMA 4PTBA 2JMJA 1JM7B 3LQJA 3M63A 5H1VA 5AITA 2IDAA 5DKAA 2EGPA 4R2YA 1WGMA 2K16A 3GL6A 4WA6A 3C6WA 2Y43A 4L7XA 2Y1MA 2LGKA 4R7EA 3O37A 2QIZA 5TDRA 1JOCA 4LLBA 2MUMA 2NAAA 5KH9A 2KREA 3ZVZB 2MA6A 1U6GB 1CHCA 2E6RA 1Z60A 2ECTA 3L1XA 5TRBA 1E4UA 2YQLA 4UP5A 4GNEA 4I7BA 4WZ0A 4A4BA 5G05B 2K1JA 1LDJB 2K17A 5C11A 2KU3A 4V3LC 4V3KC 2CKLB 2MA5A 1WEVA 3RPGC 4ZUXU 5LCWB 1WEUA 2M6MA 2LXHC 4L58A 2MD8C 4YC9A 2MD7B 3O34A 2EODA 4AUQB 2UZGA 4A49A 3HCSA 2MNYA 2ECJA 2LGLA 2G45A 4B86C 3NG2A 5FERA 2KWJA
chains in the Genus database with same CATH superfamily
2LXPC 4GNDA 3E2DA 1WEWA 3M62A 3I2DA 1WILA 3O47A 5LKTA 4FO9A 3U5OA 4YBSA 5H9MA 2CKLA 3U5NA 2G6QA 3U5PA 4A0CD 1MM2A 5I3LA 2LN0A 3C5KA 4GB0A 2DX8A 1N87A 3T9KA 3QZVA 3KQIA 2PNXA 3N9NA 2JMDA 5FB0A 3RTRB 1WENA 5G04B 3ASLA 4W4UA 4I7DA 2VPDA 2ECGA 1ZBDB 4QQ4A 2DJAA 1T1HA 2JMIA 2VPGA 2JM3A 4Z0RA 2FSAA 3PURA 4S3OC 2I50A 3SHBA 2EGMA 3HCUA 2M3HA 3DWDA 1LDKC 4TKPB 2YVRA 1RMDA 2PUYA 5AIUA 3MHSA 1HYIA 2OXQC 2KWKA 3IHPA 3L1ZB 5KH3A 5TDWA 2XEUA 3ZPVE 3EB5A 1WEPA 2ECVA 3ZYQA 2KWOA 1VYXA 4O64A 3M99A 3ZNIA 4F1PA 2D8UA 4R8PK 3PHDA 4NN2A 1K2FA 3LJUX 2YHNA 3FL2A 1FBVA 2HYED 4MSXA 4AP4A 3Q1DA 3ZPV1 5FB1A 3SOUA 4UI9B 5FEYA 2YYRA 2L75A 4S3OB 2F6JA 2FFWA 3FM8C 4AYCA 1WE9A 2VPEA 2YUCA 2EXUA 2XP0A 4XI1A 1BORA 4QF3A 2AN6A 3LVQE 2ECNA 5D1MB 4WZ3B 2ZETC 2K4DA 5SVYA 4BHWA 2M13A 3DPLR 4A4CA 5D1LB 2F6NA 1MM3A 2D8SA 2CT2A 4CCGX 1IYMA 2YU4A 3FEHA 1VFYA 1WEMA 3RPGB 2LGGA 3O7AA 4P5OB 2E6SA 2M1RA 3GV4A 1JM7A 4MVTA 5B77A 3DQVR 2RI7A 5B8DA 3DDTA 2KWNA 2JRJA 4GNGA 5H1UA 3KDEC 2VNFA 2CRRA 2L43A 5B76A 3N9OA 1DVPA 1VD4A 2LRIC 5LKXA 1G25A 4O62A 3SOWA 5G0FA 1X4UA 2KGIA 2LGVA 2OWAA 4IC2A 4ZQLA 2LV9A 2C2VS 3KV6A 2P57A 4GNFA 5SVIB 4UP0A 1DCQA 5D1KB 3V43A 2MIQA 2QJ0A 2L80A 4LJNA 4FJCA 4AVXA 2F42A 4B7YC 3JUEA 2CSZA 4YATA 5KH7A 2HDPA 2XB1A 5C13A 4N3WA 2Y1NA 3O35A 4Q6FA 2C2LA 2YSMA 5LKUA 2FUIA 4PPEA 2RSDA 2KYUA 2EA6A 1WESA 4ZDTA 3FANA 2BAYA 1WEOA 2ECWA 4YBTA 3ZTGA 1WEQA 3L11A 3LQHA 4BBQA 3T7LA 2CSYA 3N9LA 2KGGA 3MDBC 2FUUA 3KV5A 1X4JA 3PUQA 4WZ2A 1WFKA 2YT5A 4LK9A 4FK5A 3T6RA 2YW8A 4OGCA 3N9QA 4C9ZA 4LADB 4I7CA 4LKAA 2YURA 2VJEB 3O70A 2VPBA 5TABA 2XOYA 2MT5A 4YABA 4H9DA 3N9PA 1FP0A 2YHOA 5DINA 5LKZA 3U5MA 1WEEA 2H0DA 2KR4A 3EB6A 2CRWA 2L5UA 5B75A 5EYAF 3LRQA 4CA1A 2LDRA 3O36A 2MKEA 2CONA 2MNZA 2YREA 2KIZA 1HYJA 2H0DB 1F62A 2KKYA 2VJFB 2YQMA 2KE1A 5K3QA 3LQIA 5J3XA 2FD4A 2VP7A 2M85A 4N4FA 2LQ6A 2XOZA 4QF2A 3VK6A 4YAXA 4F52B 4YADA 2B0OE 2L0BA 2CSVA 2VJFA 2ECIA 3FJUB 2KFTA 3HTKC 1Z6UA 3MHHA 5JG6A 2G43A 4FIPA 3ZVYA 5B78A 1XWHA 3SOXA 2YSJA 3M7KA 3N9MA 5H1TA 2XOCA 3O33A 5B79A 4AYCB 1Z2QA 4YBMA 5TBNA 4IC3A 2QICA 3HCTA 1V87A 1X4IA 3KNVA 4X3GA 2VJEA 1WIMA 2LAUA 4PTBA 2JMJA 1JM7B 3LQJA 3M63A 5H1VA 5AITA 2IDAA 5DKAA 4OGEA 2EGPA 4R2YA 1WGMA 2K16A 3GL6A 4WA6A 2RR4A 3C6WA 2Y43A 4L7XA 1MBMA 2Y1MA 2LGKA 3FAOA 5SVIA 4R7EA 3O37A 2QIZA 2L7PA 5TDRA 3LVRE 1JOCA 5SVXA 4LLBA 2MUMA 2NAAA 5KH9A 2JUNA 2KKXA 2KREA 3ZVZB 2MA6A 1U6GB 1CHCA 3SUBA 2E6RA 1Z60A 2ECTA 3L1XA 5TRBA 1E4UA 2DSMA 2YQLA 4UP5A 4GNEA 4I7BA 4WZ0A 4A4BA 5G05B 1LDJB 2K1JA 2K17A 3H7HA 5C11A 2KU3A 4V3LC 4V3KC 2CKLB 2MA5A 1WEVA 3RPGC 4ZUXU 5LCWB 1WEUA 2M6MA 2LXHC 4L58A 2IQJA 2MD8C 4YC9A 2MD7B 3LDYA 3O34A 2E61A 4Z0OA 2EODA 4AUQB 2UZGA 3PLWA 4A49A 3HCSA 2MNYA 2ECJA 2LGLA 2G45A 4B86C 3NG2A 5FERA 2KWJA
chains in the Genus database with same CATH topology
2LXPC 4GNDA 1WEWA 3M62A 3I2DA 1WILA 5LKTA 4FO9A 3U5OA 4YBSA 5H9MA 2CKLA 3U5NA 2G6QA 3U5PA 4A0CD 1MM2A 5I3LA 2LN0A 3C5KA 4GB0A 2DX8A 1N87A 3QZVA 3KQIA 2PNXA 3N9NA 2JMDA 5FB0A 3RTRB 1WENA 5G04B 3ASLA 4W4UA 4I7DA 2VPDA 2ECGA 1ZBDB 1T1HA 2JMIA 2VPGA 2FSAA 3PURA 4S3OC 2I50A 3SHBA 3HCUA 2M3HA 1LDKC 4TKPB 1RMDA 2PUYA 5AIUA 3MHSA 1HYIA 2OXQC 2KWKA 3IHPA 3L1ZB 5KH3A 5TDWA 2XEUA 3ZPVE 3EB5A 1WEPA 2ECVA 3ZYQA 2KWOA 1VYXA 3ZNIA 3M99A 4O64A 4R8PK 3PHDA 4NN2A 1K2FA 2YHNA 3FL2A 1FBVA 2HYED 4MSXA 4AP4A 3ZPV1 5FB1A 3SOUA 4UI9B 5FEYA 2YYRA 2L75A 4S3OB 2F6JA 4AYCA 1WE9A 2VPEA 2YUCA 4XI1A 1BORA 4QF3A 2AN6A 2ECNA 5D1MB 4WZ3B 2ZETC 2K4DA 4BHWA 3DPLR 4A4CA 5D1LB 2F6NA 1MM3A 2D8SA 2CT2A 4CCGX 1IYMA 2YU4A 1VFYA 1WEMA 3RPGB 2LGGA 3O7AA 4P5OB 2E6SA 2M1RA 3GV4A 1JM7A 4MVTA 5B77A 3DQVR 2RI7A 5B8DA 2KWNA 2JRJA 4GNGA 5H1UA 2VNFA 2L43A 5B76A 3N9OA 1DVPA 1VD4A 2LRIC 5LKXA 1G25A 3SOWA 5G0FA 1X4UA 2KGIA 2LGVA 4IC2A 4ZQLA 2LV9A 2C2VS 3KV6A 4GNFA 4UP0A 5D1KB 3V43A 2MIQA 2QJ0A 2L80A 4LJNA 4FJCA 4AVXA 2F42A 4B7YC 2CSZA 4YATA 5KH7A 2HDPA 2XB1A 5C13A 4N3WA 2Y1NA 3O35A 4Q6FA 2C2LA 2YSMA 5LKUA 2FUIA 4PPEA 2RSDA 2KYUA 2EA6A 1WESA 4ZDTA 2BAYA 1WEOA 2ECWA 4YBTA 3ZTGA 1WEQA 3L11A 3LQHA 4BBQA 3T7LA 2CSYA 3N9LA 2KGGA 2FUUA 3KV5A 1X4JA 3PUQA 4WZ2A 1WFKA 2YT5A 4LK9A 4FK5A 3T6RA 2YW8A 3N9QA 4C9ZA 4LADB 4I7CA 4LKAA 2YURA 2VJEB 3O70A 2VPBA 5TABA 2MT5A 4YABA 3N9PA 1FP0A 2YHOA 5DINA 5LKZA 3U5MA 1WEEA 2H0DA 2KR4A 3EB6A 2L5UA 5B75A 5EYAF 3LRQA 4CA1A 2LDRA 3O36A 2MNZA 2YREA 2KIZA 1HYJA 2H0DB 1F62A 2VJFB 2YQMA 2KE1A 3LQIA 5J3XA 2VP7A 2M85A 4N4FA 2LQ6A 4QF2A 3VK6A 4YAXA 4F52B 4YADA 2L0BA 2VJFA 2ECIA 2KFTA 3HTKC 1Z6UA 3MHHA 5JG6A 2G43A 4FIPA 3ZVYA 5B78A 1XWHA 3SOXA 2YSJA 3N9MA 5H1TA 3O33A 5B79A 4AYCB 1Z2QA 4YBMA 5TBNA 4IC3A 2QICA 3HCTA 1V87A 1X4IA 3KNVA 4X3GA 2VJEA 1WIMA 4PTBA 2JMJA 1JM7B 3LQJA 3M63A 5H1VA 5AITA 2IDAA 5DKAA 2EGPA 4R2YA 1WGMA 2K16A 3GL6A 4WA6A 3C6WA 2Y43A 4L7XA 2Y1MA 2LGKA 4R7EA 3O37A 2QIZA 5TDRA 1JOCA 4LLBA 2MUMA 2NAAA 5KH9A 2KREA 3ZVZB 2MA6A 1U6GB 1CHCA 2E6RA 1Z60A 2ECTA 3L1XA 5TRBA 1E4UA 2YQLA 4UP5A 4GNEA 4I7BA 4WZ0A 4A4BA 5G05B 2K1JA 1LDJB 2K17A 5C11A 2KU3A 4V3LC 4V3KC 2CKLB 2MA5A 1WEVA 3RPGC 4ZUXU 5LCWB 1WEUA 2M6MA 2LXHC 4L58A 2MD8C 4YC9A 2MD7B 3O34A 2EODA 4AUQB 2UZGA 4A49A 3HCSA 2MNYA 2ECJA 2LGLA 2G45A 4B86C 3NG2A 5FERA 2KWJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LXP C;  4GND A;  1WEW A;  3M62 A;  3I2D A;  1WIL A;  5LKT A;  4FO9 A;  3U5O A;  4YBS A;  5H9M A;  2CKL A;  3U5N A;  2G6Q A;  3U5P A;  4A0C D;  1MM2 A;  5I3L A;  2LN0 A;  3C5K A;  4GB0 A;  2DX8 A;  1N87 A;  3QZV A;  3KQI A;  2PNX A;  3N9N A;  2JMD A;  5FB0 A;  3RTR B;  1WEN A;  5G04 B;  3ASL A;  4W4U A;  4I7D A;  2VPD A;  2ECG A;  1ZBD B;  1T1H A;  2JMI A;  2VPG A;  2FSA A;  3PUR A;  4S3O C;  2I50 A;  3SHB A;  3HCU A;  2M3H A;  1LDK C;  4TKP B;  1RMD A;  2PUY A;  5AIU A;  3MHS A;  1HYI A;  2OXQ C;  2KWK A;  3IHP A;  3L1Z B;  5KH3 A;  5TDW A;  2XEU A;  3ZPV E;  3EB5 A;  1WEP A;  2ECV A;  3ZYQ A;  2KWO A;  1VYX A;  3ZNI A;  3M99 A;  4O64 A;  4R8P K;  3PHD A;  4NN2 A;  1K2F A;  2YHN A;  3FL2 A;  1FBV A;  2HYE D;  4MSX A;  4AP4 A;  3ZPV 1;  5FB1 A;  3SOU A;  4UI9 B;  5FEY A;  2YYR A;  2L75 A;  4S3O B;  2F6J A;  4AYC A;  1WE9 A;  2VPE A;  2YUC A;  4XI1 A;  1BOR A;  4QF3 A;  2AN6 A;  2ECN A;  5D1M B;  4WZ3 B;  2ZET C;  2K4D A;  4BHW A;  3DPL R;  4A4C A;  5D1L B;  2F6N A;  1MM3 A;  2D8S A;  2CT2 A;  4CCG X;  1IYM A;  2YU4 A;  1VFY A;  1WEM A;  3RPG B;  2LGG A;  3O7A A;  4P5O B;  2E6S A;  2M1R A;  3GV4 A;  1JM7 A;  4MVT A;  5B77 A;  3DQV R;  2RI7 A;  5B8D A;  2KWN A;  2JRJ A;  4GNG A;  5H1U A;  2VNF A;  2L43 A;  5B76 A;  3N9O A;  1DVP A;  1VD4 A;  2LRI C;  5LKX A;  1G25 A;  3SOW A;  5G0F A;  1X4U A;  2KGI A;  2LGV A;  4IC2 A;  4ZQL A;  2LV9 A;  2C2V S;  3KV6 A;  4GNF A;  4UP0 A;  5D1K B;  3V43 A;  2MIQ A;  2QJ0 A;  2L80 A;  4LJN A;  4FJC A;  4AVX A;  2F42 A;  4B7Y C;  2CSZ A;  4YAT A;  5KH7 A;  2HDP A;  2XB1 A;  5C13 A;  4N3W A;  2Y1N A;  3O35 A;  4Q6F A;  2C2L A;  2YSM A;  5LKU A;  2FUI A;  4PPE A;  2RSD A;  2KYU A;  2EA6 A;  1WES A;  4ZDT A;  2BAY A;  1WEO A;  2ECW A;  4YBT A;  3ZTG A;  1WEQ A;  3L11 A;  3LQH A;  4BBQ A;  3T7L A;  2CSY A;  3N9L A;  2KGG A;  2FUU A;  3KV5 A;  1X4J A;  3PUQ A;  4WZ2 A;  1WFK A;  2YT5 A;  4LK9 A;  4FK5 A;  3T6R A;  2YW8 A;  3N9Q A;  4C9Z A;  4LAD B;  4I7C A;  4LKA A;  2YUR A;  2VJE B;  3O70 A;  2VPB A;  5TAB A;  2MT5 A;  4YAB A;  3N9P A;  1FP0 A;  2YHO A;  5DIN A;  5LKZ A;  3U5M A;  1WEE A;  2H0D A;  2KR4 A;  3EB6 A;  2L5U A;  5B75 A;  5EYA F;  3LRQ A;  4CA1 A;  2LDR A;  3O36 A;  2MNZ A;  2YRE A;  2KIZ A;  1HYJ A;  2H0D B;  1F62 A;  2VJF B;  2YQM A;  2KE1 A;  3LQI A;  5J3X A;  2VP7 A;  2M85 A;  4N4F A;  2LQ6 A;  4QF2 A;  3VK6 A;  4YAX A;  4F52 B;  4YAD A;  2L0B A;  2VJF A;  2ECI A;  2KFT A;  3HTK C;  1Z6U A;  3MHH A;  5JG6 A;  2G43 A;  4FIP A;  3ZVY A;  5B78 A;  1XWH A;  3SOX A;  2YSJ A;  3N9M A;  5H1T A;  3O33 A;  5B79 A;  4AYC B;  1Z2Q A;  4YBM A;  5TBN A;  4IC3 A;  2QIC A;  3HCT A;  1V87 A;  1X4I A;  3KNV A;  4X3G A;  2VJE A;  1WIM A;  4PTB A;  2JMJ A;  1JM7 B;  3LQJ A;  3M63 A;  5H1V A;  5AIT A;  2IDA A;  5DKA A;  2EGP A;  4R2Y A;  1WGM A;  2K16 A;  3GL6 A;  4WA6 A;  3C6W A;  2Y43 A;  4L7X A;  2Y1M A;  2LGK A;  4R7E A;  3O37 A;  2QIZ A;  5TDR A;  1JOC A;  4LLB A;  2MUM A;  2NAA A;  5KH9 A;  2KRE A;  3ZVZ B;  2MA6 A;  1U6G B;  1CHC A;  2E6R A;  1Z60 A;  2ECT A;  3L1X A;  5TRB A;  1E4U A;  2YQL A;  4UP5 A;  4GNE A;  4I7B A;  4WZ0 A;  4A4B A;  5G05 B;  2K1J A;  1LDJ B;  2K17 A;  5C11 A;  2KU3 A;  4V3L C;  4V3K C;  2CKL B;  2MA5 A;  1WEV A;  3RPG C;  4ZUX U;  5LCW B;  1WEU A;  2M6M A;  2LXH C;  4L58 A;  2MD8 C;  4YC9 A;  2MD7 B;  3O34 A;  2EOD A;  4AUQ B;  2UZG A;  4A49 A;  3HCS A;  2MNY A;  2ECJ A;  2LGL A;  2G45 A;  4B86 C;  3NG2 A;  5FER A;  2KWJ A; 
#chains in the Genus database with same CATH topology
 2LXP C;  4GND A;  3E2D A;  1WEW A;  3M62 A;  3I2D A;  1WIL A;  3O47 A;  5LKT A;  4FO9 A;  3U5O A;  4YBS A;  5H9M A;  2CKL A;  3U5N A;  2G6Q A;  3U5P A;  4A0C D;  1MM2 A;  5I3L A;  2LN0 A;  3C5K A;  4GB0 A;  2DX8 A;  1N87 A;  3T9K A;  3QZV A;  3KQI A;  2PNX A;  3N9N A;  2JMD A;  5FB0 A;  3RTR B;  1WEN A;  5G04 B;  3ASL A;  4W4U A;  4I7D A;  2VPD A;  2ECG A;  1ZBD B;  4QQ4 A;  2DJA A;  1T1H A;  2JMI A;  2VPG A;  2JM3 A;  4Z0R A;  2FSA A;  3PUR A;  4S3O C;  2I50 A;  3SHB A;  2EGM A;  3HCU A;  2M3H A;  3DWD A;  1LDK C;  4TKP B;  2YVR A;  1RMD A;  2PUY A;  5AIU A;  3MHS A;  1HYI A;  2OXQ C;  2KWK A;  3IHP A;  3L1Z B;  5KH3 A;  5TDW A;  2XEU A;  3ZPV E;  3EB5 A;  1WEP A;  2ECV A;  3ZYQ A;  2KWO A;  1VYX A;  4O64 A;  3M99 A;  3ZNI A;  4F1P A;  2D8U A;  4R8P K;  3PHD A;  4NN2 A;  1K2F A;  3LJU X;  2YHN A;  3FL2 A;  1FBV A;  2HYE D;  4MSX A;  4AP4 A;  3Q1D A;  3ZPV 1;  5FB1 A;  3SOU A;  4UI9 B;  5FEY A;  2YYR A;  2L75 A;  4S3O B;  2F6J A;  2FFW A;  3FM8 C;  4AYC A;  1WE9 A;  2VPE A;  2YUC A;  2EXU A;  2XP0 A;  4XI1 A;  1BOR A;  4QF3 A;  2AN6 A;  3LVQ E;  2ECN A;  5D1M B;  4WZ3 B;  2ZET C;  2K4D A;  5SVY A;  4BHW A;  2M13 A;  3DPL R;  4A4C A;  5D1L B;  2F6N A;  1MM3 A;  2D8S A;  2CT2 A;  4CCG X;  1IYM A;  2YU4 A;  3FEH A;  1VFY A;  1WEM A;  3RPG B;  2LGG A;  3O7A A;  4P5O B;  2E6S A;  2M1R A;  3GV4 A;  1JM7 A;  4MVT A;  5B77 A;  3DQV R;  2RI7 A;  5B8D A;  3DDT A;  2KWN A;  2JRJ A;  4GNG A;  5H1U A;  3KDE C;  2VNF A;  2CRR A;  2L43 A;  5B76 A;  3N9O A;  1DVP A;  1VD4 A;  2LRI C;  5LKX A;  1G25 A;  4O62 A;  3SOW A;  5G0F A;  1X4U A;  2KGI A;  2LGV A;  2OWA A;  4IC2 A;  4ZQL A;  2LV9 A;  2C2V S;  3KV6 A;  2P57 A;  4GNF A;  5SVI B;  4UP0 A;  1DCQ A;  5D1K B;  3V43 A;  2MIQ A;  2QJ0 A;  2L80 A;  4LJN A;  4FJC A;  4AVX A;  2F42 A;  4B7Y C;  3JUE A;  2CSZ A;  4YAT A;  5KH7 A;  2HDP A;  2XB1 A;  5C13 A;  4N3W A;  2Y1N A;  3O35 A;  4Q6F A;  2C2L A;  2YSM A;  5LKU A;  2FUI A;  4PPE A;  2RSD A;  2KYU A;  2EA6 A;  1WES A;  4ZDT A;  3FAN A;  2BAY A;  1WEO A;  2ECW A;  4YBT A;  3ZTG A;  1WEQ A;  3L11 A;  3LQH A;  4BBQ A;  3T7L A;  2CSY A;  3N9L A;  2KGG A;  3MDB C;  2FUU A;  3KV5 A;  1X4J A;  3PUQ A;  4WZ2 A;  1WFK A;  2YT5 A;  4LK9 A;  4FK5 A;  3T6R A;  2YW8 A;  4OGC A;  3N9Q A;  4C9Z A;  4LAD B;  4I7C A;  4LKA A;  2YUR A;  2VJE B;  3O70 A;  2VPB A;  5TAB A;  2XOY A;  2MT5 A;  4YAB A;  4H9D A;  3N9P A;  1FP0 A;  2YHO A;  5DIN A;  5LKZ A;  3U5M A;  1WEE A;  2H0D A;  2KR4 A;  3EB6 A;  2CRW A;  2L5U A;  5B75 A;  5EYA F;  3LRQ A;  4CA1 A;  2LDR A;  3O36 A;  2MKE A;  2CON A;  2MNZ A;  2YRE A;  2KIZ A;  1HYJ A;  2H0D B;  1F62 A;  2KKY A;  2VJF B;  2YQM A;  2KE1 A;  5K3Q A;  3LQI A;  5J3X A;  2FD4 A;  2VP7 A;  2M85 A;  4N4F A;  2LQ6 A;  2XOZ A;  4QF2 A;  3VK6 A;  4YAX A;  4F52 B;  4YAD A;  2B0O E;  2L0B A;  2CSV A;  2VJF A;  2ECI A;  3FJU B;  2KFT A;  3HTK C;  1Z6U A;  3MHH A;  5JG6 A;  2G43 A;  4FIP A;  3ZVY A;  5B78 A;  1XWH A;  3SOX A;  2YSJ A;  3M7K A;  3N9M A;  5H1T A;  2XOC A;  3O33 A;  5B79 A;  4AYC B;  1Z2Q A;  4YBM A;  5TBN A;  4IC3 A;  2QIC A;  3HCT A;  1V87 A;  1X4I A;  3KNV A;  4X3G A;  2VJE A;  1WIM A;  2LAU A;  4PTB A;  2JMJ A;  1JM7 B;  3LQJ A;  3M63 A;  5H1V A;  5AIT A;  2IDA A;  5DKA A;  4OGE A;  2EGP A;  4R2Y A;  1WGM A;  2K16 A;  3GL6 A;  4WA6 A;  2RR4 A;  3C6W A;  2Y43 A;  4L7X A;  1MBM A;  2Y1M A;  2LGK A;  3FAO A;  5SVI A;  4R7E A;  3O37 A;  2QIZ A;  2L7P A;  5TDR A;  3LVR E;  1JOC A;  5SVX A;  4LLB A;  2MUM A;  2NAA A;  5KH9 A;  2JUN A;  2KKX A;  2KRE A;  3ZVZ B;  2MA6 A;  1U6G B;  1CHC A;  3SUB A;  2E6R A;  1Z60 A;  2ECT A;  3L1X A;  5TRB A;  1E4U A;  2DSM A;  2YQL A;  4UP5 A;  4GNE A;  4I7B A;  4WZ0 A;  4A4B A;  5G05 B;  1LDJ B;  2K1J A;  2K17 A;  3H7H A;  5C11 A;  2KU3 A;  4V3L C;  4V3K C;  2CKL B;  2MA5 A;  1WEV A;  3RPG C;  4ZUX U;  5LCW B;  1WEU A;  2M6M A;  2LXH C;  4L58 A;  2IQJ A;  2MD8 C;  4YC9 A;  2MD7 B;  3LDY A;  3O34 A;  2E61 A;  4Z0O A;  2EOD A;  4AUQ B;  2UZG A;  3PLW A;  4A49 A;  3HCS A;  2MNY A;  2ECJ A;  2LGL A;  2G45 A;  4B86 C;  3NG2 A;  5FER A;  2KWJ A; 
#chains in the Genus database with same CATH homology
 2LXP C;  4GND A;  1WEW A;  3M62 A;  3I2D A;  1WIL A;  5LKT A;  4FO9 A;  3U5O A;  4YBS A;  5H9M A;  2CKL A;  3U5N A;  2G6Q A;  3U5P A;  4A0C D;  1MM2 A;  5I3L A;  2LN0 A;  3C5K A;  4GB0 A;  2DX8 A;  1N87 A;  3QZV A;  3KQI A;  2PNX A;  3N9N A;  2JMD A;  5FB0 A;  3RTR B;  1WEN A;  5G04 B;  3ASL A;  4W4U A;  4I7D A;  2VPD A;  2ECG A;  1ZBD B;  1T1H A;  2JMI A;  2VPG A;  2FSA A;  3PUR A;  4S3O C;  2I50 A;  3SHB A;  3HCU A;  2M3H A;  1LDK C;  4TKP B;  1RMD A;  2PUY A;  5AIU A;  3MHS A;  1HYI A;  2OXQ C;  2KWK A;  3IHP A;  3L1Z B;  5KH3 A;  5TDW A;  2XEU A;  3ZPV E;  3EB5 A;  1WEP A;  2ECV A;  3ZYQ A;  2KWO A;  1VYX A;  3ZNI A;  3M99 A;  4O64 A;  4R8P K;  3PHD A;  4NN2 A;  1K2F A;  2YHN A;  3FL2 A;  1FBV A;  2HYE D;  4MSX A;  4AP4 A;  3ZPV 1;  5FB1 A;  3SOU A;  4UI9 B;  5FEY A;  2YYR A;  2L75 A;  4S3O B;  2F6J A;  4AYC A;  1WE9 A;  2VPE A;  2YUC A;  4XI1 A;  1BOR A;  4QF3 A;  2AN6 A;  2ECN A;  5D1M B;  4WZ3 B;  2ZET C;  2K4D A;  4BHW A;  3DPL R;  4A4C A;  5D1L B;  2F6N A;  1MM3 A;  2D8S A;  2CT2 A;  4CCG X;  1IYM A;  2YU4 A;  1VFY A;  1WEM A;  3RPG B;  2LGG A;  3O7A A;  4P5O B;  2E6S A;  2M1R A;  3GV4 A;  1JM7 A;  4MVT A;  5B77 A;  3DQV R;  2RI7 A;  5B8D A;  2KWN A;  2JRJ A;  4GNG A;  5H1U A;  2VNF A;  2L43 A;  5B76 A;  3N9O A;  1DVP A;  1VD4 A;  2LRI C;  5LKX A;  1G25 A;  3SOW A;  5G0F A;  1X4U A;  2KGI A;  2LGV A;  4IC2 A;  4ZQL A;  2LV9 A;  2C2V S;  3KV6 A;  4GNF A;  4UP0 A;  5D1K B;  3V43 A;  2MIQ A;  2QJ0 A;  2L80 A;  4LJN A;  4FJC A;  4AVX A;  2F42 A;  4B7Y C;  2CSZ A;  4YAT A;  5KH7 A;  2HDP A;  2XB1 A;  5C13 A;  4N3W A;  2Y1N A;  3O35 A;  4Q6F A;  2C2L A;  2YSM A;  5LKU A;  2FUI A;  4PPE A;  2RSD A;  2KYU A;  2EA6 A;  1WES A;  4ZDT A;  2BAY A;  1WEO A;  2ECW A;  4YBT A;  3ZTG A;  1WEQ A;  3L11 A;  3LQH A;  4BBQ A;  3T7L A;  2CSY A;  3N9L A;  2KGG A;  2FUU A;  3KV5 A;  1X4J A;  3PUQ A;  4WZ2 A;  1WFK A;  2YT5 A;  4LK9 A;  4FK5 A;  3T6R A;  2YW8 A;  3N9Q A;  4C9Z A;  4LAD B;  4I7C A;  4LKA A;  2YUR A;  2VJE B;  3O70 A;  2VPB A;  5TAB A;  2MT5 A;  4YAB A;  3N9P A;  1FP0 A;  2YHO A;  5DIN A;  5LKZ A;  3U5M A;  1WEE A;  2H0D A;  2KR4 A;  3EB6 A;  2L5U A;  5B75 A;  5EYA F;  3LRQ A;  4CA1 A;  2LDR A;  3O36 A;  2MNZ A;  2YRE A;  2KIZ A;  1HYJ A;  2H0D B;  1F62 A;  2VJF B;  2YQM A;  2KE1 A;  3LQI A;  5J3X A;  2VP7 A;  2M85 A;  4N4F A;  2LQ6 A;  4QF2 A;  3VK6 A;  4YAX A;  4F52 B;  4YAD A;  2L0B A;  2VJF A;  2ECI A;  2KFT A;  3HTK C;  1Z6U A;  3MHH A;  5JG6 A;  2G43 A;  4FIP A;  3ZVY A;  5B78 A;  1XWH A;  3SOX A;  2YSJ A;  3N9M A;  5H1T A;  3O33 A;  5B79 A;  4AYC B;  1Z2Q A;  4YBM A;  5TBN A;  4IC3 A;  2QIC A;  3HCT A;  1V87 A;  1X4I A;  3KNV A;  4X3G A;  2VJE A;  1WIM A;  4PTB A;  2JMJ A;  1JM7 B;  3LQJ A;  3M63 A;  5H1V A;  5AIT A;  2IDA A;  5DKA A;  2EGP A;  4R2Y A;  1WGM A;  2K16 A;  3GL6 A;  4WA6 A;  3C6W A;  2Y43 A;  4L7X A;  2Y1M A;  2LGK A;  4R7E A;  3O37 A;  2QIZ A;  5TDR A;  1JOC A;  4LLB A;  2MUM A;  2NAA A;  5KH9 A;  2KRE A;  3ZVZ B;  2MA6 A;  1U6G B;  1CHC A;  2E6R A;  1Z60 A;  2ECT A;  3L1X A;  5TRB A;  1E4U A;  2YQL A;  4UP5 A;  4GNE A;  4I7B A;  4WZ0 A;  4A4B A;  5G05 B;  2K1J A;  1LDJ B;  2K17 A;  5C11 A;  2KU3 A;  4V3L C;  4V3K C;  2CKL B;  2MA5 A;  1WEV A;  3RPG C;  4ZUX U;  5LCW B;  1WEU A;  2M6M A;  2LXH C;  4L58 A;  2MD8 C;  4YC9 A;  2MD7 B;  3O34 A;  2EOD A;  4AUQ B;  2UZG A;  4A49 A;  3HCS A;  2MNY A;  2ECJ A;  2LGL A;  2G45 A;  4B86 C;  3NG2 A;  5FER A;  2KWJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...