2ECJA

Solution structure of the ring domain of the human tripartite motif-containing protein 39
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
58
structure length
58
Chain Sequence
b'GSSGSSGALENLQVEASCSVCLEYLKEPVIIECGHNFCKACITRWWEDLERDFPCPVC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tripartite motif-containing protein 39
publication title Solution structure of the RING domain of the human tripartite motif-containing protein 39
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 3
structure length 58
sequence length 58
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2007-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15227 zf-C3HC4_4 zinc finger of C3HC4-type, RING
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2ecjA00
2AN6A 2EGPA 4O64A 4BBQA 4Q6FA 2YT5A 2Y1NA 3DPLR 4GB0A 5H9MA 4YBMA 4BHWA 2ECJA 2RSDA 3N9OA 1WEMA 4ZUXU 4YC9A 1K2FA 3NG2A 2C2VS 1WFKA 2VPDA 3C5KA 1FBVA 1X4UA 2VJEA 1HYIA 2F6NA 1LDJB 3U5PA 3VK6A 2KFTA 1WESA 2C2LA 1XWHA 3RPGC 5B78A 3PURA 2DX8A 1CHCA 1X4JA 4GNFA 5G0FA 2JMJA 1WEVA 2LV9A 4I7BA 4A4BA 4AUQB 5B8DA 4S3OB 2MD7B 3M62A 4AYCA 3O70A 3ASLA 3T6RA 2VJEB 5B75A 2PUYA 2VJFB 4R2YA 4W4UA 2XB1A 4PTBA 2KWNA 2D8SA 1WEUA 2FUIA 2LXPC 1FP0A 2ECTA 4LKAA 2LGVA 2L75A 1IYMA 4AVXA 1WEOA 3IHPA 3U5MA 3O36A 4PPEA 4CA1A 4FK5A 2LN0A 3KV6A 2KWOA 2E6SA 2YQMA 1BORA 2ECIA 4MSXA 1T1HA 2VPBA 4XI1A 3EB5A 1WIMA 4FO9A 3RPGB 3EB6A 2KE1A 2LRIC 2YQLA 2M85A 3N9LA 4AP4A 2K4DA 1WEPA 3DQVR 3LQIA 4UP5A 3ZVYA 4YADA 1N87A 3O37A 3O33A 4I7CA 1WE9A 2MUMA 2LGKA 4V3KC 5C11A 2RI7A 4UI9B 3N9QA 2F42A 5KH7A 1G25A 3U5OA 4R8PK 2JMDA 2ECGA 1WENA 5KH3A 4R7EA 1VD4A 3HCUA 2K16A 1JM7A 2L0BA 4LK9A 4QF2A 3O7AA 2ECNA 5D1LB 2CT2A 1Z2QA 2KU3A 2H0DA 5FERA 2YUCA 2VPEA 3I2DA 3HCTA 2ECVA 3N9NA 2Y43A 2K17A 4ZDTA 5FEYA 5FB1A 3MHSA 2L43A 3N9PA 3LQJA 4YBSA 5LKUA 3ZTGA 3L1XA 4LJNA 1LDKC 1WEQA 2CSZA 2HDPA 2PNXA 4X3GA 3ZPV1 2LXHC 5G04B 2QICA 4IC2A 2YSMA 4LADB 2G43A 1VFYA 2KGIA 5TABA 4F52B 5JG6A 2IDAA 4GNGA 2YW8A 2G45A 4YAXA 2MD8C 3M63A 1JOCA 1X4IA 3KQIA 2FSAA 3HTKC 1F62A 2F6JA 4A0CD 4B86C 4AYCB 1WGMA 2LGLA 4MVTA 2M6MA 1MM3A 3V43A 4FJCA 2MA6A 2KR4A 3PUQA 2YU4A 2FUUA 2BAYA 4IC3A 2KREA 4A4CA 2UZGA 1WILA 2ZETC 5C13A 2EA6A 5LKXA 3SOUA 2MIQA 2QJ0A 2YYRA 3N9MA 2KYUA 5LCWB 1HYJA 4WZ0A 2I50A 4CCGX 2YHNA 1U6GB 5D1KB 5TBNA 4QF3A 5G05B 3SOXA 5EYAF 2YURA 4N3WA 3ZVZB 5AIUA 4GNDA 2ECWA 1RMDA 2VNFA 4YATA 2HYED 5H1VA 4GNEA 4B7YC 1Z6UA 2L5UA 3C6WA 2MNZA 2KWJA 2VP7A 2CSYA 2E6RA 2LDRA 3KNVA 4L7XA 3QZVA 1DVPA 2JMIA 3LRQA 1WEEA 4NN2A 2YHOA 3MHHA 3T7LA 4A49A 2M3HA 2K1JA 2XEUA 3GV4A 3O35A 2VJFA 1JM7B 4FIPA 5DINA 1V87A 2Y1MA 2MT5A 2YREA 2YSJA 4TKPB 2H0DB 4WZ3B 4I7DA 1ZBDB 5TDRA 1E4UA 3PHDA 5KH9A 3O34A 4C9ZA 2G6QA 2L80A 3ZNIA 5I3LA 1MM2A 3RTRB 2NAAA 2QIZA 5H1TA 3KV5A 5TDWA 5DKAA 3HCSA 3SOWA 2CKLA 5J3XA 4ZQLA 2KGGA 2MA5A 2KIZA 3M99A 5FB0A 2M1RA 4P5OB 5B79A 4YABA 2VPGA 3ZPVE 1WEWA 5AITA 4L58A 3ZYQA 3GL6A 2EODA 4WZ2A 3L11A 4V3LC 4WA6A 4UP0A 2CKLB 5B77A 5TRBA 5H1UA 5B76A 3FL2A 2KWKA 4S3OC 3L1ZB 2LGGA 3LQHA 1Z60A 5LKTA 1VYXA 4YBTA 4N4FA 3SHBA 5LKZA 2MNYA 3U5NA 5D1MB 4LLBA 2JRJA 2LQ6A 2OXQC
chains in the Genus database with same CATH superfamily
2AN6A 2EGPA 4O64A 4BBQA 4Q6FA 2E61A 2YT5A 2Y1NA 3DPLR 4GB0A 5H9MA 4YBMA 4BHWA 2ECJA 2RSDA 3N9OA 1WEMA 4ZUXU 4YC9A 1K2FA 2IQJA 2CONA 2M13A 3NG2A 2C2VS 1WFKA 2VPDA 4OGCA 2MKEA 3C5KA 1FBVA 1X4UA 2VJEA 1HYIA 2F6NA 1LDJB 3U5PA 5SVXA 3VK6A 2KKYA 3LVQE 2KFTA 1WESA 2C2LA 1XWHA 3RPGC 5B78A 3PURA 2DX8A 3KDEC 1CHCA 1X4JA 4GNFA 5G0FA 2JMJA 1WEVA 2LV9A 2JUNA 4I7BA 4A4BA 4AUQB 5B8DA 3DWDA 4S3OB 2MD7B 3M62A 4AYCA 3O70A 3ASLA 3T6RA 2VJEB 5B75A 2CRRA 2PUYA 2VJFB 4R2YA 4W4UA 2XB1A 4PTBA 2KWNA 2D8SA 1WEUA 2FUIA 2LXPC 3FAOA 1FP0A 2ECTA 2DJAA 4LKAA 5SVIA 2LGVA 2L75A 3FANA 3PLWA 1IYMA 4AVXA 2OWAA 1WEOA 3IHPA 3U5MA 2P57A 3O36A 4PPEA 4CA1A 4FK5A 2LN0A 3KV6A 2KWOA 2E6SA 2LAUA 2YQMA 1BORA 2ECIA 4MSXA 5SVYA 1T1HA 2VPBA 4XI1A 3EB5A 1WIMA 4FO9A 3RPGB 3EB6A 2EXUA 2KE1A 2XOZA 2LRIC 2YQLA 2M85A 3N9LA 4AP4A 2K4DA 1WEPA 3DQVR 3LQIA 4UP5A 2CSVA 3ZVYA 4YADA 1N87A 3O37A 3O33A 4I7CA 1WE9A 2MUMA 2LGKA 4V3KC 5K3QA 5C11A 2RI7A 4UI9B 3N9QA 2F42A 2L7PA 5KH7A 1G25A 3U5OA 4R8PK 4H9DA 2JMDA 2ECGA 1WENA 5KH3A 4R7EA 1VD4A 3HCUA 2K16A 2FFWA 1JM7A 2L0BA 4LK9A 4QF2A 3O7AA 2ECNA 5D1LB 2CT2A 1Z2QA 2KU3A 2H0DA 5FERA 2YUCA 2VPEA 3O47A 3I2DA 3HCTA 2ECVA 3N9NA 2Y43A 2K17A 4ZDTA 5FEYA 5FB1A 3MHSA 2L43A 3N9PA 3LQJA 4YBSA 5LKUA 3ZTGA 3L1XA 4LJNA 3FEHA 2CRWA 1LDKC 1WEQA 2CSZA 2HDPA 2PNXA 4X3GA 3ZPV1 2XP0A 4O62A 2LXHC 5G04B 2QICA 4IC2A 4LADB 2YSMA 2G43A 4OGEA 3FM8C 1VFYA 2KGIA 5TABA 4F52B 5JG6A 2IDAA 4GNGA 2YW8A 2G45A 4YAXA 2XOYA 2MD8C 3M63A 1JOCA 1X4IA 3KQIA 2FSAA 3HTKC 1F62A 2F6JA 2EGMA 4A0CD 4B86C 4AYCB 2XOCA 1WGMA 2LGLA 4MVTA 2M6MA 1MM3A 3V43A 4FJCA 2MA6A 2KR4A 3PUQA 2YU4A 2FUUA 2BAYA 4IC3A 2KREA 4A4CA 2UZGA 1WILA 5SVIB 2ZETC 5C13A 2EA6A 5LKXA 3SOUA 2MIQA 2QJ0A 2YYRA 3E2DA 3N9MA 2KYUA 5LCWB 1HYJA 4WZ0A 2I50A 4CCGX 2YHNA 1U6GB 2DSMA 5D1KB 5TBNA 4QF3A 5G05B 3M7KA 3SOXA 5EYAF 2YURA 4N3WA 4Z0OA 3ZVZB 5AIUA 4GNDA 2ECWA 1RMDA 2VNFA 4YATA 2HYED 5H1VA 4GNEA 4B7YC 1Z6UA 2L5UA 3C6WA 2MNZA 3LJUX 2KWJA 3SUBA 2KKXA 2VP7A 2FD4A 2CSYA 2E6RA 2LDRA 3KNVA 4L7XA 3QZVA 1DVPA 4QQ4A 2JMIA 3LRQA 3H7HA 3LDYA 1WEEA 4NN2A 3MHHA 2YHOA 3T7LA 3FJUB 2D8UA 4A49A 2M3HA 2K1JA 2XEUA 3GV4A 3O35A 2VJFA 1JM7B 4FIPA 5DINA 1V87A 2Y1MA 2MT5A 3JUEA 2YREA 2YSJA 4TKPB 2H0DB 4WZ3B 4I7DA 1ZBDB 4F1PA 5TDRA 1E4UA 3PHDA 3Q1DA 5KH9A 3O34A 4C9ZA 2B0OE 2G6QA 2L80A 3ZNIA 5I3LA 1MM2A 3RTRB 2NAAA 2QIZA 5H1TA 3KV5A 5TDWA 5DKAA 3HCSA 3SOWA 2CKLA 2RR4A 4ZQLA 5J3XA 2KGGA 2MA5A 2KIZA 3M99A 3LVRE 5FB0A 2M1RA 4P5OB 5B79A 1DCQA 3T9KA 4YABA 2VPGA 3ZPVE 1WEWA 4Z0RA 5AITA 4L58A 3ZYQA 3GL6A 2EODA 2YVRA 4WZ2A 3L11A 1MBMA 4V3LC 3DDTA 3MDBC 4WA6A 4UP0A 2CKLB 5B77A 5TRBA 5H1UA 5B76A 2JM3A 3FL2A 2KWKA 4S3OC 3L1ZB 2LGGA 3LQHA 1Z60A 5LKTA 1VYXA 4YBTA 4N4FA 3SHBA 5LKZA 2MNYA 3U5NA 5D1MB 4LLBA 2JRJA 2LQ6A 2OXQC
chains in the Genus database with same CATH topology
2AN6A 2EGPA 4O64A 4BBQA 4Q6FA 2YT5A 2Y1NA 3DPLR 4GB0A 5H9MA 4YBMA 4BHWA 2ECJA 2RSDA 3N9OA 1WEMA 4ZUXU 4YC9A 1K2FA 3NG2A 2C2VS 1WFKA 2VPDA 3C5KA 1FBVA 1X4UA 2VJEA 1HYIA 2F6NA 1LDJB 3U5PA 3VK6A 2KFTA 1WESA 2C2LA 1XWHA 3RPGC 5B78A 3PURA 2DX8A 1CHCA 1X4JA 4GNFA 5G0FA 2JMJA 1WEVA 2LV9A 4I7BA 4A4BA 4AUQB 5B8DA 4S3OB 2MD7B 3M62A 4AYCA 3O70A 3ASLA 3T6RA 2VJEB 5B75A 2PUYA 2VJFB 4R2YA 4W4UA 2XB1A 4PTBA 2KWNA 2D8SA 1WEUA 2FUIA 2LXPC 1FP0A 2ECTA 4LKAA 2LGVA 2L75A 1IYMA 4AVXA 1WEOA 3IHPA 3U5MA 3O36A 4PPEA 4CA1A 4FK5A 2LN0A 3KV6A 2KWOA 2E6SA 2YQMA 1BORA 2ECIA 4MSXA 1T1HA 2VPBA 4XI1A 3EB5A 1WIMA 4FO9A 3RPGB 3EB6A 2KE1A 2LRIC 2YQLA 2M85A 3N9LA 4AP4A 2K4DA 1WEPA 3DQVR 3LQIA 4UP5A 3ZVYA 4YADA 1N87A 3O37A 3O33A 4I7CA 1WE9A 2MUMA 2LGKA 4V3KC 5C11A 2RI7A 4UI9B 3N9QA 2F42A 5KH7A 1G25A 3U5OA 4R8PK 2JMDA 2ECGA 1WENA 5KH3A 4R7EA 1VD4A 3HCUA 2K16A 1JM7A 2L0BA 4LK9A 4QF2A 3O7AA 2ECNA 5D1LB 2CT2A 1Z2QA 2KU3A 2H0DA 5FERA 2YUCA 2VPEA 3I2DA 3HCTA 2ECVA 3N9NA 2Y43A 2K17A 4ZDTA 5FEYA 5FB1A 3MHSA 2L43A 3N9PA 3LQJA 4YBSA 5LKUA 3ZTGA 3L1XA 4LJNA 1LDKC 1WEQA 2CSZA 2HDPA 2PNXA 4X3GA 3ZPV1 2LXHC 5G04B 2QICA 4IC2A 2YSMA 4LADB 2G43A 1VFYA 2KGIA 5TABA 4F52B 5JG6A 2IDAA 4GNGA 2YW8A 2G45A 4YAXA 2MD8C 3M63A 1JOCA 1X4IA 3KQIA 2FSAA 3HTKC 1F62A 2F6JA 4A0CD 4B86C 4AYCB 1WGMA 2LGLA 4MVTA 2M6MA 1MM3A 3V43A 4FJCA 2MA6A 2KR4A 3PUQA 2YU4A 2FUUA 2BAYA 4IC3A 2KREA 4A4CA 2UZGA 1WILA 2ZETC 5C13A 2EA6A 5LKXA 3SOUA 2MIQA 2QJ0A 2YYRA 3N9MA 2KYUA 5LCWB 1HYJA 4WZ0A 2I50A 4CCGX 2YHNA 1U6GB 5D1KB 5TBNA 4QF3A 5G05B 3SOXA 5EYAF 2YURA 4N3WA 3ZVZB 5AIUA 4GNDA 2ECWA 1RMDA 2VNFA 4YATA 2HYED 5H1VA 4GNEA 4B7YC 1Z6UA 2L5UA 3C6WA 2MNZA 2KWJA 2VP7A 2CSYA 2E6RA 2LDRA 3KNVA 4L7XA 3QZVA 1DVPA 2JMIA 3LRQA 1WEEA 4NN2A 2YHOA 3MHHA 3T7LA 4A49A 2M3HA 2K1JA 2XEUA 3GV4A 3O35A 2VJFA 1JM7B 4FIPA 5DINA 1V87A 2Y1MA 2MT5A 2YREA 2YSJA 4TKPB 2H0DB 4WZ3B 4I7DA 1ZBDB 5TDRA 1E4UA 3PHDA 5KH9A 3O34A 4C9ZA 2G6QA 2L80A 3ZNIA 5I3LA 1MM2A 3RTRB 2NAAA 2QIZA 5H1TA 3KV5A 5TDWA 5DKAA 3HCSA 3SOWA 2CKLA 5J3XA 4ZQLA 2KGGA 2MA5A 2KIZA 3M99A 5FB0A 2M1RA 4P5OB 5B79A 4YABA 2VPGA 3ZPVE 1WEWA 5AITA 4L58A 3ZYQA 3GL6A 2EODA 4WZ2A 3L11A 4V3LC 4WA6A 4UP0A 2CKLB 5B77A 5TRBA 5H1UA 5B76A 3FL2A 2KWKA 4S3OC 3L1ZB 2LGGA 3LQHA 1Z60A 5LKTA 1VYXA 4YBTA 4N4FA 3SHBA 5LKZA 2MNYA 3U5NA 5D1MB 4LLBA 2JRJA 2LQ6A 2OXQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AN6 A;  2EGP A;  4O64 A;  4BBQ A;  4Q6F A;  2YT5 A;  2Y1N A;  3DPL R;  4GB0 A;  5H9M A;  4YBM A;  4BHW A;  2ECJ A;  2RSD A;  3N9O A;  1WEM A;  4ZUX U;  4YC9 A;  1K2F A;  3NG2 A;  2C2V S;  1WFK A;  2VPD A;  3C5K A;  1FBV A;  1X4U A;  2VJE A;  1HYI A;  2F6N A;  1LDJ B;  3U5P A;  3VK6 A;  2KFT A;  1WES A;  2C2L A;  1XWH A;  3RPG C;  5B78 A;  3PUR A;  2DX8 A;  1CHC A;  1X4J A;  4GNF A;  5G0F A;  2JMJ A;  1WEV A;  2LV9 A;  4I7B A;  4A4B A;  4AUQ B;  5B8D A;  4S3O B;  2MD7 B;  3M62 A;  4AYC A;  3O70 A;  3ASL A;  3T6R A;  2VJE B;  5B75 A;  2PUY A;  2VJF B;  4R2Y A;  4W4U A;  2XB1 A;  4PTB A;  2KWN A;  2D8S A;  1WEU A;  2FUI A;  2LXP C;  1FP0 A;  2ECT A;  4LKA A;  2LGV A;  2L75 A;  1IYM A;  4AVX A;  1WEO A;  3IHP A;  3U5M A;  3O36 A;  4PPE A;  4CA1 A;  4FK5 A;  2LN0 A;  3KV6 A;  2KWO A;  2E6S A;  2YQM A;  1BOR A;  2ECI A;  4MSX A;  1T1H A;  2VPB A;  4XI1 A;  3EB5 A;  1WIM A;  4FO9 A;  3RPG B;  3EB6 A;  2KE1 A;  2LRI C;  2YQL A;  2M85 A;  3N9L A;  4AP4 A;  2K4D A;  1WEP A;  3DQV R;  3LQI A;  4UP5 A;  3ZVY A;  4YAD A;  1N87 A;  3O37 A;  3O33 A;  4I7C A;  1WE9 A;  2MUM A;  2LGK A;  4V3K C;  5C11 A;  2RI7 A;  4UI9 B;  3N9Q A;  2F42 A;  5KH7 A;  1G25 A;  3U5O A;  4R8P K;  2JMD A;  2ECG A;  1WEN A;  5KH3 A;  4R7E A;  1VD4 A;  3HCU A;  2K16 A;  1JM7 A;  2L0B A;  4LK9 A;  4QF2 A;  3O7A A;  2ECN A;  5D1L B;  2CT2 A;  1Z2Q A;  2KU3 A;  2H0D A;  5FER A;  2YUC A;  2VPE A;  3I2D A;  3HCT A;  2ECV A;  3N9N A;  2Y43 A;  2K17 A;  4ZDT A;  5FEY A;  5FB1 A;  3MHS A;  2L43 A;  3N9P A;  3LQJ A;  4YBS A;  5LKU A;  3ZTG A;  3L1X A;  4LJN A;  1LDK C;  1WEQ A;  2CSZ A;  2HDP A;  2PNX A;  4X3G A;  3ZPV 1;  2LXH C;  5G04 B;  2QIC A;  4IC2 A;  2YSM A;  4LAD B;  2G43 A;  1VFY A;  2KGI A;  5TAB A;  4F52 B;  5JG6 A;  2IDA A;  4GNG A;  2YW8 A;  2G45 A;  4YAX A;  2MD8 C;  3M63 A;  1JOC A;  1X4I A;  3KQI A;  2FSA A;  3HTK C;  1F62 A;  2F6J A;  4A0C D;  4B86 C;  4AYC B;  1WGM A;  2LGL A;  4MVT A;  2M6M A;  1MM3 A;  3V43 A;  4FJC A;  2MA6 A;  2KR4 A;  3PUQ A;  2YU4 A;  2FUU A;  2BAY A;  4IC3 A;  2KRE A;  4A4C A;  2UZG A;  1WIL A;  2ZET C;  5C13 A;  2EA6 A;  5LKX A;  3SOU A;  2MIQ A;  2QJ0 A;  2YYR A;  3N9M A;  2KYU A;  5LCW B;  1HYJ A;  4WZ0 A;  2I50 A;  4CCG X;  2YHN A;  1U6G B;  5D1K B;  5TBN A;  4QF3 A;  5G05 B;  3SOX A;  5EYA F;  2YUR A;  4N3W A;  3ZVZ B;  5AIU A;  4GND A;  2ECW A;  1RMD A;  2VNF A;  4YAT A;  2HYE D;  5H1V A;  4GNE A;  4B7Y C;  1Z6U A;  2L5U A;  3C6W A;  2MNZ A;  2KWJ A;  2VP7 A;  2CSY A;  2E6R A;  2LDR A;  3KNV A;  4L7X A;  3QZV A;  1DVP A;  2JMI A;  3LRQ A;  1WEE A;  4NN2 A;  2YHO A;  3MHH A;  3T7L A;  4A49 A;  2M3H A;  2K1J A;  2XEU A;  3GV4 A;  3O35 A;  2VJF A;  1JM7 B;  4FIP A;  5DIN A;  1V87 A;  2Y1M A;  2MT5 A;  2YRE A;  2YSJ A;  4TKP B;  2H0D B;  4WZ3 B;  4I7D A;  1ZBD B;  5TDR A;  1E4U A;  3PHD A;  5KH9 A;  3O34 A;  4C9Z A;  2G6Q A;  2L80 A;  3ZNI A;  5I3L A;  1MM2 A;  3RTR B;  2NAA A;  2QIZ A;  5H1T A;  3KV5 A;  5TDW A;  5DKA A;  3HCS A;  3SOW A;  2CKL A;  5J3X A;  4ZQL A;  2KGG A;  2MA5 A;  2KIZ A;  3M99 A;  5FB0 A;  2M1R A;  4P5O B;  5B79 A;  4YAB A;  2VPG A;  3ZPV E;  1WEW A;  5AIT A;  4L58 A;  3ZYQ A;  3GL6 A;  2EOD A;  4WZ2 A;  3L11 A;  4V3L C;  4WA6 A;  4UP0 A;  2CKL B;  5B77 A;  5TRB A;  5H1U A;  5B76 A;  3FL2 A;  2KWK A;  4S3O C;  3L1Z B;  2LGG A;  3LQH A;  1Z60 A;  5LKT A;  1VYX A;  4YBT A;  4N4F A;  3SHB A;  5LKZ A;  2MNY A;  3U5N A;  5D1M B;  4LLB A;  2JRJ A;  2LQ6 A;  2OXQ C; 
#chains in the Genus database with same CATH topology
 2AN6 A;  2EGP A;  4O64 A;  4BBQ A;  4Q6F A;  2E61 A;  2YT5 A;  2Y1N A;  3DPL R;  4GB0 A;  5H9M A;  4YBM A;  4BHW A;  2ECJ A;  2RSD A;  3N9O A;  1WEM A;  4ZUX U;  4YC9 A;  1K2F A;  2IQJ A;  2CON A;  2M13 A;  3NG2 A;  2C2V S;  1WFK A;  2VPD A;  4OGC A;  2MKE A;  3C5K A;  1FBV A;  1X4U A;  2VJE A;  1HYI A;  2F6N A;  1LDJ B;  3U5P A;  5SVX A;  3VK6 A;  2KKY A;  3LVQ E;  2KFT A;  1WES A;  2C2L A;  1XWH A;  3RPG C;  5B78 A;  3PUR A;  2DX8 A;  3KDE C;  1CHC A;  1X4J A;  4GNF A;  5G0F A;  2JMJ A;  1WEV A;  2LV9 A;  2JUN A;  4I7B A;  4A4B A;  4AUQ B;  5B8D A;  3DWD A;  4S3O B;  2MD7 B;  3M62 A;  4AYC A;  3O70 A;  3ASL A;  3T6R A;  2VJE B;  5B75 A;  2CRR A;  2PUY A;  2VJF B;  4R2Y A;  4W4U A;  2XB1 A;  4PTB A;  2KWN A;  2D8S A;  1WEU A;  2FUI A;  2LXP C;  3FAO A;  1FP0 A;  2ECT A;  2DJA A;  4LKA A;  5SVI A;  2LGV A;  2L75 A;  3FAN A;  3PLW A;  1IYM A;  4AVX A;  2OWA A;  1WEO A;  3IHP A;  3U5M A;  2P57 A;  3O36 A;  4PPE A;  4CA1 A;  4FK5 A;  2LN0 A;  3KV6 A;  2KWO A;  2E6S A;  2LAU A;  2YQM A;  1BOR A;  2ECI A;  4MSX A;  5SVY A;  1T1H A;  2VPB A;  4XI1 A;  3EB5 A;  1WIM A;  4FO9 A;  3RPG B;  3EB6 A;  2EXU A;  2KE1 A;  2XOZ A;  2LRI C;  2YQL A;  2M85 A;  3N9L A;  4AP4 A;  2K4D A;  1WEP A;  3DQV R;  3LQI A;  4UP5 A;  2CSV A;  3ZVY A;  4YAD A;  1N87 A;  3O37 A;  3O33 A;  4I7C A;  1WE9 A;  2MUM A;  2LGK A;  4V3K C;  5K3Q A;  5C11 A;  2RI7 A;  4UI9 B;  3N9Q A;  2F42 A;  2L7P A;  5KH7 A;  1G25 A;  3U5O A;  4R8P K;  4H9D A;  2JMD A;  2ECG A;  1WEN A;  5KH3 A;  4R7E A;  1VD4 A;  3HCU A;  2K16 A;  2FFW A;  1JM7 A;  2L0B A;  4LK9 A;  4QF2 A;  3O7A A;  2ECN A;  5D1L B;  2CT2 A;  1Z2Q A;  2KU3 A;  2H0D A;  5FER A;  2YUC A;  2VPE A;  3O47 A;  3I2D A;  3HCT A;  2ECV A;  3N9N A;  2Y43 A;  2K17 A;  4ZDT A;  5FEY A;  5FB1 A;  3MHS A;  2L43 A;  3N9P A;  3LQJ A;  4YBS A;  5LKU A;  3ZTG A;  3L1X A;  4LJN A;  3FEH A;  2CRW A;  1LDK C;  1WEQ A;  2CSZ A;  2HDP A;  2PNX A;  4X3G A;  3ZPV 1;  2XP0 A;  4O62 A;  2LXH C;  5G04 B;  2QIC A;  4IC2 A;  4LAD B;  2YSM A;  2G43 A;  4OGE A;  3FM8 C;  1VFY A;  2KGI A;  5TAB A;  4F52 B;  5JG6 A;  2IDA A;  4GNG A;  2YW8 A;  2G45 A;  4YAX A;  2XOY A;  2MD8 C;  3M63 A;  1JOC A;  1X4I A;  3KQI A;  2FSA A;  3HTK C;  1F62 A;  2F6J A;  2EGM A;  4A0C D;  4B86 C;  4AYC B;  2XOC A;  1WGM A;  2LGL A;  4MVT A;  2M6M A;  1MM3 A;  3V43 A;  4FJC A;  2MA6 A;  2KR4 A;  3PUQ A;  2YU4 A;  2FUU A;  2BAY A;  4IC3 A;  2KRE A;  4A4C A;  2UZG A;  1WIL A;  5SVI B;  2ZET C;  5C13 A;  2EA6 A;  5LKX A;  3SOU A;  2MIQ A;  2QJ0 A;  2YYR A;  3E2D A;  3N9M A;  2KYU A;  5LCW B;  1HYJ A;  4WZ0 A;  2I50 A;  4CCG X;  2YHN A;  1U6G B;  2DSM A;  5D1K B;  5TBN A;  4QF3 A;  5G05 B;  3M7K A;  3SOX A;  5EYA F;  2YUR A;  4N3W A;  4Z0O A;  3ZVZ B;  5AIU A;  4GND A;  2ECW A;  1RMD A;  2VNF A;  4YAT A;  2HYE D;  5H1V A;  4GNE A;  4B7Y C;  1Z6U A;  2L5U A;  3C6W A;  2MNZ A;  3LJU X;  2KWJ A;  3SUB A;  2KKX A;  2VP7 A;  2FD4 A;  2CSY A;  2E6R A;  2LDR A;  3KNV A;  4L7X A;  3QZV A;  1DVP A;  4QQ4 A;  2JMI A;  3LRQ A;  3H7H A;  3LDY A;  1WEE A;  4NN2 A;  3MHH A;  2YHO A;  3T7L A;  3FJU B;  2D8U A;  4A49 A;  2M3H A;  2K1J A;  2XEU A;  3GV4 A;  3O35 A;  2VJF A;  1JM7 B;  4FIP A;  5DIN A;  1V87 A;  2Y1M A;  2MT5 A;  3JUE A;  2YRE A;  2YSJ A;  4TKP B;  2H0D B;  4WZ3 B;  4I7D A;  1ZBD B;  4F1P A;  5TDR A;  1E4U A;  3PHD A;  3Q1D A;  5KH9 A;  3O34 A;  4C9Z A;  2B0O E;  2G6Q A;  2L80 A;  3ZNI A;  5I3L A;  1MM2 A;  3RTR B;  2NAA A;  2QIZ A;  5H1T A;  3KV5 A;  5TDW A;  5DKA A;  3HCS A;  3SOW A;  2CKL A;  2RR4 A;  4ZQL A;  5J3X A;  2KGG A;  2MA5 A;  2KIZ A;  3M99 A;  3LVR E;  5FB0 A;  2M1R A;  4P5O B;  5B79 A;  1DCQ A;  3T9K A;  4YAB A;  2VPG A;  3ZPV E;  1WEW A;  4Z0R A;  5AIT A;  4L58 A;  3ZYQ A;  3GL6 A;  2EOD A;  2YVR A;  4WZ2 A;  3L11 A;  1MBM A;  4V3L C;  3DDT A;  3MDB C;  4WA6 A;  4UP0 A;  2CKL B;  5B77 A;  5TRB A;  5H1U A;  5B76 A;  2JM3 A;  3FL2 A;  2KWK A;  4S3O C;  3L1Z B;  2LGG A;  3LQH A;  1Z60 A;  5LKT A;  1VYX A;  4YBT A;  4N4F A;  3SHB A;  5LKZ A;  2MNY A;  3U5N A;  5D1M B;  4LLB A;  2JRJ A;  2LQ6 A;  2OXQ C; 
#chains in the Genus database with same CATH homology
 2AN6 A;  2EGP A;  4O64 A;  4BBQ A;  4Q6F A;  2YT5 A;  2Y1N A;  3DPL R;  4GB0 A;  5H9M A;  4YBM A;  4BHW A;  2ECJ A;  2RSD A;  3N9O A;  1WEM A;  4ZUX U;  4YC9 A;  1K2F A;  3NG2 A;  2C2V S;  1WFK A;  2VPD A;  3C5K A;  1FBV A;  1X4U A;  2VJE A;  1HYI A;  2F6N A;  1LDJ B;  3U5P A;  3VK6 A;  2KFT A;  1WES A;  2C2L A;  1XWH A;  3RPG C;  5B78 A;  3PUR A;  2DX8 A;  1CHC A;  1X4J A;  4GNF A;  5G0F A;  2JMJ A;  1WEV A;  2LV9 A;  4I7B A;  4A4B A;  4AUQ B;  5B8D A;  4S3O B;  2MD7 B;  3M62 A;  4AYC A;  3O70 A;  3ASL A;  3T6R A;  2VJE B;  5B75 A;  2PUY A;  2VJF B;  4R2Y A;  4W4U A;  2XB1 A;  4PTB A;  2KWN A;  2D8S A;  1WEU A;  2FUI A;  2LXP C;  1FP0 A;  2ECT A;  4LKA A;  2LGV A;  2L75 A;  1IYM A;  4AVX A;  1WEO A;  3IHP A;  3U5M A;  3O36 A;  4PPE A;  4CA1 A;  4FK5 A;  2LN0 A;  3KV6 A;  2KWO A;  2E6S A;  2YQM A;  1BOR A;  2ECI A;  4MSX A;  1T1H A;  2VPB A;  4XI1 A;  3EB5 A;  1WIM A;  4FO9 A;  3RPG B;  3EB6 A;  2KE1 A;  2LRI C;  2YQL A;  2M85 A;  3N9L A;  4AP4 A;  2K4D A;  1WEP A;  3DQV R;  3LQI A;  4UP5 A;  3ZVY A;  4YAD A;  1N87 A;  3O37 A;  3O33 A;  4I7C A;  1WE9 A;  2MUM A;  2LGK A;  4V3K C;  5C11 A;  2RI7 A;  4UI9 B;  3N9Q A;  2F42 A;  5KH7 A;  1G25 A;  3U5O A;  4R8P K;  2JMD A;  2ECG A;  1WEN A;  5KH3 A;  4R7E A;  1VD4 A;  3HCU A;  2K16 A;  1JM7 A;  2L0B A;  4LK9 A;  4QF2 A;  3O7A A;  2ECN A;  5D1L B;  2CT2 A;  1Z2Q A;  2KU3 A;  2H0D A;  5FER A;  2YUC A;  2VPE A;  3I2D A;  3HCT A;  2ECV A;  3N9N A;  2Y43 A;  2K17 A;  4ZDT A;  5FEY A;  5FB1 A;  3MHS A;  2L43 A;  3N9P A;  3LQJ A;  4YBS A;  5LKU A;  3ZTG A;  3L1X A;  4LJN A;  1LDK C;  1WEQ A;  2CSZ A;  2HDP A;  2PNX A;  4X3G A;  3ZPV 1;  2LXH C;  5G04 B;  2QIC A;  4IC2 A;  2YSM A;  4LAD B;  2G43 A;  1VFY A;  2KGI A;  5TAB A;  4F52 B;  5JG6 A;  2IDA A;  4GNG A;  2YW8 A;  2G45 A;  4YAX A;  2MD8 C;  3M63 A;  1JOC A;  1X4I A;  3KQI A;  2FSA A;  3HTK C;  1F62 A;  2F6J A;  4A0C D;  4B86 C;  4AYC B;  1WGM A;  2LGL A;  4MVT A;  2M6M A;  1MM3 A;  3V43 A;  4FJC A;  2MA6 A;  2KR4 A;  3PUQ A;  2YU4 A;  2FUU A;  2BAY A;  4IC3 A;  2KRE A;  4A4C A;  2UZG A;  1WIL A;  2ZET C;  5C13 A;  2EA6 A;  5LKX A;  3SOU A;  2MIQ A;  2QJ0 A;  2YYR A;  3N9M A;  2KYU A;  5LCW B;  1HYJ A;  4WZ0 A;  2I50 A;  4CCG X;  2YHN A;  1U6G B;  5D1K B;  5TBN A;  4QF3 A;  5G05 B;  3SOX A;  5EYA F;  2YUR A;  4N3W A;  3ZVZ B;  5AIU A;  4GND A;  2ECW A;  1RMD A;  2VNF A;  4YAT A;  2HYE D;  5H1V A;  4GNE A;  4B7Y C;  1Z6U A;  2L5U A;  3C6W A;  2MNZ A;  2KWJ A;  2VP7 A;  2CSY A;  2E6R A;  2LDR A;  3KNV A;  4L7X A;  3QZV A;  1DVP A;  2JMI A;  3LRQ A;  1WEE A;  4NN2 A;  2YHO A;  3MHH A;  3T7L A;  4A49 A;  2M3H A;  2K1J A;  2XEU A;  3GV4 A;  3O35 A;  2VJF A;  1JM7 B;  4FIP A;  5DIN A;  1V87 A;  2Y1M A;  2MT5 A;  2YRE A;  2YSJ A;  4TKP B;  2H0D B;  4WZ3 B;  4I7D A;  1ZBD B;  5TDR A;  1E4U A;  3PHD A;  5KH9 A;  3O34 A;  4C9Z A;  2G6Q A;  2L80 A;  3ZNI A;  5I3L A;  1MM2 A;  3RTR B;  2NAA A;  2QIZ A;  5H1T A;  3KV5 A;  5TDW A;  5DKA A;  3HCS A;  3SOW A;  2CKL A;  5J3X A;  4ZQL A;  2KGG A;  2MA5 A;  2KIZ A;  3M99 A;  5FB0 A;  2M1R A;  4P5O B;  5B79 A;  4YAB A;  2VPG A;  3ZPV E;  1WEW A;  5AIT A;  4L58 A;  3ZYQ A;  3GL6 A;  2EOD A;  4WZ2 A;  3L11 A;  4V3L C;  4WA6 A;  4UP0 A;  2CKL B;  5B77 A;  5TRB A;  5H1U A;  5B76 A;  3FL2 A;  2KWK A;  4S3O C;  3L1Z B;  2LGG A;  3LQH A;  1Z60 A;  5LKT A;  1VYX A;  4YBT A;  4N4F A;  3SHB A;  5LKZ A;  2MNY A;  3U5N A;  5D1M B;  4LLB A;  2JRJ A;  2LQ6 A;  2OXQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...