3ZVYA

Phd finger of human uhrf1 in complex with unmodified histone h3 n- terminal tail
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
65
structure length
65
Chain Sequence
PSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYCPECR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 UBIQUITIN-PROTEIN LIGASE UHRF1
publication title The Phd Finger of Human Uhrf1 Reveals a New Subgroup of Unmethylated Histone H3 Tail Readers.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/peptide
total genus 11
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3zvyA00
3HCUA 1RMDA 4BBQA 2OXQC 5FB1A 3PURA 1Z60A 4YAXA 2Y1NA 1X4UA 1FP0A 4MVTA 3O34A 2KGGA 1VFYA 2ECTA 4GNEA 2CSZA 1WILA 5G05B 5B78A 2F42A 1WIMA 4V3LC 5AITA 2VPDA 1DVPA 1HYIA 3RPGB 2VJEA 4PPEA 2KIZA 4IC2A 2K16A 4YADA 5B76A 4YBMA 2JMJA 2LDRA 1WEWA 4LK9A 2VNFA 5KH9A 4C9ZA 2YU4A 2K17A 3ZPV1 5B79A 2JMDA 3N9QA 5TABA 4A0CD 4N3WA 1VD4A 5C13A 2LGLA 1WEOA 4YABA 2PNXA 2ECVA 2QICA 2KWJA 5LKUA 2VPGA 2FUIA 5FEYA 2M85A 2ECWA 2C2LA 2VJFB 4ZDTA 5TBNA 2RSDA 3KV5A 5B77A 2UZGA 2MD8C 2CKLA 1XWHA 4A49A 1Z2QA 2F6NA 3MHSA 2L5UA 4ZUXU 4IC3A 5D1KB 2KYUA 3LQHA 1G25A 3U5PA 4WZ2A 2EGPA 1JOCA 2MD7B 4QF2A 2YHOA 5DINA 3O36A 2PUYA 5H1TA 3EB6A 1JM7A 1X4JA 5EYAF 1Z6UA 5D1MB 5J3XA 3N9NA 4GNFA 2H0DB 2YSJA 2CSYA 1U6GB 1V87A 2YHNA 3DQVR 4TKPB 1T1HA 3V43A 2K4DA 2YYRA 4PTBA 3M63A 2LN0A 5LCWB 3HCTA 3T6RA 4CA1A 3U5MA 3IHPA 2FSAA 2YW8A 3QZVA 4YBTA 4WZ3B 3N9PA 3VK6A 3U5OA 4S3OB 2L80A 3RTRB 5C11A 3SOUA 1LDKC 4FIPA 4GB0A 2HYED 3RPGC 2LGGA 4YC9A 3N9OA 3KQIA 4LADB 3T7LA 4GNDA 2KWKA 4FK5A 1K2FA 2G45A 3ZTGA 2KREA 5B75A 2YT5A 1CHCA 2MA5A 2BAYA 3I2DA 4MSXA 3NG2A 2M6MA 2VPEA 3N9LA 5TDWA 4WZ0A 1BORA 4R7EA 5FB0A 2E6SA 3LQJA 4AYCA 2DX8A 2XEUA 5H9MA 4B7YC 4GNGA 2L0BA 3HTKC 4X3GA 3L1XA 1WEEA 3L1ZB 2HDPA 2MT5A 4I7CA 2E6RA 2VJEB 2EA6A 2KGIA 2JRJA 4V3KC 1WEUA 5FERA 1E4UA 3KNVA 3O33A 4UI9B 4AVXA 4AUQB 2NAAA 1MM3A 2KWNA 5TDRA 3LQIA 1ZBDB 2MA6A 3M99A 3M62A 1WEVA 4AP4A 2ZETC 1IYMA 3C5KA 2QJ0A 2KU3A 1N87A 3ZNIA 4A4BA 5G0FA 3ASLA 2JMIA 4N4FA 4L58A 2YREA 5DKAA 2CKLB 3N9MA 2VJFA 2KR4A 3HCSA 3DPLR 4S3OC 1LDJB 2YSMA 4FJCA 4CCGX 1HYJA 2LGKA 2MNYA 4I7DA 1WESA 2QIZA 3L11A 4NN2A 5H1VA 4Q6FA 4R8PK 4I7BA 4LLBA 2MUMA 2RI7A 1JM7B 1WE9A 2LXHC 1WEMA 1WEQA 4FO9A 2KFTA 2MNZA 4P5OB 5AIUA 2EODA 4R2YA 5LKTA 2Y1MA 3ZVYA 4LJNA 2MIQA 4YATA 5G04B 1WGMA 2G6QA 2YQLA 3O7AA 4UP5A 5LKXA 1WFKA 3GL6A 4B86C 2H0DA 1MM2A 2K1JA 4BHWA 2VP7A 2AN6A 2D8SA 1FBVA 2I50A 3SHBA 1X4IA 4A4CA 3PUQA 2ECGA 5H1UA 5KH3A 4W4UA 3ZYQA 4UP0A 5I3LA 2IDAA 2LRIC 3SOXA 2ECNA 2LGVA 2LV9A 2G43A 1VYXA 4LKAA 3SOWA 5KH7A 4XI1A 3FL2A 2Y43A 3U5NA 2FUUA 4WA6A 2M3HA 3GV4A 3O37A 2KE1A 3MHHA 3LRQA 3O35A 2ECIA 1F62A 3O70A 4O64A 2VPBA 4QF3A 2L43A 2L75A 5JG6A 5TRBA 1WEPA 2XB1A 5LKZA 3ZVZB 4F52B 2LXPC 3EB5A 2M1RA 2ECJA 2YUCA 3ZPVE 2F6JA 2YQMA 2C2VS 4AYCB 3C6WA 1WENA 4ZQLA 4YBSA 4L7XA 3PHDA 2LQ6A 5D1LB 2KWOA 2YURA 3KV6A 5B8DA 2CT2A
chains in the Genus database with same CATH superfamily
3HCUA 1RMDA 4BBQA 2OXQC 5FB1A 3FANA 3PURA 1Z60A 4YAXA 2Y1NA 1X4UA 1FP0A 4MVTA 3O34A 2KGGA 1VFYA 2ECTA 4GNEA 2CSZA 1WILA 5G05B 5B78A 2F42A 1WIMA 4V3LC 5AITA 2VPDA 1DVPA 1HYIA 3RPGB 2VJEA 3LJUX 4PPEA 2KIZA 4IC2A 2K16A 4YADA 5B76A 4YBMA 4O62A 2JMJA 2LDRA 1WEWA 2P57A 4LK9A 2VNFA 5KH9A 4C9ZA 2YU4A 2K17A 3ZPV1 5B79A 2JMDA 2YVRA 3N9QA 5TABA 4A0CD 2B0OE 2XOCA 4N3WA 1VD4A 5C13A 2D8UA 2LGLA 1WEOA 4YABA 3E2DA 2PNXA 2JM3A 4OGCA 2ECVA 2QICA 2KWJA 5LKUA 2VPGA 2FUIA 5FEYA 2M85A 2ECWA 2C2LA 2VJFB 2CONA 4ZDTA 5TBNA 2RSDA 5SVXA 3KV5A 5B77A 2UZGA 2MD8C 2CKLA 1XWHA 4A49A 1Z2QA 2F6NA 3MDBC 3MHSA 2L5UA 4ZUXU 4IC3A 5D1KB 2KYUA 3LQHA 1G25A 3U5PA 4WZ2A 2EGPA 1JOCA 2MD7B 4Z0RA 4QF2A 2YHOA 5DINA 3O36A 2PUYA 5H1TA 3EB6A 1JM7A 1X4JA 5EYAF 1Z6UA 5D1MB 5J3XA 3KDEC 3N9NA 4GNFA 2H0DB 3FEHA 2YSJA 2CSYA 1U6GB 1V87A 2MKEA 2YHNA 3DQVR 4TKPB 1T1HA 5SVIB 3V43A 2K4DA 2YYRA 3LVQE 4PTBA 3DWDA 3M63A 2LN0A 5LCWB 3HCTA 3T6RA 4CA1A 2KKYA 3U5MA 3IHPA 2FSAA 2YW8A 3QZVA 4YBTA 4WZ3B 3N9PA 3VK6A 3U5OA 4S3OB 2L80A 3RTRB 5C11A 3SOUA 1LDKC 4FIPA 4GB0A 2HYED 3FJUB 3FM8C 1DCQA 3RPGC 2LGGA 4YC9A 3N9OA 3KQIA 4LADB 3T7LA 4F1PA 4GNDA 2KWKA 4FK5A 1K2FA 2G45A 3ZTGA 2KREA 5B75A 2YT5A 1CHCA 2MA5A 3JUEA 2EGMA 3H7HA 2OWAA 2BAYA 3I2DA 4MSXA 2RR4A 3NG2A 2DSMA 2M6MA 2VPEA 3N9LA 5TDWA 4WZ0A 1BORA 4QQ4A 2CRRA 4R7EA 5FB0A 2E6SA 3LQJA 4AYCA 3FAOA 2DX8A 2L7PA 2XEUA 5H9MA 5SVIA 4B7YC 3LDYA 4GNGA 2L0BA 3HTKC 4X3GA 3L1XA 1WEEA 3L1ZB 2HDPA 2MT5A 3SUBA 4I7CA 2E6RA 2VJEB 2M13A 2CSVA 2EA6A 2KGIA 2JRJA 4V3KC 3M7KA 1WEUA 5FERA 1E4UA 3KNVA 3O33A 4UI9B 3PLWA 4AVXA 2EXUA 4AUQB 2NAAA 2DJAA 1MM3A 2FD4A 2KWNA 2JUNA 5TDRA 3LQIA 1ZBDB 2MA6A 1MBMA 3M99A 3M62A 2CRWA 1WEVA 2XOYA 4AP4A 2ZETC 1IYMA 3C5KA 2QJ0A 2KU3A 1N87A 3ZNIA 4A4BA 5G0FA 3ASLA 2JMIA 4N4FA 4L58A 2YREA 5DKAA 2FFWA 2CKLB 3N9MA 4Z0OA 2VJFA 2KR4A 3HCSA 3DPLR 4S3OC 1LDJB 4OGEA 2YSMA 4FJCA 4CCGX 1HYJA 2LGKA 2MNYA 4I7DA 1WESA 2QIZA 3L11A 4NN2A 5H1VA 4Q6FA 4R8PK 4I7BA 4LLBA 2MUMA 2RI7A 2LAUA 1JM7B 1WE9A 2LXHC 2E61A 1WEMA 1WEQA 4FO9A 2KFTA 2MNZA 4P5OB 5AIUA 2EODA 4R2YA 5LKTA 2Y1MA 3ZVYA 4LJNA 2MIQA 4YATA 5G04B 5SVYA 1WGMA 2G6QA 2YQLA 3O7AA 4UP5A 5LKXA 1WFKA 4H9DA 3GL6A 4B86C 2H0DA 1MM2A 2K1JA 4BHWA 2VP7A 2AN6A 2D8SA 1FBVA 2I50A 3O47A 3SHBA 2KKXA 1X4IA 4A4CA 3PUQA 2XP0A 2ECGA 5H1UA 5KH3A 2XOZA 4W4UA 3ZYQA 4UP0A 5I3LA 2IQJA 2IDAA 2LRIC 3SOXA 2ECNA 2LGVA 2LV9A 2G43A 1VYXA 4LKAA 3SOWA 5KH7A 4XI1A 3FL2A 2Y43A 3U5NA 2FUUA 4WA6A 2M3HA 3GV4A 3O37A 3T9KA 2KE1A 3MHHA 3LRQA 3O35A 2ECIA 1F62A 3O70A 4O64A 2VPBA 4QF3A 2L43A 2L75A 5JG6A 5TRBA 3LVRE 1WEPA 2XB1A 5LKZA 3ZVZB 4F52B 2LXPC 3EB5A 2M1RA 5K3QA 2ECJA 2YUCA 3ZPVE 2F6JA 2YQMA 3Q1DA 2C2VS 4AYCB 3DDTA 3C6WA 1WENA 4ZQLA 4YBSA 4L7XA 3PHDA 2LQ6A 5D1LB 2KWOA 2YURA 3KV6A 5B8DA 2CT2A
chains in the Genus database with same CATH topology
3HCUA 1RMDA 4BBQA 2OXQC 5FB1A 3PURA 1Z60A 4YAXA 2Y1NA 1X4UA 1FP0A 4MVTA 3O34A 2KGGA 1VFYA 2ECTA 4GNEA 2CSZA 1WILA 5G05B 5B78A 2F42A 1WIMA 4V3LC 5AITA 2VPDA 1DVPA 1HYIA 3RPGB 2VJEA 4PPEA 2KIZA 4IC2A 2K16A 4YADA 5B76A 4YBMA 2JMJA 2LDRA 1WEWA 4LK9A 2VNFA 5KH9A 4C9ZA 2YU4A 2K17A 3ZPV1 5B79A 2JMDA 3N9QA 5TABA 4A0CD 4N3WA 1VD4A 5C13A 2LGLA 1WEOA 4YABA 2PNXA 2ECVA 2QICA 2KWJA 5LKUA 2VPGA 2FUIA 5FEYA 2M85A 2ECWA 2C2LA 2VJFB 4ZDTA 5TBNA 2RSDA 3KV5A 5B77A 2UZGA 2MD8C 2CKLA 1XWHA 4A49A 1Z2QA 2F6NA 3MHSA 2L5UA 4ZUXU 4IC3A 5D1KB 2KYUA 3LQHA 1G25A 3U5PA 4WZ2A 2EGPA 1JOCA 2MD7B 4QF2A 2YHOA 5DINA 3O36A 2PUYA 5H1TA 3EB6A 1JM7A 1X4JA 5EYAF 1Z6UA 5D1MB 5J3XA 3N9NA 4GNFA 2H0DB 2YSJA 2CSYA 1U6GB 1V87A 2YHNA 3DQVR 4TKPB 1T1HA 3V43A 2K4DA 2YYRA 4PTBA 3M63A 2LN0A 5LCWB 3HCTA 3T6RA 4CA1A 3U5MA 3IHPA 2FSAA 2YW8A 3QZVA 4YBTA 4WZ3B 3N9PA 3VK6A 3U5OA 4S3OB 2L80A 3RTRB 5C11A 3SOUA 1LDKC 4FIPA 4GB0A 2HYED 3RPGC 2LGGA 4YC9A 3N9OA 3KQIA 4LADB 3T7LA 4GNDA 2KWKA 4FK5A 1K2FA 2G45A 3ZTGA 2KREA 5B75A 2YT5A 1CHCA 2MA5A 2BAYA 3I2DA 4MSXA 3NG2A 2M6MA 2VPEA 3N9LA 5TDWA 4WZ0A 1BORA 4R7EA 5FB0A 2E6SA 3LQJA 4AYCA 2DX8A 2XEUA 5H9MA 4B7YC 4GNGA 2L0BA 3HTKC 4X3GA 3L1XA 1WEEA 3L1ZB 2HDPA 2MT5A 4I7CA 2E6RA 2VJEB 2EA6A 2KGIA 2JRJA 4V3KC 1WEUA 5FERA 1E4UA 3KNVA 3O33A 4UI9B 4AVXA 4AUQB 2NAAA 1MM3A 2KWNA 5TDRA 3LQIA 1ZBDB 2MA6A 3M99A 3M62A 1WEVA 4AP4A 2ZETC 1IYMA 3C5KA 2QJ0A 2KU3A 1N87A 3ZNIA 4A4BA 5G0FA 3ASLA 2JMIA 4N4FA 4L58A 2YREA 5DKAA 2CKLB 3N9MA 2VJFA 2KR4A 3HCSA 3DPLR 4S3OC 1LDJB 2YSMA 4FJCA 4CCGX 1HYJA 2LGKA 2MNYA 4I7DA 1WESA 2QIZA 3L11A 4NN2A 5H1VA 4Q6FA 4R8PK 4I7BA 4LLBA 2MUMA 2RI7A 1JM7B 1WE9A 2LXHC 1WEMA 1WEQA 4FO9A 2KFTA 2MNZA 4P5OB 5AIUA 2EODA 4R2YA 5LKTA 2Y1MA 3ZVYA 4LJNA 2MIQA 4YATA 5G04B 1WGMA 2G6QA 2YQLA 3O7AA 4UP5A 5LKXA 1WFKA 3GL6A 4B86C 2H0DA 1MM2A 2K1JA 4BHWA 2VP7A 2AN6A 2D8SA 1FBVA 2I50A 3SHBA 1X4IA 4A4CA 3PUQA 2ECGA 5H1UA 5KH3A 4W4UA 3ZYQA 4UP0A 5I3LA 2IDAA 2LRIC 3SOXA 2ECNA 2LGVA 2LV9A 2G43A 1VYXA 4LKAA 3SOWA 5KH7A 4XI1A 3FL2A 2Y43A 3U5NA 2FUUA 4WA6A 2M3HA 3GV4A 3O37A 2KE1A 3MHHA 3LRQA 3O35A 2ECIA 1F62A 3O70A 4O64A 2VPBA 4QF3A 2L43A 2L75A 5JG6A 5TRBA 1WEPA 2XB1A 5LKZA 3ZVZB 4F52B 2LXPC 3EB5A 2M1RA 2ECJA 2YUCA 3ZPVE 2F6JA 2YQMA 2C2VS 4AYCB 3C6WA 1WENA 4ZQLA 4YBSA 4L7XA 3PHDA 2LQ6A 5D1LB 2KWOA 2YURA 3KV6A 5B8DA 2CT2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HCU A;  1RMD A;  4BBQ A;  2OXQ C;  5FB1 A;  3PUR A;  1Z60 A;  4YAX A;  2Y1N A;  1X4U A;  1FP0 A;  4MVT A;  3O34 A;  2KGG A;  1VFY A;  2ECT A;  4GNE A;  2CSZ A;  1WIL A;  5G05 B;  5B78 A;  2F42 A;  1WIM A;  4V3L C;  5AIT A;  2VPD A;  1DVP A;  1HYI A;  3RPG B;  2VJE A;  4PPE A;  2KIZ A;  4IC2 A;  2K16 A;  4YAD A;  5B76 A;  4YBM A;  2JMJ A;  2LDR A;  1WEW A;  4LK9 A;  2VNF A;  5KH9 A;  4C9Z A;  2YU4 A;  2K17 A;  3ZPV 1;  5B79 A;  2JMD A;  3N9Q A;  5TAB A;  4A0C D;  4N3W A;  1VD4 A;  5C13 A;  2LGL A;  1WEO A;  4YAB A;  2PNX A;  2ECV A;  2QIC A;  2KWJ A;  5LKU A;  2VPG A;  2FUI A;  5FEY A;  2M85 A;  2ECW A;  2C2L A;  2VJF B;  4ZDT A;  5TBN A;  2RSD A;  3KV5 A;  5B77 A;  2UZG A;  2MD8 C;  2CKL A;  1XWH A;  4A49 A;  1Z2Q A;  2F6N A;  3MHS A;  2L5U A;  4ZUX U;  4IC3 A;  5D1K B;  2KYU A;  3LQH A;  1G25 A;  3U5P A;  4WZ2 A;  2EGP A;  1JOC A;  2MD7 B;  4QF2 A;  2YHO A;  5DIN A;  3O36 A;  2PUY A;  5H1T A;  3EB6 A;  1JM7 A;  1X4J A;  5EYA F;  1Z6U A;  5D1M B;  5J3X A;  3N9N A;  4GNF A;  2H0D B;  2YSJ A;  2CSY A;  1U6G B;  1V87 A;  2YHN A;  3DQV R;  4TKP B;  1T1H A;  3V43 A;  2K4D A;  2YYR A;  4PTB A;  3M63 A;  2LN0 A;  5LCW B;  3HCT A;  3T6R A;  4CA1 A;  3U5M A;  3IHP A;  2FSA A;  2YW8 A;  3QZV A;  4YBT A;  4WZ3 B;  3N9P A;  3VK6 A;  3U5O A;  4S3O B;  2L80 A;  3RTR B;  5C11 A;  3SOU A;  1LDK C;  4FIP A;  4GB0 A;  2HYE D;  3RPG C;  2LGG A;  4YC9 A;  3N9O A;  3KQI A;  4LAD B;  3T7L A;  4GND A;  2KWK A;  4FK5 A;  1K2F A;  2G45 A;  3ZTG A;  2KRE A;  5B75 A;  2YT5 A;  1CHC A;  2MA5 A;  2BAY A;  3I2D A;  4MSX A;  3NG2 A;  2M6M A;  2VPE A;  3N9L A;  5TDW A;  4WZ0 A;  1BOR A;  4R7E A;  5FB0 A;  2E6S A;  3LQJ A;  4AYC A;  2DX8 A;  2XEU A;  5H9M A;  4B7Y C;  4GNG A;  2L0B A;  3HTK C;  4X3G A;  3L1X A;  1WEE A;  3L1Z B;  2HDP A;  2MT5 A;  4I7C A;  2E6R A;  2VJE B;  2EA6 A;  2KGI A;  2JRJ A;  4V3K C;  1WEU A;  5FER A;  1E4U A;  3KNV A;  3O33 A;  4UI9 B;  4AVX A;  4AUQ B;  2NAA A;  1MM3 A;  2KWN A;  5TDR A;  3LQI A;  1ZBD B;  2MA6 A;  3M99 A;  3M62 A;  1WEV A;  4AP4 A;  2ZET C;  1IYM A;  3C5K A;  2QJ0 A;  2KU3 A;  1N87 A;  3ZNI A;  4A4B A;  5G0F A;  3ASL A;  2JMI A;  4N4F A;  4L58 A;  2YRE A;  5DKA A;  2CKL B;  3N9M A;  2VJF A;  2KR4 A;  3HCS A;  3DPL R;  4S3O C;  1LDJ B;  2YSM A;  4FJC A;  4CCG X;  1HYJ A;  2LGK A;  2MNY A;  4I7D A;  1WES A;  2QIZ A;  3L11 A;  4NN2 A;  5H1V A;  4Q6F A;  4R8P K;  4I7B A;  4LLB A;  2MUM A;  2RI7 A;  1JM7 B;  1WE9 A;  2LXH C;  1WEM A;  1WEQ A;  4FO9 A;  2KFT A;  2MNZ A;  4P5O B;  5AIU A;  2EOD A;  4R2Y A;  5LKT A;  2Y1M A;  3ZVY A;  4LJN A;  2MIQ A;  4YAT A;  5G04 B;  1WGM A;  2G6Q A;  2YQL A;  3O7A A;  4UP5 A;  5LKX A;  1WFK A;  3GL6 A;  4B86 C;  2H0D A;  1MM2 A;  2K1J A;  4BHW A;  2VP7 A;  2AN6 A;  2D8S A;  1FBV A;  2I50 A;  3SHB A;  1X4I A;  4A4C A;  3PUQ A;  2ECG A;  5H1U A;  5KH3 A;  4W4U A;  3ZYQ A;  4UP0 A;  5I3L A;  2IDA A;  2LRI C;  3SOX A;  2ECN A;  2LGV A;  2LV9 A;  2G43 A;  1VYX A;  4LKA A;  3SOW A;  5KH7 A;  4XI1 A;  3FL2 A;  2Y43 A;  3U5N A;  2FUU A;  4WA6 A;  2M3H A;  3GV4 A;  3O37 A;  2KE1 A;  3MHH A;  3LRQ A;  3O35 A;  2ECI A;  1F62 A;  3O70 A;  4O64 A;  2VPB A;  4QF3 A;  2L43 A;  2L75 A;  5JG6 A;  5TRB A;  1WEP A;  2XB1 A;  5LKZ A;  3ZVZ B;  4F52 B;  2LXP C;  3EB5 A;  2M1R A;  2ECJ A;  2YUC A;  3ZPV E;  2F6J A;  2YQM A;  2C2V S;  4AYC B;  3C6W A;  1WEN A;  4ZQL A;  4YBS A;  4L7X A;  3PHD A;  2LQ6 A;  5D1L B;  2KWO A;  2YUR A;  3KV6 A;  5B8D A;  2CT2 A; 
#chains in the Genus database with same CATH topology
 3HCU A;  1RMD A;  4BBQ A;  2OXQ C;  5FB1 A;  3FAN A;  3PUR A;  1Z60 A;  4YAX A;  2Y1N A;  1X4U A;  1FP0 A;  4MVT A;  3O34 A;  2KGG A;  1VFY A;  2ECT A;  4GNE A;  2CSZ A;  1WIL A;  5G05 B;  5B78 A;  2F42 A;  1WIM A;  4V3L C;  5AIT A;  2VPD A;  1DVP A;  1HYI A;  3RPG B;  2VJE A;  3LJU X;  4PPE A;  2KIZ A;  4IC2 A;  2K16 A;  4YAD A;  5B76 A;  4YBM A;  4O62 A;  2JMJ A;  2LDR A;  1WEW A;  2P57 A;  4LK9 A;  2VNF A;  5KH9 A;  4C9Z A;  2YU4 A;  2K17 A;  3ZPV 1;  5B79 A;  2JMD A;  2YVR A;  3N9Q A;  5TAB A;  4A0C D;  2B0O E;  2XOC A;  4N3W A;  1VD4 A;  5C13 A;  2D8U A;  2LGL A;  1WEO A;  4YAB A;  3E2D A;  2PNX A;  2JM3 A;  4OGC A;  2ECV A;  2QIC A;  2KWJ A;  5LKU A;  2VPG A;  2FUI A;  5FEY A;  2M85 A;  2ECW A;  2C2L A;  2VJF B;  2CON A;  4ZDT A;  5TBN A;  2RSD A;  5SVX A;  3KV5 A;  5B77 A;  2UZG A;  2MD8 C;  2CKL A;  1XWH A;  4A49 A;  1Z2Q A;  2F6N A;  3MDB C;  3MHS A;  2L5U A;  4ZUX U;  4IC3 A;  5D1K B;  2KYU A;  3LQH A;  1G25 A;  3U5P A;  4WZ2 A;  2EGP A;  1JOC A;  2MD7 B;  4Z0R A;  4QF2 A;  2YHO A;  5DIN A;  3O36 A;  2PUY A;  5H1T A;  3EB6 A;  1JM7 A;  1X4J A;  5EYA F;  1Z6U A;  5D1M B;  5J3X A;  3KDE C;  3N9N A;  4GNF A;  2H0D B;  3FEH A;  2YSJ A;  2CSY A;  1U6G B;  1V87 A;  2MKE A;  2YHN A;  3DQV R;  4TKP B;  1T1H A;  5SVI B;  3V43 A;  2K4D A;  2YYR A;  3LVQ E;  4PTB A;  3DWD A;  3M63 A;  2LN0 A;  5LCW B;  3HCT A;  3T6R A;  4CA1 A;  2KKY A;  3U5M A;  3IHP A;  2FSA A;  2YW8 A;  3QZV A;  4YBT A;  4WZ3 B;  3N9P A;  3VK6 A;  3U5O A;  4S3O B;  2L80 A;  3RTR B;  5C11 A;  3SOU A;  1LDK C;  4FIP A;  4GB0 A;  2HYE D;  3FJU B;  3FM8 C;  1DCQ A;  3RPG C;  2LGG A;  4YC9 A;  3N9O A;  3KQI A;  4LAD B;  3T7L A;  4F1P A;  4GND A;  2KWK A;  4FK5 A;  1K2F A;  2G45 A;  3ZTG A;  2KRE A;  5B75 A;  2YT5 A;  1CHC A;  2MA5 A;  3JUE A;  2EGM A;  3H7H A;  2OWA A;  2BAY A;  3I2D A;  4MSX A;  2RR4 A;  3NG2 A;  2DSM A;  2M6M A;  2VPE A;  3N9L A;  5TDW A;  4WZ0 A;  1BOR A;  4QQ4 A;  2CRR A;  4R7E A;  5FB0 A;  2E6S A;  3LQJ A;  4AYC A;  3FAO A;  2DX8 A;  2L7P A;  2XEU A;  5H9M A;  5SVI A;  4B7Y C;  3LDY A;  4GNG A;  2L0B A;  3HTK C;  4X3G A;  3L1X A;  1WEE A;  3L1Z B;  2HDP A;  2MT5 A;  3SUB A;  4I7C A;  2E6R A;  2VJE B;  2M13 A;  2CSV A;  2EA6 A;  2KGI A;  2JRJ A;  4V3K C;  3M7K A;  1WEU A;  5FER A;  1E4U A;  3KNV A;  3O33 A;  4UI9 B;  3PLW A;  4AVX A;  2EXU A;  4AUQ B;  2NAA A;  2DJA A;  1MM3 A;  2FD4 A;  2KWN A;  2JUN A;  5TDR A;  3LQI A;  1ZBD B;  2MA6 A;  1MBM A;  3M99 A;  3M62 A;  2CRW A;  1WEV A;  2XOY A;  4AP4 A;  2ZET C;  1IYM A;  3C5K A;  2QJ0 A;  2KU3 A;  1N87 A;  3ZNI A;  4A4B A;  5G0F A;  3ASL A;  2JMI A;  4N4F A;  4L58 A;  2YRE A;  5DKA A;  2FFW A;  2CKL B;  3N9M A;  4Z0O A;  2VJF A;  2KR4 A;  3HCS A;  3DPL R;  4S3O C;  1LDJ B;  4OGE A;  2YSM A;  4FJC A;  4CCG X;  1HYJ A;  2LGK A;  2MNY A;  4I7D A;  1WES A;  2QIZ A;  3L11 A;  4NN2 A;  5H1V A;  4Q6F A;  4R8P K;  4I7B A;  4LLB A;  2MUM A;  2RI7 A;  2LAU A;  1JM7 B;  1WE9 A;  2LXH C;  2E61 A;  1WEM A;  1WEQ A;  4FO9 A;  2KFT A;  2MNZ A;  4P5O B;  5AIU A;  2EOD A;  4R2Y A;  5LKT A;  2Y1M A;  3ZVY A;  4LJN A;  2MIQ A;  4YAT A;  5G04 B;  5SVY A;  1WGM A;  2G6Q A;  2YQL A;  3O7A A;  4UP5 A;  5LKX A;  1WFK A;  4H9D A;  3GL6 A;  4B86 C;  2H0D A;  1MM2 A;  2K1J A;  4BHW A;  2VP7 A;  2AN6 A;  2D8S A;  1FBV A;  2I50 A;  3O47 A;  3SHB A;  2KKX A;  1X4I A;  4A4C A;  3PUQ A;  2XP0 A;  2ECG A;  5H1U A;  5KH3 A;  2XOZ A;  4W4U A;  3ZYQ A;  4UP0 A;  5I3L A;  2IQJ A;  2IDA A;  2LRI C;  3SOX A;  2ECN A;  2LGV A;  2LV9 A;  2G43 A;  1VYX A;  4LKA A;  3SOW A;  5KH7 A;  4XI1 A;  3FL2 A;  2Y43 A;  3U5N A;  2FUU A;  4WA6 A;  2M3H A;  3GV4 A;  3O37 A;  3T9K A;  2KE1 A;  3MHH A;  3LRQ A;  3O35 A;  2ECI A;  1F62 A;  3O70 A;  4O64 A;  2VPB A;  4QF3 A;  2L43 A;  2L75 A;  5JG6 A;  5TRB A;  3LVR E;  1WEP A;  2XB1 A;  5LKZ A;  3ZVZ B;  4F52 B;  2LXP C;  3EB5 A;  2M1R A;  5K3Q A;  2ECJ A;  2YUC A;  3ZPV E;  2F6J A;  2YQM A;  3Q1D A;  2C2V S;  4AYC B;  3DDT A;  3C6W A;  1WEN A;  4ZQL A;  4YBS A;  4L7X A;  3PHD A;  2LQ6 A;  5D1L B;  2KWO A;  2YUR A;  3KV6 A;  5B8D A;  2CT2 A; 
#chains in the Genus database with same CATH homology
 3HCU A;  1RMD A;  4BBQ A;  2OXQ C;  5FB1 A;  3PUR A;  1Z60 A;  4YAX A;  2Y1N A;  1X4U A;  1FP0 A;  4MVT A;  3O34 A;  2KGG A;  1VFY A;  2ECT A;  4GNE A;  2CSZ A;  1WIL A;  5G05 B;  5B78 A;  2F42 A;  1WIM A;  4V3L C;  5AIT A;  2VPD A;  1DVP A;  1HYI A;  3RPG B;  2VJE A;  4PPE A;  2KIZ A;  4IC2 A;  2K16 A;  4YAD A;  5B76 A;  4YBM A;  2JMJ A;  2LDR A;  1WEW A;  4LK9 A;  2VNF A;  5KH9 A;  4C9Z A;  2YU4 A;  2K17 A;  3ZPV 1;  5B79 A;  2JMD A;  3N9Q A;  5TAB A;  4A0C D;  4N3W A;  1VD4 A;  5C13 A;  2LGL A;  1WEO A;  4YAB A;  2PNX A;  2ECV A;  2QIC A;  2KWJ A;  5LKU A;  2VPG A;  2FUI A;  5FEY A;  2M85 A;  2ECW A;  2C2L A;  2VJF B;  4ZDT A;  5TBN A;  2RSD A;  3KV5 A;  5B77 A;  2UZG A;  2MD8 C;  2CKL A;  1XWH A;  4A49 A;  1Z2Q A;  2F6N A;  3MHS A;  2L5U A;  4ZUX U;  4IC3 A;  5D1K B;  2KYU A;  3LQH A;  1G25 A;  3U5P A;  4WZ2 A;  2EGP A;  1JOC A;  2MD7 B;  4QF2 A;  2YHO A;  5DIN A;  3O36 A;  2PUY A;  5H1T A;  3EB6 A;  1JM7 A;  1X4J A;  5EYA F;  1Z6U A;  5D1M B;  5J3X A;  3N9N A;  4GNF A;  2H0D B;  2YSJ A;  2CSY A;  1U6G B;  1V87 A;  2YHN A;  3DQV R;  4TKP B;  1T1H A;  3V43 A;  2K4D A;  2YYR A;  4PTB A;  3M63 A;  2LN0 A;  5LCW B;  3HCT A;  3T6R A;  4CA1 A;  3U5M A;  3IHP A;  2FSA A;  2YW8 A;  3QZV A;  4YBT A;  4WZ3 B;  3N9P A;  3VK6 A;  3U5O A;  4S3O B;  2L80 A;  3RTR B;  5C11 A;  3SOU A;  1LDK C;  4FIP A;  4GB0 A;  2HYE D;  3RPG C;  2LGG A;  4YC9 A;  3N9O A;  3KQI A;  4LAD B;  3T7L A;  4GND A;  2KWK A;  4FK5 A;  1K2F A;  2G45 A;  3ZTG A;  2KRE A;  5B75 A;  2YT5 A;  1CHC A;  2MA5 A;  2BAY A;  3I2D A;  4MSX A;  3NG2 A;  2M6M A;  2VPE A;  3N9L A;  5TDW A;  4WZ0 A;  1BOR A;  4R7E A;  5FB0 A;  2E6S A;  3LQJ A;  4AYC A;  2DX8 A;  2XEU A;  5H9M A;  4B7Y C;  4GNG A;  2L0B A;  3HTK C;  4X3G A;  3L1X A;  1WEE A;  3L1Z B;  2HDP A;  2MT5 A;  4I7C A;  2E6R A;  2VJE B;  2EA6 A;  2KGI A;  2JRJ A;  4V3K C;  1WEU A;  5FER A;  1E4U A;  3KNV A;  3O33 A;  4UI9 B;  4AVX A;  4AUQ B;  2NAA A;  1MM3 A;  2KWN A;  5TDR A;  3LQI A;  1ZBD B;  2MA6 A;  3M99 A;  3M62 A;  1WEV A;  4AP4 A;  2ZET C;  1IYM A;  3C5K A;  2QJ0 A;  2KU3 A;  1N87 A;  3ZNI A;  4A4B A;  5G0F A;  3ASL A;  2JMI A;  4N4F A;  4L58 A;  2YRE A;  5DKA A;  2CKL B;  3N9M A;  2VJF A;  2KR4 A;  3HCS A;  3DPL R;  4S3O C;  1LDJ B;  2YSM A;  4FJC A;  4CCG X;  1HYJ A;  2LGK A;  2MNY A;  4I7D A;  1WES A;  2QIZ A;  3L11 A;  4NN2 A;  5H1V A;  4Q6F A;  4R8P K;  4I7B A;  4LLB A;  2MUM A;  2RI7 A;  1JM7 B;  1WE9 A;  2LXH C;  1WEM A;  1WEQ A;  4FO9 A;  2KFT A;  2MNZ A;  4P5O B;  5AIU A;  2EOD A;  4R2Y A;  5LKT A;  2Y1M A;  3ZVY A;  4LJN A;  2MIQ A;  4YAT A;  5G04 B;  1WGM A;  2G6Q A;  2YQL A;  3O7A A;  4UP5 A;  5LKX A;  1WFK A;  3GL6 A;  4B86 C;  2H0D A;  1MM2 A;  2K1J A;  4BHW A;  2VP7 A;  2AN6 A;  2D8S A;  1FBV A;  2I50 A;  3SHB A;  1X4I A;  4A4C A;  3PUQ A;  2ECG A;  5H1U A;  5KH3 A;  4W4U A;  3ZYQ A;  4UP0 A;  5I3L A;  2IDA A;  2LRI C;  3SOX A;  2ECN A;  2LGV A;  2LV9 A;  2G43 A;  1VYX A;  4LKA A;  3SOW A;  5KH7 A;  4XI1 A;  3FL2 A;  2Y43 A;  3U5N A;  2FUU A;  4WA6 A;  2M3H A;  3GV4 A;  3O37 A;  2KE1 A;  3MHH A;  3LRQ A;  3O35 A;  2ECI A;  1F62 A;  3O70 A;  4O64 A;  2VPB A;  4QF3 A;  2L43 A;  2L75 A;  5JG6 A;  5TRB A;  1WEP A;  2XB1 A;  5LKZ A;  3ZVZ B;  4F52 B;  2LXP C;  3EB5 A;  2M1R A;  2ECJ A;  2YUC A;  3ZPV E;  2F6J A;  2YQM A;  2C2V S;  4AYC B;  3C6W A;  1WEN A;  4ZQL A;  4YBS A;  4L7X A;  3PHD A;  2LQ6 A;  5D1L B;  2KWO A;  2YUR A;  3KV6 A;  5B8D A;  2CT2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...