3ZVYA

Phd finger of human uhrf1 in complex with unmodified histone h3 n- terminal tail
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
65
structure length
65
Chain Sequence
PSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYCPECR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Phd Finger of Human Uhrf1 Reveals a New Subgroup of Unmethylated Histone H3 Tail Readers.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/peptide
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE UHRF1
total genus 11
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3zvyA00
1WILA 4V3KC 4O64A 2C2VS 1DVPA 4I7BA 2JMDA 2VJEA 3DPLR 2VP7A 2KGGA 4I7CA 2ECVA 2MUMA 4MVTA 3ZVYA 4C9ZA 4LLBA 2L75A 2VPBA 2KFTA 1LDKC 1LDJB 2BAYA 4CA1A 2RSDA 2CT2A 3MHHA 4S3OB 5KH7A 5EYAF 5FB0A 4UP5A 3M99A 2F42A 1WGMA 3HCSA 2FUIA 2K1JA 4AYCB 2YURA 4AUQB 4LKAA 5JG6A 1XWHA 2VPEA 4CCGX 1HYIA 5C13A 4S3OC 2LRIC 5D1MB 2KR4A 3C5KA 2YHOA 3L11A 4XI1A 3MHSA 2LXHC 5G0FA 5H1VA 1RMDA 2I50A 3SOXA 5D1LB 1WE9A 3LQIA 2ECIA 1HYJA 2DX8A 3N9LA 3I2DA 4A49A 2HYED 2G45A 3O36A 4YBSA 2ECGA 3HCUA 3IHPA 2MIQA 2G43A 1X4IA 2YUCA 2Y1MA 1U6GB 1WEVA 1JM7B 2ECNA 1X4UA 3C6WA 1F62A 5TBNA 1WFKA 2FSAA 4L58A 5B78A 5G04B 1WIMA 4AVXA 4WZ2A 5DKAA 1N87A 1VYXA 3RPGC 3O70A 4UP0A 4B7YC 4F52B 5FEYA 2QIZA 1FP0A 3KNVA 3ZPVE 4PPEA 2MT5A 1WEQA 4PTBA 1WEEA 4FIPA 3O37A 3V43A 4WZ3B 1MM2A 1Z6UA 2VJFB 4LJNA 2KU3A 2XB1A 2ECTA 3PHDA 4WZ0A 2LV9A 2L0BA 4Q6FA 2M1RA 3LQJA 2EA6A 2KWJA 3FL2A 2VPGA 2KWKA 3DQVR 4YBTA 3EB5A 5G05B 5H1TA 2YSJA 4QF2A 1IYMA 5H1UA 4ZDTA 5LKXA 5B8DA 4MSXA 1JM7A 2LQ6A 2Y1NA 1WENA 2K4DA 5FB1A 5B75A 2QICA 3ZPV1 1E4UA 3EB6A 2YQLA 1T1HA 2F6JA 1WEUA 4FJCA 4YC9A 2C2LA 2UZGA 2MNZA 2OXQC 4GNGA 2IDAA 5AITA 2PNXA 4BHWA 1Z2QA 3M63A 5H9MA 3LQHA 2VNFA 4N3WA 4A0CD 3T6RA 2MD7B 2E6RA 4NN2A 2HDPA 2LGKA 4QF3A 4YABA 2M3HA 3HTKC 1VD4A 4YAXA 5B77A 3KV6A 2MNYA 3O34A 3ZNIA 1FBVA 3GV4A 2RI7A 3O7AA 3LRQA 3KV5A 2F6NA 5B79A 5TDRA 2LGLA 4WA6A 3N9OA 3HCTA 4FO9A 2ECWA 3N9NA 4BBQA 4LADB 4YADA 2MD8C 2XEUA 2YU4A 3PURA 4W4UA 4ZQLA 2VJEB 3U5OA 2ZETC 1CHCA 1WEOA 4GNFA 4UI9B 2M85A 4AYCA 4R7EA 2K17A 4X3GA 2VJFA 2H0DA 5KH3A 2KGIA 5LKUA 3T7LA 3N9QA 1WEMA 3SHBA 1X4JA 4R8PK 3ZTGA 3ZYQA 1V87A 2D8SA 2EODA 2YW8A 5AIUA 2MA5A 2JRJA 3O35A 2KE1A 3PUQA 4IC3A 2L43A 4I7DA 3KQIA 1JOCA 2M6MA 2PUYA 2AN6A 2JMIA 2KWNA 5KH9A 3M62A 2LGVA 2K16A 5LKTA 4A4CA 4GNEA 2MA6A 4LK9A 2JMJA 2H0DB 2KREA 1K2FA 4V3LC 5J3XA 2CKLB 4R2YA 2VPDA 3ASLA 2YHNA 4GNDA 2ECJA 5D1KB 1WEWA 5FERA 2NAAA 5TDWA 3NG2A 5DINA 2FUUA 3N9PA 2G6QA 2LDRA 3SOUA 4GB0A 5LKZA 3RPGB 2CSZA 4L7XA 2LGGA 3ZVZB 3QZVA 3U5PA 2LXPC 5I3LA 1BORA 1WEPA 2YREA 4AP4A 1ZBDB 3U5NA 3RTRB 3N9MA 4P5OB 2Y43A 2CSYA 4N4FA 2E6SA 2KIZA 4TKPB 3L1ZB 3L1XA 5TABA 3GL6A 2YSMA 2KWOA 2L80A 2L5UA 1MM3A 1Z60A 2YT5A 2CKLA 2YYRA 4IC2A 4YATA 5TRBA 5LCWB 2EGPA 4YBMA 5B76A 4FK5A 4A4BA 3VK6A 3SOWA 2QJ0A 1VFYA 4ZUXU 4B86C 1G25A 2KYUA 1WESA 3O33A 5C11A 2LN0A 3U5MA 2YQMA
chains in the Genus database with same CATH superfamily
1WILA 4V3KC 4O64A 2C2VS 1DVPA 4I7BA 2JMDA 2VJEA 3DPLR 3FAOA 2VP7A 2KGGA 4Z0OA 4I7CA 2ECVA 2MUMA 4MVTA 3ZVYA 4C9ZA 4LLBA 2E61A 2L75A 2VPBA 2CONA 2KFTA 1LDKC 1LDJB 2BAYA 3LVRE 4CA1A 2RSDA 2MKEA 2CT2A 3MHHA 2FD4A 4S3OB 5EYAF 5FB0A 4UP5A 2P57A 3M99A 5KH7A 2F42A 1WGMA 3HCSA 2FUIA 2K1JA 4O62A 4AYCB 5SVYA 2YURA 4AUQB 3MDBC 4LKAA 5JG6A 1XWHA 2XOCA 2VPEA 4CCGX 1HYIA 5C13A 4S3OC 3DDTA 2LRIC 5D1MB 2KR4A 3C5KA 2YHOA 2XOYA 3L11A 4XI1A 3MHSA 2LXHC 4H9DA 5G0FA 5H1VA 2JM3A 1RMDA 2I50A 3SOXA 5D1LB 1WE9A 3LQIA 2ECIA 1HYJA 2DX8A 3N9LA 3FANA 3I2DA 2XP0A 4A49A 4Z0RA 2JUNA 2HYED 2YVRA 2G45A 2L7PA 3O36A 3LJUX 4YBSA 2ECGA 3HCUA 3IHPA 5SVIB 2MIQA 3DWDA 2G43A 1X4IA 2YUCA 2Y1MA 1U6GB 1WEVA 3KDEC 1JM7B 2ECNA 1X4UA 3C6WA 4OGEA 1F62A 2OWAA 5TBNA 1WFKA 2FSAA 4L58A 5B78A 3LVQE 5G04B 1WIMA 4AVXA 4WZ2A 5DKAA 1N87A 1VYXA 3RPGC 3O70A 4UP0A 2DJAA 4B7YC 4F52B 5FEYA 2QIZA 1FP0A 3KNVA 3ZPVE 4PPEA 2KKYA 2MT5A 1WEQA 4PTBA 3FEHA 1WEEA 4FIPA 3O37A 3V43A 4WZ3B 1MM2A 1Z6UA 2VJFB 4LJNA 2KU3A 2XB1A 2ECTA 3PHDA 4WZ0A 2LV9A 2L0BA 4Q6FA 2M1RA 3LQJA 2EA6A 2KWJA 3FL2A 2VPGA 2KWKA 3DQVR 4YBTA 3H7HA 3EB5A 5G05B 5H1TA 2YSJA 4QF2A 1IYMA 5H1UA 5SVXA 4ZDTA 5LKXA 5B8DA 2RR4A 2EXUA 4MSXA 1JM7A 2LQ6A 2Y1NA 1WENA 2K4DA 5FB1A 5B75A 2QICA 3ZPV1 1E4UA 3EB6A 3PLWA 2YQLA 1T1HA 2F6JA 1WEUA 4FJCA 4YC9A 2C2LA 2UZGA 2MNZA 2OXQC 4GNGA 4F1PA 2IDAA 5AITA 2PNXA 4BHWA 1Z2QA 3M7KA 3M63A 5H9MA 5SVIA 3LQHA 2VNFA 4N3WA 4A0CD 3T6RA 2MD7B 2E6RA 4NN2A 2HDPA 2LGKA 2LAUA 4QF3A 4YABA 2M3HA 3HTKC 1VD4A 4YAXA 5B77A 2DSMA 3KV6A 3O47A 2MNYA 3O34A 3ZNIA 1FBVA 3GV4A 2RI7A 3O7AA 3LRQA 3JUEA 3KV5A 2F6NA 5B79A 5TDRA 2LGLA 4WA6A 3N9OA 3HCTA 2M13A 4FO9A 2ECWA 3N9NA 4BBQA 4LADB 4YADA 2MD8C 2XEUA 3SUBA 2YU4A 2CRWA 3PURA 4W4UA 4ZQLA 3FM8C 2VJEB 3U5OA 2ZETC 1CHCA 1WEOA 4GNFA 4UI9B 2M85A 4AYCA 4R7EA 2K17A 4X3GA 2VJFA 2H0DA 5KH3A 2KGIA 5LKUA 3T7LA 3N9QA 1WEMA 3FJUB 3SHBA 1X4JA 4R8PK 3ZTGA 2KKXA 3ZYQA 1V87A 2D8SA 2EODA 2YW8A 5AIUA 2MA5A 2JRJA 3O35A 1DCQA 2KE1A 3PUQA 4IC3A 2L43A 4I7DA 3KQIA 1JOCA 2M6MA 4OGCA 2PUYA 2AN6A 2D8UA 2JMIA 2KWNA 5KH9A 3M62A 2LGVA 2K16A 5LKTA 2XOZA 5K3QA 4A4CA 4GNEA 2CSVA 2MA6A 4LK9A 2IQJA 2JMJA 3T9KA 3E2DA 2H0DB 2CRRA 2KREA 1K2FA 4V3LC 2CKLB 5J3XA 4R2YA 2VPDA 3ASLA 2YHNA 4GNDA 2ECJA 5D1KB 1WEWA 5FERA 2NAAA 5TDWA 3NG2A 5DINA 2FUUA 3N9PA 2G6QA 2LDRA 3SOUA 4GB0A 5LKZA 3RPGB 2CSZA 4L7XA 2LGGA 3ZVZB 3QZVA 3U5PA 2LXPC 5I3LA 1BORA 1WEPA 2YREA 4AP4A 1MBMA 1ZBDB 3U5NA 3RTRB 3N9MA 3LDYA 4QQ4A 2FFWA 4P5OB 2Y43A 2CSYA 4N4FA 2E6SA 2KIZA 4TKPB 3L1ZB 3L1XA 5TABA 3GL6A 2YSMA 2KWOA 2L80A 2L5UA 1MM3A 1Z60A 2YT5A 2CKLA 2YYRA 4IC2A 4YATA 5TRBA 5LCWB 2EGPA 4YBMA 2EGMA 5B76A 4FK5A 4A4BA 3VK6A 3Q1DA 3SOWA 2QJ0A 1VFYA 4ZUXU 4B86C 1G25A 2KYUA 1WESA 3O33A 5C11A 2B0OE 2LN0A 3U5MA 2YQMA
chains in the Genus database with same CATH topology
1WILA 4V3KC 4O64A 2C2VS 1DVPA 4I7BA 2JMDA 2VJEA 3DPLR 2VP7A 2KGGA 4I7CA 2ECVA 2MUMA 4MVTA 3ZVYA 4C9ZA 4LLBA 2L75A 2VPBA 2KFTA 1LDKC 1LDJB 2BAYA 4CA1A 2RSDA 2CT2A 3MHHA 4S3OB 5KH7A 5EYAF 5FB0A 4UP5A 3M99A 2F42A 1WGMA 3HCSA 2FUIA 2K1JA 4AYCB 2YURA 4AUQB 4LKAA 5JG6A 1XWHA 2VPEA 4CCGX 1HYIA 5C13A 4S3OC 2LRIC 5D1MB 2KR4A 3C5KA 2YHOA 3L11A 4XI1A 3MHSA 2LXHC 5G0FA 5H1VA 1RMDA 2I50A 3SOXA 5D1LB 1WE9A 3LQIA 2ECIA 1HYJA 2DX8A 3N9LA 3I2DA 4A49A 2HYED 2G45A 3O36A 4YBSA 2ECGA 3HCUA 3IHPA 2MIQA 2G43A 1X4IA 2YUCA 2Y1MA 1U6GB 1WEVA 1JM7B 2ECNA 1X4UA 3C6WA 1F62A 5TBNA 1WFKA 2FSAA 4L58A 5B78A 5G04B 1WIMA 4AVXA 4WZ2A 5DKAA 1N87A 1VYXA 3RPGC 3O70A 4UP0A 4B7YC 4F52B 5FEYA 2QIZA 1FP0A 3KNVA 3ZPVE 4PPEA 2MT5A 1WEQA 4PTBA 1WEEA 4FIPA 3O37A 3V43A 4WZ3B 1MM2A 1Z6UA 2VJFB 4LJNA 2KU3A 2XB1A 2ECTA 3PHDA 4WZ0A 2LV9A 2L0BA 4Q6FA 2M1RA 3LQJA 2EA6A 2KWJA 3FL2A 2VPGA 2KWKA 3DQVR 4YBTA 3EB5A 5G05B 5H1TA 2YSJA 4QF2A 1IYMA 5H1UA 4ZDTA 5LKXA 5B8DA 4MSXA 1JM7A 2LQ6A 2Y1NA 1WENA 2K4DA 5FB1A 5B75A 2QICA 3ZPV1 1E4UA 3EB6A 2YQLA 1T1HA 2F6JA 1WEUA 4FJCA 4YC9A 2C2LA 2UZGA 2MNZA 2OXQC 4GNGA 2IDAA 5AITA 2PNXA 4BHWA 1Z2QA 3M63A 5H9MA 3LQHA 2VNFA 4N3WA 4A0CD 3T6RA 2MD7B 2E6RA 4NN2A 2HDPA 2LGKA 4QF3A 4YABA 2M3HA 3HTKC 1VD4A 4YAXA 5B77A 3KV6A 2MNYA 3O34A 3ZNIA 1FBVA 3GV4A 2RI7A 3O7AA 3LRQA 3KV5A 2F6NA 5B79A 5TDRA 2LGLA 4WA6A 3N9OA 3HCTA 4FO9A 2ECWA 3N9NA 4BBQA 4LADB 4YADA 2MD8C 2XEUA 2YU4A 3PURA 4W4UA 4ZQLA 2VJEB 3U5OA 2ZETC 1CHCA 1WEOA 4GNFA 4UI9B 2M85A 4AYCA 4R7EA 2K17A 4X3GA 2VJFA 2H0DA 5KH3A 2KGIA 5LKUA 3T7LA 3N9QA 1WEMA 3SHBA 1X4JA 4R8PK 3ZTGA 3ZYQA 1V87A 2D8SA 2EODA 2YW8A 5AIUA 2MA5A 2JRJA 3O35A 2KE1A 3PUQA 4IC3A 2L43A 4I7DA 3KQIA 1JOCA 2M6MA 2PUYA 2AN6A 2JMIA 2KWNA 5KH9A 3M62A 2LGVA 2K16A 5LKTA 4A4CA 4GNEA 2MA6A 4LK9A 2JMJA 2H0DB 2KREA 1K2FA 4V3LC 5J3XA 2CKLB 4R2YA 2VPDA 3ASLA 2YHNA 4GNDA 2ECJA 5D1KB 1WEWA 5FERA 2NAAA 5TDWA 3NG2A 5DINA 2FUUA 3N9PA 2G6QA 2LDRA 3SOUA 4GB0A 5LKZA 3RPGB 2CSZA 4L7XA 2LGGA 3ZVZB 3QZVA 3U5PA 2LXPC 5I3LA 1BORA 1WEPA 2YREA 4AP4A 1ZBDB 3U5NA 3RTRB 3N9MA 4P5OB 2Y43A 2CSYA 4N4FA 2E6SA 2KIZA 4TKPB 3L1ZB 3L1XA 5TABA 3GL6A 2YSMA 2KWOA 2L80A 2L5UA 1MM3A 1Z60A 2YT5A 2CKLA 2YYRA 4IC2A 4YATA 5TRBA 5LCWB 2EGPA 4YBMA 5B76A 4FK5A 4A4BA 3VK6A 3SOWA 2QJ0A 1VFYA 4ZUXU 4B86C 1G25A 2KYUA 1WESA 3O33A 5C11A 2LN0A 3U5MA 2YQMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WIL A;  4V3K C;  4O64 A;  2C2V S;  1DVP A;  4I7B A;  2JMD A;  2VJE A;  3DPL R;  2VP7 A;  2KGG A;  4I7C A;  2ECV A;  2MUM A;  4MVT A;  3ZVY A;  4C9Z A;  4LLB A;  2L75 A;  2VPB A;  2KFT A;  1LDK C;  1LDJ B;  2BAY A;  4CA1 A;  2RSD A;  2CT2 A;  3MHH A;  4S3O B;  5KH7 A;  5EYA F;  5FB0 A;  4UP5 A;  3M99 A;  2F42 A;  1WGM A;  3HCS A;  2FUI A;  2K1J A;  4AYC B;  2YUR A;  4AUQ B;  4LKA A;  5JG6 A;  1XWH A;  2VPE A;  4CCG X;  1HYI A;  5C13 A;  4S3O C;  2LRI C;  5D1M B;  2KR4 A;  3C5K A;  2YHO A;  3L11 A;  4XI1 A;  3MHS A;  2LXH C;  5G0F A;  5H1V A;  1RMD A;  2I50 A;  3SOX A;  5D1L B;  1WE9 A;  3LQI A;  2ECI A;  1HYJ A;  2DX8 A;  3N9L A;  3I2D A;  4A49 A;  2HYE D;  2G45 A;  3O36 A;  4YBS A;  2ECG A;  3HCU A;  3IHP A;  2MIQ A;  2G43 A;  1X4I A;  2YUC A;  2Y1M A;  1U6G B;  1WEV A;  1JM7 B;  2ECN A;  1X4U A;  3C6W A;  1F62 A;  5TBN A;  1WFK A;  2FSA A;  4L58 A;  5B78 A;  5G04 B;  1WIM A;  4AVX A;  4WZ2 A;  5DKA A;  1N87 A;  1VYX A;  3RPG C;  3O70 A;  4UP0 A;  4B7Y C;  4F52 B;  5FEY A;  2QIZ A;  1FP0 A;  3KNV A;  3ZPV E;  4PPE A;  2MT5 A;  1WEQ A;  4PTB A;  1WEE A;  4FIP A;  3O37 A;  3V43 A;  4WZ3 B;  1MM2 A;  1Z6U A;  2VJF B;  4LJN A;  2KU3 A;  2XB1 A;  2ECT A;  3PHD A;  4WZ0 A;  2LV9 A;  2L0B A;  4Q6F A;  2M1R A;  3LQJ A;  2EA6 A;  2KWJ A;  3FL2 A;  2VPG A;  2KWK A;  3DQV R;  4YBT A;  3EB5 A;  5G05 B;  5H1T A;  2YSJ A;  4QF2 A;  1IYM A;  5H1U A;  4ZDT A;  5LKX A;  5B8D A;  4MSX A;  1JM7 A;  2LQ6 A;  2Y1N A;  1WEN A;  2K4D A;  5FB1 A;  5B75 A;  2QIC A;  3ZPV 1;  1E4U A;  3EB6 A;  2YQL A;  1T1H A;  2F6J A;  1WEU A;  4FJC A;  4YC9 A;  2C2L A;  2UZG A;  2MNZ A;  2OXQ C;  4GNG A;  2IDA A;  5AIT A;  2PNX A;  4BHW A;  1Z2Q A;  3M63 A;  5H9M A;  3LQH A;  2VNF A;  4N3W A;  4A0C D;  3T6R A;  2MD7 B;  2E6R A;  4NN2 A;  2HDP A;  2LGK A;  4QF3 A;  4YAB A;  2M3H A;  3HTK C;  1VD4 A;  4YAX A;  5B77 A;  3KV6 A;  2MNY A;  3O34 A;  3ZNI A;  1FBV A;  3GV4 A;  2RI7 A;  3O7A A;  3LRQ A;  3KV5 A;  2F6N A;  5B79 A;  5TDR A;  2LGL A;  4WA6 A;  3N9O A;  3HCT A;  4FO9 A;  2ECW A;  3N9N A;  4BBQ A;  4LAD B;  4YAD A;  2MD8 C;  2XEU A;  2YU4 A;  3PUR A;  4W4U A;  4ZQL A;  2VJE B;  3U5O A;  2ZET C;  1CHC A;  1WEO A;  4GNF A;  4UI9 B;  2M85 A;  4AYC A;  4R7E A;  2K17 A;  4X3G A;  2VJF A;  2H0D A;  5KH3 A;  2KGI A;  5LKU A;  3T7L A;  3N9Q A;  1WEM A;  3SHB A;  1X4J A;  4R8P K;  3ZTG A;  3ZYQ A;  1V87 A;  2D8S A;  2EOD A;  2YW8 A;  5AIU A;  2MA5 A;  2JRJ A;  3O35 A;  2KE1 A;  3PUQ A;  4IC3 A;  2L43 A;  4I7D A;  3KQI A;  1JOC A;  2M6M A;  2PUY A;  2AN6 A;  2JMI A;  2KWN A;  5KH9 A;  3M62 A;  2LGV A;  2K16 A;  5LKT A;  4A4C A;  4GNE A;  2MA6 A;  4LK9 A;  2JMJ A;  2H0D B;  2KRE A;  1K2F A;  4V3L C;  5J3X A;  2CKL B;  4R2Y A;  2VPD A;  3ASL A;  2YHN A;  4GND A;  2ECJ A;  5D1K B;  1WEW A;  5FER A;  2NAA A;  5TDW A;  3NG2 A;  5DIN A;  2FUU A;  3N9P A;  2G6Q A;  2LDR A;  3SOU A;  4GB0 A;  5LKZ A;  3RPG B;  2CSZ A;  4L7X A;  2LGG A;  3ZVZ B;  3QZV A;  3U5P A;  2LXP C;  5I3L A;  1BOR A;  1WEP A;  2YRE A;  4AP4 A;  1ZBD B;  3U5N A;  3RTR B;  3N9M A;  4P5O B;  2Y43 A;  2CSY A;  4N4F A;  2E6S A;  2KIZ A;  4TKP B;  3L1Z B;  3L1X A;  5TAB A;  3GL6 A;  2YSM A;  2KWO A;  2L80 A;  2L5U A;  1MM3 A;  1Z60 A;  2YT5 A;  2CKL A;  2YYR A;  4IC2 A;  4YAT A;  5TRB A;  5LCW B;  2EGP A;  4YBM A;  5B76 A;  4FK5 A;  4A4B A;  3VK6 A;  3SOW A;  2QJ0 A;  1VFY A;  4ZUX U;  4B86 C;  1G25 A;  2KYU A;  1WES A;  3O33 A;  5C11 A;  2LN0 A;  3U5M A;  2YQM A; 
#chains in the Genus database with same CATH topology
 1WIL A;  4V3K C;  4O64 A;  2C2V S;  1DVP A;  4I7B A;  2JMD A;  2VJE A;  3DPL R;  3FAO A;  2VP7 A;  2KGG A;  4Z0O A;  4I7C A;  2ECV A;  2MUM A;  4MVT A;  3ZVY A;  4C9Z A;  4LLB A;  2E61 A;  2L75 A;  2VPB A;  2CON A;  2KFT A;  1LDK C;  1LDJ B;  2BAY A;  3LVR E;  4CA1 A;  2RSD A;  2MKE A;  2CT2 A;  3MHH A;  2FD4 A;  4S3O B;  5EYA F;  5FB0 A;  4UP5 A;  2P57 A;  3M99 A;  5KH7 A;  2F42 A;  1WGM A;  3HCS A;  2FUI A;  2K1J A;  4O62 A;  4AYC B;  5SVY A;  2YUR A;  4AUQ B;  3MDB C;  4LKA A;  5JG6 A;  1XWH A;  2XOC A;  2VPE A;  4CCG X;  1HYI A;  5C13 A;  4S3O C;  3DDT A;  2LRI C;  5D1M B;  2KR4 A;  3C5K A;  2YHO A;  2XOY A;  3L11 A;  4XI1 A;  3MHS A;  2LXH C;  4H9D A;  5G0F A;  5H1V A;  2JM3 A;  1RMD A;  2I50 A;  3SOX A;  5D1L B;  1WE9 A;  3LQI A;  2ECI A;  1HYJ A;  2DX8 A;  3N9L A;  3FAN A;  3I2D A;  2XP0 A;  4A49 A;  4Z0R A;  2JUN A;  2HYE D;  2YVR A;  2G45 A;  2L7P A;  3O36 A;  3LJU X;  4YBS A;  2ECG A;  3HCU A;  3IHP A;  5SVI B;  2MIQ A;  3DWD A;  2G43 A;  1X4I A;  2YUC A;  2Y1M A;  1U6G B;  1WEV A;  3KDE C;  1JM7 B;  2ECN A;  1X4U A;  3C6W A;  4OGE A;  1F62 A;  2OWA A;  5TBN A;  1WFK A;  2FSA A;  4L58 A;  5B78 A;  3LVQ E;  5G04 B;  1WIM A;  4AVX A;  4WZ2 A;  5DKA A;  1N87 A;  1VYX A;  3RPG C;  3O70 A;  4UP0 A;  2DJA A;  4B7Y C;  4F52 B;  5FEY A;  2QIZ A;  1FP0 A;  3KNV A;  3ZPV E;  4PPE A;  2KKY A;  2MT5 A;  1WEQ A;  4PTB A;  3FEH A;  1WEE A;  4FIP A;  3O37 A;  3V43 A;  4WZ3 B;  1MM2 A;  1Z6U A;  2VJF B;  4LJN A;  2KU3 A;  2XB1 A;  2ECT A;  3PHD A;  4WZ0 A;  2LV9 A;  2L0B A;  4Q6F A;  2M1R A;  3LQJ A;  2EA6 A;  2KWJ A;  3FL2 A;  2VPG A;  2KWK A;  3DQV R;  4YBT A;  3H7H A;  3EB5 A;  5G05 B;  5H1T A;  2YSJ A;  4QF2 A;  1IYM A;  5H1U A;  5SVX A;  4ZDT A;  5LKX A;  5B8D A;  2RR4 A;  2EXU A;  4MSX A;  1JM7 A;  2LQ6 A;  2Y1N A;  1WEN A;  2K4D A;  5FB1 A;  5B75 A;  2QIC A;  3ZPV 1;  1E4U A;  3EB6 A;  3PLW A;  2YQL A;  1T1H A;  2F6J A;  1WEU A;  4FJC A;  4YC9 A;  2C2L A;  2UZG A;  2MNZ A;  2OXQ C;  4GNG A;  4F1P A;  2IDA A;  5AIT A;  2PNX A;  4BHW A;  1Z2Q A;  3M7K A;  3M63 A;  5H9M A;  5SVI A;  3LQH A;  2VNF A;  4N3W A;  4A0C D;  3T6R A;  2MD7 B;  2E6R A;  4NN2 A;  2HDP A;  2LGK A;  2LAU A;  4QF3 A;  4YAB A;  2M3H A;  3HTK C;  1VD4 A;  4YAX A;  5B77 A;  2DSM A;  3KV6 A;  3O47 A;  2MNY A;  3O34 A;  3ZNI A;  1FBV A;  3GV4 A;  2RI7 A;  3O7A A;  3LRQ A;  3JUE A;  3KV5 A;  2F6N A;  5B79 A;  5TDR A;  2LGL A;  4WA6 A;  3N9O A;  3HCT A;  2M13 A;  4FO9 A;  2ECW A;  3N9N A;  4BBQ A;  4LAD B;  4YAD A;  2MD8 C;  2XEU A;  3SUB A;  2YU4 A;  2CRW A;  3PUR A;  4W4U A;  4ZQL A;  3FM8 C;  2VJE B;  3U5O A;  2ZET C;  1CHC A;  1WEO A;  4GNF A;  4UI9 B;  2M85 A;  4AYC A;  4R7E A;  2K17 A;  4X3G A;  2VJF A;  2H0D A;  5KH3 A;  2KGI A;  5LKU A;  3T7L A;  3N9Q A;  1WEM A;  3FJU B;  3SHB A;  1X4J A;  4R8P K;  3ZTG A;  2KKX A;  3ZYQ A;  1V87 A;  2D8S A;  2EOD A;  2YW8 A;  5AIU A;  2MA5 A;  2JRJ A;  3O35 A;  1DCQ A;  2KE1 A;  3PUQ A;  4IC3 A;  2L43 A;  4I7D A;  3KQI A;  1JOC A;  2M6M A;  4OGC A;  2PUY A;  2AN6 A;  2D8U A;  2JMI A;  2KWN A;  5KH9 A;  3M62 A;  2LGV A;  2K16 A;  5LKT A;  2XOZ A;  5K3Q A;  4A4C A;  4GNE A;  2CSV A;  2MA6 A;  4LK9 A;  2IQJ A;  2JMJ A;  3T9K A;  3E2D A;  2H0D B;  2CRR A;  2KRE A;  1K2F A;  4V3L C;  2CKL B;  5J3X A;  4R2Y A;  2VPD A;  3ASL A;  2YHN A;  4GND A;  2ECJ A;  5D1K B;  1WEW A;  5FER A;  2NAA A;  5TDW A;  3NG2 A;  5DIN A;  2FUU A;  3N9P A;  2G6Q A;  2LDR A;  3SOU A;  4GB0 A;  5LKZ A;  3RPG B;  2CSZ A;  4L7X A;  2LGG A;  3ZVZ B;  3QZV A;  3U5P A;  2LXP C;  5I3L A;  1BOR A;  1WEP A;  2YRE A;  4AP4 A;  1MBM A;  1ZBD B;  3U5N A;  3RTR B;  3N9M A;  3LDY A;  4QQ4 A;  2FFW A;  4P5O B;  2Y43 A;  2CSY A;  4N4F A;  2E6S A;  2KIZ A;  4TKP B;  3L1Z B;  3L1X A;  5TAB A;  3GL6 A;  2YSM A;  2KWO A;  2L80 A;  2L5U A;  1MM3 A;  1Z60 A;  2YT5 A;  2CKL A;  2YYR A;  4IC2 A;  4YAT A;  5TRB A;  5LCW B;  2EGP A;  4YBM A;  2EGM A;  5B76 A;  4FK5 A;  4A4B A;  3VK6 A;  3Q1D A;  3SOW A;  2QJ0 A;  1VFY A;  4ZUX U;  4B86 C;  1G25 A;  2KYU A;  1WES A;  3O33 A;  5C11 A;  2B0O E;  2LN0 A;  3U5M A;  2YQM A; 
#chains in the Genus database with same CATH homology
 1WIL A;  4V3K C;  4O64 A;  2C2V S;  1DVP A;  4I7B A;  2JMD A;  2VJE A;  3DPL R;  2VP7 A;  2KGG A;  4I7C A;  2ECV A;  2MUM A;  4MVT A;  3ZVY A;  4C9Z A;  4LLB A;  2L75 A;  2VPB A;  2KFT A;  1LDK C;  1LDJ B;  2BAY A;  4CA1 A;  2RSD A;  2CT2 A;  3MHH A;  4S3O B;  5KH7 A;  5EYA F;  5FB0 A;  4UP5 A;  3M99 A;  2F42 A;  1WGM A;  3HCS A;  2FUI A;  2K1J A;  4AYC B;  2YUR A;  4AUQ B;  4LKA A;  5JG6 A;  1XWH A;  2VPE A;  4CCG X;  1HYI A;  5C13 A;  4S3O C;  2LRI C;  5D1M B;  2KR4 A;  3C5K A;  2YHO A;  3L11 A;  4XI1 A;  3MHS A;  2LXH C;  5G0F A;  5H1V A;  1RMD A;  2I50 A;  3SOX A;  5D1L B;  1WE9 A;  3LQI A;  2ECI A;  1HYJ A;  2DX8 A;  3N9L A;  3I2D A;  4A49 A;  2HYE D;  2G45 A;  3O36 A;  4YBS A;  2ECG A;  3HCU A;  3IHP A;  2MIQ A;  2G43 A;  1X4I A;  2YUC A;  2Y1M A;  1U6G B;  1WEV A;  1JM7 B;  2ECN A;  1X4U A;  3C6W A;  1F62 A;  5TBN A;  1WFK A;  2FSA A;  4L58 A;  5B78 A;  5G04 B;  1WIM A;  4AVX A;  4WZ2 A;  5DKA A;  1N87 A;  1VYX A;  3RPG C;  3O70 A;  4UP0 A;  4B7Y C;  4F52 B;  5FEY A;  2QIZ A;  1FP0 A;  3KNV A;  3ZPV E;  4PPE A;  2MT5 A;  1WEQ A;  4PTB A;  1WEE A;  4FIP A;  3O37 A;  3V43 A;  4WZ3 B;  1MM2 A;  1Z6U A;  2VJF B;  4LJN A;  2KU3 A;  2XB1 A;  2ECT A;  3PHD A;  4WZ0 A;  2LV9 A;  2L0B A;  4Q6F A;  2M1R A;  3LQJ A;  2EA6 A;  2KWJ A;  3FL2 A;  2VPG A;  2KWK A;  3DQV R;  4YBT A;  3EB5 A;  5G05 B;  5H1T A;  2YSJ A;  4QF2 A;  1IYM A;  5H1U A;  4ZDT A;  5LKX A;  5B8D A;  4MSX A;  1JM7 A;  2LQ6 A;  2Y1N A;  1WEN A;  2K4D A;  5FB1 A;  5B75 A;  2QIC A;  3ZPV 1;  1E4U A;  3EB6 A;  2YQL A;  1T1H A;  2F6J A;  1WEU A;  4FJC A;  4YC9 A;  2C2L A;  2UZG A;  2MNZ A;  2OXQ C;  4GNG A;  2IDA A;  5AIT A;  2PNX A;  4BHW A;  1Z2Q A;  3M63 A;  5H9M A;  3LQH A;  2VNF A;  4N3W A;  4A0C D;  3T6R A;  2MD7 B;  2E6R A;  4NN2 A;  2HDP A;  2LGK A;  4QF3 A;  4YAB A;  2M3H A;  3HTK C;  1VD4 A;  4YAX A;  5B77 A;  3KV6 A;  2MNY A;  3O34 A;  3ZNI A;  1FBV A;  3GV4 A;  2RI7 A;  3O7A A;  3LRQ A;  3KV5 A;  2F6N A;  5B79 A;  5TDR A;  2LGL A;  4WA6 A;  3N9O A;  3HCT A;  4FO9 A;  2ECW A;  3N9N A;  4BBQ A;  4LAD B;  4YAD A;  2MD8 C;  2XEU A;  2YU4 A;  3PUR A;  4W4U A;  4ZQL A;  2VJE B;  3U5O A;  2ZET C;  1CHC A;  1WEO A;  4GNF A;  4UI9 B;  2M85 A;  4AYC A;  4R7E A;  2K17 A;  4X3G A;  2VJF A;  2H0D A;  5KH3 A;  2KGI A;  5LKU A;  3T7L A;  3N9Q A;  1WEM A;  3SHB A;  1X4J A;  4R8P K;  3ZTG A;  3ZYQ A;  1V87 A;  2D8S A;  2EOD A;  2YW8 A;  5AIU A;  2MA5 A;  2JRJ A;  3O35 A;  2KE1 A;  3PUQ A;  4IC3 A;  2L43 A;  4I7D A;  3KQI A;  1JOC A;  2M6M A;  2PUY A;  2AN6 A;  2JMI A;  2KWN A;  5KH9 A;  3M62 A;  2LGV A;  2K16 A;  5LKT A;  4A4C A;  4GNE A;  2MA6 A;  4LK9 A;  2JMJ A;  2H0D B;  2KRE A;  1K2F A;  4V3L C;  5J3X A;  2CKL B;  4R2Y A;  2VPD A;  3ASL A;  2YHN A;  4GND A;  2ECJ A;  5D1K B;  1WEW A;  5FER A;  2NAA A;  5TDW A;  3NG2 A;  5DIN A;  2FUU A;  3N9P A;  2G6Q A;  2LDR A;  3SOU A;  4GB0 A;  5LKZ A;  3RPG B;  2CSZ A;  4L7X A;  2LGG A;  3ZVZ B;  3QZV A;  3U5P A;  2LXP C;  5I3L A;  1BOR A;  1WEP A;  2YRE A;  4AP4 A;  1ZBD B;  3U5N A;  3RTR B;  3N9M A;  4P5O B;  2Y43 A;  2CSY A;  4N4F A;  2E6S A;  2KIZ A;  4TKP B;  3L1Z B;  3L1X A;  5TAB A;  3GL6 A;  2YSM A;  2KWO A;  2L80 A;  2L5U A;  1MM3 A;  1Z60 A;  2YT5 A;  2CKL A;  2YYR A;  4IC2 A;  4YAT A;  5TRB A;  5LCW B;  2EGP A;  4YBM A;  5B76 A;  4FK5 A;  4A4B A;  3VK6 A;  3SOW A;  2QJ0 A;  1VFY A;  4ZUX U;  4B86 C;  1G25 A;  2KYU A;  1WES A;  3O33 A;  5C11 A;  2LN0 A;  3U5M A;  2YQM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...