2ECJA

Solution structure of the ring domain of the human tripartite motif-containing protein 39
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
58
structure length
58
Chain Sequence
GSSGSSGALENLQVEASCSVCLEYLKEPVIIECGHNFCKACITRWWEDLERDFPCPVC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tripartite motif-containing protein 39
publication title Solution structure of the RING domain of the human tripartite motif-containing protein 39
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 3
structure length 58
sequence length 58
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2007-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15227 zf-C3HC4_4 zinc finger of C3HC4-type, RING
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2ecjA00
3ZYQA 3N9MA 4I7BA 4GNEA 1JM7B 2CSYA 3O7AA 4Q6FA 1N87A 3ZPVE 2IDAA 5LKXA 1Z6UA 3GL6A 2KR4A 4A49A 2LV9A 2ECVA 3VK6A 1E4UA 3SOUA 5DKAA 2E6SA 2LXPC 2ECTA 2HDPA 3O70A 2Y1NA 2EGPA 3PURA 3T7LA 2VJEB 2LDRA 1WESA 2JMDA 5I3LA 5FB1A 2G45A 4W4UA 2VJFA 2NAAA 2MUMA 3N9PA 2YHNA 2LGGA 4A4CA 3N9NA 2F6JA 2MA5A 2JMIA 3KV6A 2K4DA 4ZUXU 4PPEA 4V3LC 5FERA 2EA6A 5KH3A 2ECWA 1T1HA 4S3OB 5AIUA 4X3GA 2YSMA 2KU3A 2ZETC 3EB5A 5D1MB 1JM7A 5G0FA 3ZVYA 3M63A 5TRBA 3FL2A 4UP0A 1WIMA 3EB6A 4CCGX 3SOWA 1VFYA 4QF3A 1MM3A 4XI1A 2K1JA 4PTBA 3M99A 3RTRB 4WA6A 2LGLA 5KH9A 1WILA 2Y43A 4LKAA 2YUCA 4LADB 4V3KC 4LK9A 5TABA 2VJEA 3LRQA 3U5NA 3SHBA 5JG6A 5TBNA 3QZVA 4F52B 4GNGA 2M3HA 2KFTA 4YBMA 2LQ6A 4AUQB 2M1RA 4I7CA 4A0CD 2VP7A 1Z2QA 1CHCA 4YBSA 2CT2A 3L1ZB 4C9ZA 2I50A 4R7EA 3V43A 2OXQC 2YQLA 2Y1MA 5J3XA 2L0BA 4ZDTA 3C6WA 3C5KA 5LCWB 2MA6A 1K2FA 1WEEA 2CSZA 2RSDA 3HCSA 5LKTA 4YATA 4YADA 2KWNA 3L11A 1WEMA 2QIZA 4GNDA 3LQHA 2QJ0A 1WEWA 2CKLB 2QICA 2H0DB 3O37A 2PNXA 5B78A 4BBQA 3M62A 5C13A 3O34A 4IC3A 2K16A 2YREA 1WEQA 3KV5A 4AYCA 2LRIC 4O64A 2MNYA 5H1UA 2VPDA 5C11A 5G05B 3U5PA 4LLBA 2LXHC 3DQVR 3O35A 4ZQLA 4UP5A 2HYED 4IC2A 4WZ0A 4N3WA 2DX8A 2YYRA 2VPEA 2KYUA 2KWJA 3N9LA 4L7XA 3IHPA 3HTKC 4A4BA 4FK5A 1LDJB 3PUQA 4I7DA 4GB0A 3T6RA 3U5MA 1HYJA 4YC9A 4AP4A 2ECJA 4B86C 2JMJA 1LDKC 1F62A 3N9QA 2PUYA 3RPGC 3NG2A 3O36A 1WE9A 2JRJA 3N9OA 1IYMA 5LKZA 3MHHA 5AITA 1FP0A 4NN2A 4FO9A 1ZBDB 2CKLA 2RI7A 1WEVA 2L43A 2ECGA 2YSJA 2YQMA 4LJNA 3HCTA 2KE1A 2F42A 2YU4A 4B7YC 2L80A 3PHDA 5LKUA 2C2VS 3O33A 2MNZA 2YHOA 4TKPB 1WEOA 5D1KB 4UI9B 2LGVA 2KWKA 2MD7B 2ECNA 4YBTA 2XB1A 3I2DA 1G25A 1VYXA 5DINA 4N4FA 1WENA 4CA1A 4QF2A 2L75A 4MVTA 4YABA 4MSXA 3LQJA 3RPGB 3MHSA 4R8PK 4YAXA 5H9MA 3ZPV1 5B79A 2UZGA 5B75A 1DVPA 1JOCA 1V87A 1WFKA 3HCUA 4WZ3B 4FIPA 5TDWA 2G43A 5TDRA 2EODA 2YW8A 2MT5A 2L5UA 2MIQA 1BORA 5FEYA 3GV4A 4WZ2A 2E6RA 1X4IA 2D8SA 1FBVA 2VPBA 2F6NA 3ASLA 1U6GB 5EYAF 4P5OB 5H1VA 2KREA 2YURA 5G04B 2VPGA 3U5OA 3ZVZB 1WEPA 4R2YA 2G6QA 2KGIA 3LQIA 2C2LA 2YT5A 3ZNIA 2M6MA 2ECIA 1X4UA 2LN0A 2VNFA 5B8DA 2FUUA 2FUIA 2K17A 4GNFA 1X4JA 3KNVA 2BAYA 5D1LB 1WEUA 3L1XA 4FJCA 1MM2A 2FSAA 5FB0A 2H0DA 2VJFB 2MD8C 5B76A 2XEUA 5KH7A 2LGKA 4AVXA 4L58A 3ZTGA 1XWHA 2KGGA 4AYCB 1Z60A 1RMDA 5H1TA 3DPLR 5B77A 1WGMA 1HYIA 1VD4A 2KIZA 2AN6A 2M85A 3KQIA 4S3OC 3SOXA 4BHWA 2KWOA
chains in the Genus database with same CATH superfamily
3ZYQA 3N9MA 4I7BA 4GNEA 1JM7B 2CSYA 3O7AA 4Q6FA 1N87A 3ZPVE 2IDAA 5LKXA 1Z6UA 3GL6A 3T9KA 2KR4A 4O62A 4A49A 2LV9A 3LJUX 2ECVA 3VK6A 1E4UA 3SOUA 5DKAA 2E6SA 2LXPC 2E61A 2ECTA 2HDPA 3O70A 2Y1NA 2EGPA 3PURA 3T7LA 2VJEB 3FANA 2LDRA 3LDYA 1WESA 4F1PA 5SVYA 2JMDA 5I3LA 2RR4A 5FB1A 2G45A 4W4UA 3E2DA 2VJFA 2NAAA 2MUMA 3N9PA 2YHNA 2LGGA 4A4CA 3N9NA 2F6JA 2MA5A 2JMIA 3KV6A 2K4DA 4ZUXU 4PPEA 4V3LC 5FERA 2EA6A 5KH3A 2ECWA 1T1HA 4S3OB 5AIUA 5SVIB 4X3GA 2YSMA 2JM3A 2KU3A 2ZETC 3EB5A 4QQ4A 5D1MB 1JM7A 5G0FA 3ZVYA 3M63A 5TRBA 3FL2A 4UP0A 1WIMA 3EB6A 4CCGX 3SOWA 1VFYA 4QF3A 1MM3A 4XI1A 2K1JA 4PTBA 3M99A 3RTRB 4WA6A 2LGLA 5KH9A 4OGEA 1WILA 2Y43A 3DWDA 4LKAA 2YUCA 4LADB 4V3KC 4LK9A 5TABA 2VJEA 3LRQA 3U5NA 2XOYA 3SHBA 5JG6A 5TBNA 1MBMA 3JUEA 3QZVA 4F52B 4GNGA 2M3HA 2KFTA 4YBMA 2LQ6A 4AUQB 5SVXA 2M1RA 4I7CA 2KKYA 4A0CD 2VP7A 1Z2QA 1CHCA 4YBSA 2CT2A 3L1ZB 2YVRA 4C9ZA 2I50A 3SUBA 5K3QA 3FJUB 4R7EA 3V43A 2DJAA 2OXQC 2YQLA 4OGCA 2Y1MA 5J3XA 2L0BA 4ZDTA 3C6WA 3C5KA 5LCWB 2XP0A 2MA6A 1K2FA 1WEEA 2CSZA 2RSDA 3HCSA 3FAOA 5LKTA 4YATA 4YADA 2KWNA 3L11A 1WEMA 2OWAA 2QIZA 4GNDA 3LQHA 2QJ0A 1WEWA 2CKLB 2QICA 2H0DB 3O37A 2PNXA 5B78A 4BBQA 3M7KA 2D8UA 3M62A 2M13A 2FFWA 5C13A 3O34A 4IC3A 2EXUA 3KDEC 2K16A 2YREA 1WEQA 3KV5A 4AYCA 2LRIC 4O64A 2MNYA 5H1UA 2VPDA 5C11A 5G05B 3U5PA 4LLBA 2LXHC 3DQVR 3O35A 4ZQLA 4UP5A 2CRRA 2HYED 4IC2A 4WZ0A 2B0OE 4N3WA 2DX8A 2YYRA 2VPEA 2KYUA 2KWJA 3O47A 3N9LA 4L7XA 3H7HA 3IHPA 3HTKC 4A4BA 4FK5A 1LDJB 3PUQA 4I7DA 4GB0A 3T6RA 3U5MA 1HYJA 4YC9A 2CONA 4AP4A 2ECJA 4B86C 2JMJA 1LDKC 1F62A 3N9QA 2PUYA 3RPGC 3NG2A 3O36A 1WE9A 3MDBC 2JRJA 3N9OA 1IYMA 5LKZA 3MHHA 5AITA 1FP0A 2JUNA 4NN2A 4FO9A 1ZBDB 2CKLA 2RI7A 1WEVA 2L43A 2ECGA 2YSJA 2YQMA 4LJNA 3HCTA 2KE1A 2F42A 2YU4A 4B7YC 2L80A 3PHDA 5LKUA 2C2VS 4Z0OA 2IQJA 3O33A 1DCQA 5SVIA 3LVQE 2MNZA 2YHOA 4TKPB 1WEOA 5D1KB 3FEHA 4UI9B 2LGVA 2KWKA 2MD7B 2ECNA 4YBTA 3FM8C 2XB1A 2L7PA 2FD4A 3I2DA 1G25A 1VYXA 5DINA 4N4FA 1WENA 4CA1A 4QF2A 2EGMA 2L75A 4MVTA 4YABA 4MSXA 3LQJA 3RPGB 3MHSA 4R8PK 4YAXA 5H9MA 3ZPV1 5B79A 2UZGA 5B75A 1DVPA 1JOCA 1V87A 1WFKA 3HCUA 4WZ3B 4FIPA 5TDWA 2G43A 5TDRA 2EODA 2YW8A 2MT5A 4H9DA 2KKXA 2L5UA 2MIQA 1BORA 5FEYA 3GV4A 4WZ2A 2E6RA 1X4IA 3LVRE 2CRWA 2D8SA 3DDTA 1FBVA 2VPBA 2DSMA 2F6NA 3ASLA 1U6GB 5EYAF 4P5OB 5H1VA 2KREA 2YURA 5G04B 2VPGA 3PLWA 3U5OA 2CSVA 3ZVZB 1WEPA 4R2YA 2G6QA 2KGIA 3LQIA 2C2LA 2YT5A 3ZNIA 2M6MA 2ECIA 1X4UA 2LN0A 2VNFA 5B8DA 2FUUA 2FUIA 2K17A 4GNFA 1X4JA 3KNVA 2BAYA 5D1LB 1WEUA 3L1XA 4FJCA 1MM2A 2FSAA 5FB0A 2H0DA 2VJFB 2MD8C 5B76A 2XEUA 5KH7A 2LGKA 4AVXA 4L58A 2XOCA 2XOZA 3ZTGA 1XWHA 2KGGA 2MKEA 4AYCB 1Z60A 2P57A 4Z0RA 1RMDA 3Q1DA 5H1TA 3DPLR 5B77A 1WGMA 1HYIA 1VD4A 2KIZA 2AN6A 2M85A 3KQIA 4S3OC 2LAUA 3SOXA 4BHWA 2KWOA
chains in the Genus database with same CATH topology
3ZYQA 3N9MA 4I7BA 4GNEA 1JM7B 2CSYA 3O7AA 4Q6FA 1N87A 3ZPVE 2IDAA 5LKXA 1Z6UA 3GL6A 2KR4A 4A49A 2LV9A 2ECVA 3VK6A 1E4UA 3SOUA 5DKAA 2E6SA 2LXPC 2ECTA 2HDPA 3O70A 2Y1NA 2EGPA 3PURA 3T7LA 2VJEB 2LDRA 1WESA 2JMDA 5I3LA 5FB1A 2G45A 4W4UA 2VJFA 2NAAA 2MUMA 3N9PA 2YHNA 2LGGA 4A4CA 3N9NA 2F6JA 2MA5A 2JMIA 3KV6A 2K4DA 4ZUXU 4PPEA 4V3LC 5FERA 2EA6A 5KH3A 2ECWA 1T1HA 4S3OB 5AIUA 4X3GA 2YSMA 2KU3A 2ZETC 3EB5A 5D1MB 1JM7A 5G0FA 3ZVYA 3M63A 5TRBA 3FL2A 4UP0A 1WIMA 3EB6A 4CCGX 3SOWA 1VFYA 4QF3A 1MM3A 4XI1A 2K1JA 4PTBA 3M99A 3RTRB 4WA6A 2LGLA 5KH9A 1WILA 2Y43A 4LKAA 2YUCA 4LADB 4V3KC 4LK9A 5TABA 2VJEA 3LRQA 3U5NA 3SHBA 5JG6A 5TBNA 3QZVA 4F52B 4GNGA 2M3HA 2KFTA 4YBMA 2LQ6A 4AUQB 2M1RA 4I7CA 4A0CD 2VP7A 1Z2QA 1CHCA 4YBSA 2CT2A 3L1ZB 4C9ZA 2I50A 4R7EA 3V43A 2OXQC 2YQLA 2Y1MA 5J3XA 2L0BA 4ZDTA 3C6WA 3C5KA 5LCWB 2MA6A 1K2FA 1WEEA 2CSZA 2RSDA 3HCSA 5LKTA 4YATA 4YADA 2KWNA 3L11A 1WEMA 2QIZA 4GNDA 3LQHA 2QJ0A 1WEWA 2CKLB 2QICA 2H0DB 3O37A 2PNXA 5B78A 4BBQA 3M62A 5C13A 3O34A 4IC3A 2K16A 2YREA 1WEQA 3KV5A 4AYCA 2LRIC 4O64A 2MNYA 5H1UA 2VPDA 5C11A 5G05B 3U5PA 4LLBA 2LXHC 3DQVR 3O35A 4ZQLA 4UP5A 2HYED 4IC2A 4WZ0A 4N3WA 2DX8A 2YYRA 2VPEA 2KYUA 2KWJA 3N9LA 4L7XA 3IHPA 3HTKC 4A4BA 4FK5A 1LDJB 3PUQA 4I7DA 4GB0A 3T6RA 3U5MA 1HYJA 4YC9A 4AP4A 2ECJA 4B86C 2JMJA 1LDKC 1F62A 3N9QA 2PUYA 3RPGC 3NG2A 3O36A 1WE9A 2JRJA 3N9OA 1IYMA 5LKZA 3MHHA 5AITA 1FP0A 4NN2A 4FO9A 1ZBDB 2CKLA 2RI7A 1WEVA 2L43A 2ECGA 2YSJA 2YQMA 4LJNA 3HCTA 2KE1A 2F42A 2YU4A 4B7YC 2L80A 3PHDA 5LKUA 2C2VS 3O33A 2MNZA 2YHOA 4TKPB 1WEOA 5D1KB 4UI9B 2LGVA 2KWKA 2MD7B 2ECNA 4YBTA 2XB1A 3I2DA 1G25A 1VYXA 5DINA 4N4FA 1WENA 4CA1A 4QF2A 2L75A 4MVTA 4YABA 4MSXA 3LQJA 3RPGB 3MHSA 4R8PK 4YAXA 5H9MA 3ZPV1 5B79A 2UZGA 5B75A 1DVPA 1JOCA 1V87A 1WFKA 3HCUA 4WZ3B 4FIPA 5TDWA 2G43A 5TDRA 2EODA 2YW8A 2MT5A 2L5UA 2MIQA 1BORA 5FEYA 3GV4A 4WZ2A 2E6RA 1X4IA 2D8SA 1FBVA 2VPBA 2F6NA 3ASLA 1U6GB 5EYAF 4P5OB 5H1VA 2KREA 2YURA 5G04B 2VPGA 3U5OA 3ZVZB 1WEPA 4R2YA 2G6QA 2KGIA 3LQIA 2C2LA 2YT5A 3ZNIA 2M6MA 2ECIA 1X4UA 2LN0A 2VNFA 5B8DA 2FUUA 2FUIA 2K17A 4GNFA 1X4JA 3KNVA 2BAYA 5D1LB 1WEUA 3L1XA 4FJCA 1MM2A 2FSAA 5FB0A 2H0DA 2VJFB 2MD8C 5B76A 2XEUA 5KH7A 2LGKA 4AVXA 4L58A 3ZTGA 1XWHA 2KGGA 4AYCB 1Z60A 1RMDA 5H1TA 3DPLR 5B77A 1WGMA 1HYIA 1VD4A 2KIZA 2AN6A 2M85A 3KQIA 4S3OC 3SOXA 4BHWA 2KWOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZYQ A;  3N9M A;  4I7B A;  4GNE A;  1JM7 B;  2CSY A;  3O7A A;  4Q6F A;  1N87 A;  3ZPV E;  2IDA A;  5LKX A;  1Z6U A;  3GL6 A;  2KR4 A;  4A49 A;  2LV9 A;  2ECV A;  3VK6 A;  1E4U A;  3SOU A;  5DKA A;  2E6S A;  2LXP C;  2ECT A;  2HDP A;  3O70 A;  2Y1N A;  2EGP A;  3PUR A;  3T7L A;  2VJE B;  2LDR A;  1WES A;  2JMD A;  5I3L A;  5FB1 A;  2G45 A;  4W4U A;  2VJF A;  2NAA A;  2MUM A;  3N9P A;  2YHN A;  2LGG A;  4A4C A;  3N9N A;  2F6J A;  2MA5 A;  2JMI A;  3KV6 A;  2K4D A;  4ZUX U;  4PPE A;  4V3L C;  5FER A;  2EA6 A;  5KH3 A;  2ECW A;  1T1H A;  4S3O B;  5AIU A;  4X3G A;  2YSM A;  2KU3 A;  2ZET C;  3EB5 A;  5D1M B;  1JM7 A;  5G0F A;  3ZVY A;  3M63 A;  5TRB A;  3FL2 A;  4UP0 A;  1WIM A;  3EB6 A;  4CCG X;  3SOW A;  1VFY A;  4QF3 A;  1MM3 A;  4XI1 A;  2K1J A;  4PTB A;  3M99 A;  3RTR B;  4WA6 A;  2LGL A;  5KH9 A;  1WIL A;  2Y43 A;  4LKA A;  2YUC A;  4LAD B;  4V3K C;  4LK9 A;  5TAB A;  2VJE A;  3LRQ A;  3U5N A;  3SHB A;  5JG6 A;  5TBN A;  3QZV A;  4F52 B;  4GNG A;  2M3H A;  2KFT A;  4YBM A;  2LQ6 A;  4AUQ B;  2M1R A;  4I7C A;  4A0C D;  2VP7 A;  1Z2Q A;  1CHC A;  4YBS A;  2CT2 A;  3L1Z B;  4C9Z A;  2I50 A;  4R7E A;  3V43 A;  2OXQ C;  2YQL A;  2Y1M A;  5J3X A;  2L0B A;  4ZDT A;  3C6W A;  3C5K A;  5LCW B;  2MA6 A;  1K2F A;  1WEE A;  2CSZ A;  2RSD A;  3HCS A;  5LKT A;  4YAT A;  4YAD A;  2KWN A;  3L11 A;  1WEM A;  2QIZ A;  4GND A;  3LQH A;  2QJ0 A;  1WEW A;  2CKL B;  2QIC A;  2H0D B;  3O37 A;  2PNX A;  5B78 A;  4BBQ A;  3M62 A;  5C13 A;  3O34 A;  4IC3 A;  2K16 A;  2YRE A;  1WEQ A;  3KV5 A;  4AYC A;  2LRI C;  4O64 A;  2MNY A;  5H1U A;  2VPD A;  5C11 A;  5G05 B;  3U5P A;  4LLB A;  2LXH C;  3DQV R;  3O35 A;  4ZQL A;  4UP5 A;  2HYE D;  4IC2 A;  4WZ0 A;  4N3W A;  2DX8 A;  2YYR A;  2VPE A;  2KYU A;  2KWJ A;  3N9L A;  4L7X A;  3IHP A;  3HTK C;  4A4B A;  4FK5 A;  1LDJ B;  3PUQ A;  4I7D A;  4GB0 A;  3T6R A;  3U5M A;  1HYJ A;  4YC9 A;  4AP4 A;  2ECJ A;  4B86 C;  2JMJ A;  1LDK C;  1F62 A;  3N9Q A;  2PUY A;  3RPG C;  3NG2 A;  3O36 A;  1WE9 A;  2JRJ A;  3N9O A;  1IYM A;  5LKZ A;  3MHH A;  5AIT A;  1FP0 A;  4NN2 A;  4FO9 A;  1ZBD B;  2CKL A;  2RI7 A;  1WEV A;  2L43 A;  2ECG A;  2YSJ A;  2YQM A;  4LJN A;  3HCT A;  2KE1 A;  2F42 A;  2YU4 A;  4B7Y C;  2L80 A;  3PHD A;  5LKU A;  2C2V S;  3O33 A;  2MNZ A;  2YHO A;  4TKP B;  1WEO A;  5D1K B;  4UI9 B;  2LGV A;  2KWK A;  2MD7 B;  2ECN A;  4YBT A;  2XB1 A;  3I2D A;  1G25 A;  1VYX A;  5DIN A;  4N4F A;  1WEN A;  4CA1 A;  4QF2 A;  2L75 A;  4MVT A;  4YAB A;  4MSX A;  3LQJ A;  3RPG B;  3MHS A;  4R8P K;  4YAX A;  5H9M A;  3ZPV 1;  5B79 A;  2UZG A;  5B75 A;  1DVP A;  1JOC A;  1V87 A;  1WFK A;  3HCU A;  4WZ3 B;  4FIP A;  5TDW A;  2G43 A;  5TDR A;  2EOD A;  2YW8 A;  2MT5 A;  2L5U A;  2MIQ A;  1BOR A;  5FEY A;  3GV4 A;  4WZ2 A;  2E6R A;  1X4I A;  2D8S A;  1FBV A;  2VPB A;  2F6N A;  3ASL A;  1U6G B;  5EYA F;  4P5O B;  5H1V A;  2KRE A;  2YUR A;  5G04 B;  2VPG A;  3U5O A;  3ZVZ B;  1WEP A;  4R2Y A;  2G6Q A;  2KGI A;  3LQI A;  2C2L A;  2YT5 A;  3ZNI A;  2M6M A;  2ECI A;  1X4U A;  2LN0 A;  2VNF A;  5B8D A;  2FUU A;  2FUI A;  2K17 A;  4GNF A;  1X4J A;  3KNV A;  2BAY A;  5D1L B;  1WEU A;  3L1X A;  4FJC A;  1MM2 A;  2FSA A;  5FB0 A;  2H0D A;  2VJF B;  2MD8 C;  5B76 A;  2XEU A;  5KH7 A;  2LGK A;  4AVX A;  4L58 A;  3ZTG A;  1XWH A;  2KGG A;  4AYC B;  1Z60 A;  1RMD A;  5H1T A;  3DPL R;  5B77 A;  1WGM A;  1HYI A;  1VD4 A;  2KIZ A;  2AN6 A;  2M85 A;  3KQI A;  4S3O C;  3SOX A;  4BHW A;  2KWO A; 
#chains in the Genus database with same CATH topology
 3ZYQ A;  3N9M A;  4I7B A;  4GNE A;  1JM7 B;  2CSY A;  3O7A A;  4Q6F A;  1N87 A;  3ZPV E;  2IDA A;  5LKX A;  1Z6U A;  3GL6 A;  3T9K A;  2KR4 A;  4O62 A;  4A49 A;  2LV9 A;  3LJU X;  2ECV A;  3VK6 A;  1E4U A;  3SOU A;  5DKA A;  2E6S A;  2LXP C;  2E61 A;  2ECT A;  2HDP A;  3O70 A;  2Y1N A;  2EGP A;  3PUR A;  3T7L A;  2VJE B;  3FAN A;  2LDR A;  3LDY A;  1WES A;  4F1P A;  5SVY A;  2JMD A;  5I3L A;  2RR4 A;  5FB1 A;  2G45 A;  4W4U A;  3E2D A;  2VJF A;  2NAA A;  2MUM A;  3N9P A;  2YHN A;  2LGG A;  4A4C A;  3N9N A;  2F6J A;  2MA5 A;  2JMI A;  3KV6 A;  2K4D A;  4ZUX U;  4PPE A;  4V3L C;  5FER A;  2EA6 A;  5KH3 A;  2ECW A;  1T1H A;  4S3O B;  5AIU A;  5SVI B;  4X3G A;  2YSM A;  2JM3 A;  2KU3 A;  2ZET C;  3EB5 A;  4QQ4 A;  5D1M B;  1JM7 A;  5G0F A;  3ZVY A;  3M63 A;  5TRB A;  3FL2 A;  4UP0 A;  1WIM A;  3EB6 A;  4CCG X;  3SOW A;  1VFY A;  4QF3 A;  1MM3 A;  4XI1 A;  2K1J A;  4PTB A;  3M99 A;  3RTR B;  4WA6 A;  2LGL A;  5KH9 A;  4OGE A;  1WIL A;  2Y43 A;  3DWD A;  4LKA A;  2YUC A;  4LAD B;  4V3K C;  4LK9 A;  5TAB A;  2VJE A;  3LRQ A;  3U5N A;  2XOY A;  3SHB A;  5JG6 A;  5TBN A;  1MBM A;  3JUE A;  3QZV A;  4F52 B;  4GNG A;  2M3H A;  2KFT A;  4YBM A;  2LQ6 A;  4AUQ B;  5SVX A;  2M1R A;  4I7C A;  2KKY A;  4A0C D;  2VP7 A;  1Z2Q A;  1CHC A;  4YBS A;  2CT2 A;  3L1Z B;  2YVR A;  4C9Z A;  2I50 A;  3SUB A;  5K3Q A;  3FJU B;  4R7E A;  3V43 A;  2DJA A;  2OXQ C;  2YQL A;  4OGC A;  2Y1M A;  5J3X A;  2L0B A;  4ZDT A;  3C6W A;  3C5K A;  5LCW B;  2XP0 A;  2MA6 A;  1K2F A;  1WEE A;  2CSZ A;  2RSD A;  3HCS A;  3FAO A;  5LKT A;  4YAT A;  4YAD A;  2KWN A;  3L11 A;  1WEM A;  2OWA A;  2QIZ A;  4GND A;  3LQH A;  2QJ0 A;  1WEW A;  2CKL B;  2QIC A;  2H0D B;  3O37 A;  2PNX A;  5B78 A;  4BBQ A;  3M7K A;  2D8U A;  3M62 A;  2M13 A;  2FFW A;  5C13 A;  3O34 A;  4IC3 A;  2EXU A;  3KDE C;  2K16 A;  2YRE A;  1WEQ A;  3KV5 A;  4AYC A;  2LRI C;  4O64 A;  2MNY A;  5H1U A;  2VPD A;  5C11 A;  5G05 B;  3U5P A;  4LLB A;  2LXH C;  3DQV R;  3O35 A;  4ZQL A;  4UP5 A;  2CRR A;  2HYE D;  4IC2 A;  4WZ0 A;  2B0O E;  4N3W A;  2DX8 A;  2YYR A;  2VPE A;  2KYU A;  2KWJ A;  3O47 A;  3N9L A;  4L7X A;  3H7H A;  3IHP A;  3HTK C;  4A4B A;  4FK5 A;  1LDJ B;  3PUQ A;  4I7D A;  4GB0 A;  3T6R A;  3U5M A;  1HYJ A;  4YC9 A;  2CON A;  4AP4 A;  2ECJ A;  4B86 C;  2JMJ A;  1LDK C;  1F62 A;  3N9Q A;  2PUY A;  3RPG C;  3NG2 A;  3O36 A;  1WE9 A;  3MDB C;  2JRJ A;  3N9O A;  1IYM A;  5LKZ A;  3MHH A;  5AIT A;  1FP0 A;  2JUN A;  4NN2 A;  4FO9 A;  1ZBD B;  2CKL A;  2RI7 A;  1WEV A;  2L43 A;  2ECG A;  2YSJ A;  2YQM A;  4LJN A;  3HCT A;  2KE1 A;  2F42 A;  2YU4 A;  4B7Y C;  2L80 A;  3PHD A;  5LKU A;  2C2V S;  4Z0O A;  2IQJ A;  3O33 A;  1DCQ A;  5SVI A;  3LVQ E;  2MNZ A;  2YHO A;  4TKP B;  1WEO A;  5D1K B;  3FEH A;  4UI9 B;  2LGV A;  2KWK A;  2MD7 B;  2ECN A;  4YBT A;  3FM8 C;  2XB1 A;  2L7P A;  2FD4 A;  3I2D A;  1G25 A;  1VYX A;  5DIN A;  4N4F A;  1WEN A;  4CA1 A;  4QF2 A;  2EGM A;  2L75 A;  4MVT A;  4YAB A;  4MSX A;  3LQJ A;  3RPG B;  3MHS A;  4R8P K;  4YAX A;  5H9M A;  3ZPV 1;  5B79 A;  2UZG A;  5B75 A;  1DVP A;  1JOC A;  1V87 A;  1WFK A;  3HCU A;  4WZ3 B;  4FIP A;  5TDW A;  2G43 A;  5TDR A;  2EOD A;  2YW8 A;  2MT5 A;  4H9D A;  2KKX A;  2L5U A;  2MIQ A;  1BOR A;  5FEY A;  3GV4 A;  4WZ2 A;  2E6R A;  1X4I A;  3LVR E;  2CRW A;  2D8S A;  3DDT A;  1FBV A;  2VPB A;  2DSM A;  2F6N A;  3ASL A;  1U6G B;  5EYA F;  4P5O B;  5H1V A;  2KRE A;  2YUR A;  5G04 B;  2VPG A;  3PLW A;  3U5O A;  2CSV A;  3ZVZ B;  1WEP A;  4R2Y A;  2G6Q A;  2KGI A;  3LQI A;  2C2L A;  2YT5 A;  3ZNI A;  2M6M A;  2ECI A;  1X4U A;  2LN0 A;  2VNF A;  5B8D A;  2FUU A;  2FUI A;  2K17 A;  4GNF A;  1X4J A;  3KNV A;  2BAY A;  5D1L B;  1WEU A;  3L1X A;  4FJC A;  1MM2 A;  2FSA A;  5FB0 A;  2H0D A;  2VJF B;  2MD8 C;  5B76 A;  2XEU A;  5KH7 A;  2LGK A;  4AVX A;  4L58 A;  2XOC A;  2XOZ A;  3ZTG A;  1XWH A;  2KGG A;  2MKE A;  4AYC B;  1Z60 A;  2P57 A;  4Z0R A;  1RMD A;  3Q1D A;  5H1T A;  3DPL R;  5B77 A;  1WGM A;  1HYI A;  1VD4 A;  2KIZ A;  2AN6 A;  2M85 A;  3KQI A;  4S3O C;  2LAU A;  3SOX A;  4BHW A;  2KWO A; 
#chains in the Genus database with same CATH homology
 3ZYQ A;  3N9M A;  4I7B A;  4GNE A;  1JM7 B;  2CSY A;  3O7A A;  4Q6F A;  1N87 A;  3ZPV E;  2IDA A;  5LKX A;  1Z6U A;  3GL6 A;  2KR4 A;  4A49 A;  2LV9 A;  2ECV A;  3VK6 A;  1E4U A;  3SOU A;  5DKA A;  2E6S A;  2LXP C;  2ECT A;  2HDP A;  3O70 A;  2Y1N A;  2EGP A;  3PUR A;  3T7L A;  2VJE B;  2LDR A;  1WES A;  2JMD A;  5I3L A;  5FB1 A;  2G45 A;  4W4U A;  2VJF A;  2NAA A;  2MUM A;  3N9P A;  2YHN A;  2LGG A;  4A4C A;  3N9N A;  2F6J A;  2MA5 A;  2JMI A;  3KV6 A;  2K4D A;  4ZUX U;  4PPE A;  4V3L C;  5FER A;  2EA6 A;  5KH3 A;  2ECW A;  1T1H A;  4S3O B;  5AIU A;  4X3G A;  2YSM A;  2KU3 A;  2ZET C;  3EB5 A;  5D1M B;  1JM7 A;  5G0F A;  3ZVY A;  3M63 A;  5TRB A;  3FL2 A;  4UP0 A;  1WIM A;  3EB6 A;  4CCG X;  3SOW A;  1VFY A;  4QF3 A;  1MM3 A;  4XI1 A;  2K1J A;  4PTB A;  3M99 A;  3RTR B;  4WA6 A;  2LGL A;  5KH9 A;  1WIL A;  2Y43 A;  4LKA A;  2YUC A;  4LAD B;  4V3K C;  4LK9 A;  5TAB A;  2VJE A;  3LRQ A;  3U5N A;  3SHB A;  5JG6 A;  5TBN A;  3QZV A;  4F52 B;  4GNG A;  2M3H A;  2KFT A;  4YBM A;  2LQ6 A;  4AUQ B;  2M1R A;  4I7C A;  4A0C D;  2VP7 A;  1Z2Q A;  1CHC A;  4YBS A;  2CT2 A;  3L1Z B;  4C9Z A;  2I50 A;  4R7E A;  3V43 A;  2OXQ C;  2YQL A;  2Y1M A;  5J3X A;  2L0B A;  4ZDT A;  3C6W A;  3C5K A;  5LCW B;  2MA6 A;  1K2F A;  1WEE A;  2CSZ A;  2RSD A;  3HCS A;  5LKT A;  4YAT A;  4YAD A;  2KWN A;  3L11 A;  1WEM A;  2QIZ A;  4GND A;  3LQH A;  2QJ0 A;  1WEW A;  2CKL B;  2QIC A;  2H0D B;  3O37 A;  2PNX A;  5B78 A;  4BBQ A;  3M62 A;  5C13 A;  3O34 A;  4IC3 A;  2K16 A;  2YRE A;  1WEQ A;  3KV5 A;  4AYC A;  2LRI C;  4O64 A;  2MNY A;  5H1U A;  2VPD A;  5C11 A;  5G05 B;  3U5P A;  4LLB A;  2LXH C;  3DQV R;  3O35 A;  4ZQL A;  4UP5 A;  2HYE D;  4IC2 A;  4WZ0 A;  4N3W A;  2DX8 A;  2YYR A;  2VPE A;  2KYU A;  2KWJ A;  3N9L A;  4L7X A;  3IHP A;  3HTK C;  4A4B A;  4FK5 A;  1LDJ B;  3PUQ A;  4I7D A;  4GB0 A;  3T6R A;  3U5M A;  1HYJ A;  4YC9 A;  4AP4 A;  2ECJ A;  4B86 C;  2JMJ A;  1LDK C;  1F62 A;  3N9Q A;  2PUY A;  3RPG C;  3NG2 A;  3O36 A;  1WE9 A;  2JRJ A;  3N9O A;  1IYM A;  5LKZ A;  3MHH A;  5AIT A;  1FP0 A;  4NN2 A;  4FO9 A;  1ZBD B;  2CKL A;  2RI7 A;  1WEV A;  2L43 A;  2ECG A;  2YSJ A;  2YQM A;  4LJN A;  3HCT A;  2KE1 A;  2F42 A;  2YU4 A;  4B7Y C;  2L80 A;  3PHD A;  5LKU A;  2C2V S;  3O33 A;  2MNZ A;  2YHO A;  4TKP B;  1WEO A;  5D1K B;  4UI9 B;  2LGV A;  2KWK A;  2MD7 B;  2ECN A;  4YBT A;  2XB1 A;  3I2D A;  1G25 A;  1VYX A;  5DIN A;  4N4F A;  1WEN A;  4CA1 A;  4QF2 A;  2L75 A;  4MVT A;  4YAB A;  4MSX A;  3LQJ A;  3RPG B;  3MHS A;  4R8P K;  4YAX A;  5H9M A;  3ZPV 1;  5B79 A;  2UZG A;  5B75 A;  1DVP A;  1JOC A;  1V87 A;  1WFK A;  3HCU A;  4WZ3 B;  4FIP A;  5TDW A;  2G43 A;  5TDR A;  2EOD A;  2YW8 A;  2MT5 A;  2L5U A;  2MIQ A;  1BOR A;  5FEY A;  3GV4 A;  4WZ2 A;  2E6R A;  1X4I A;  2D8S A;  1FBV A;  2VPB A;  2F6N A;  3ASL A;  1U6G B;  5EYA F;  4P5O B;  5H1V A;  2KRE A;  2YUR A;  5G04 B;  2VPG A;  3U5O A;  3ZVZ B;  1WEP A;  4R2Y A;  2G6Q A;  2KGI A;  3LQI A;  2C2L A;  2YT5 A;  3ZNI A;  2M6M A;  2ECI A;  1X4U A;  2LN0 A;  2VNF A;  5B8D A;  2FUU A;  2FUI A;  2K17 A;  4GNF A;  1X4J A;  3KNV A;  2BAY A;  5D1L B;  1WEU A;  3L1X A;  4FJC A;  1MM2 A;  2FSA A;  5FB0 A;  2H0D A;  2VJF B;  2MD8 C;  5B76 A;  2XEU A;  5KH7 A;  2LGK A;  4AVX A;  4L58 A;  3ZTG A;  1XWH A;  2KGG A;  4AYC B;  1Z60 A;  1RMD A;  5H1T A;  3DPL R;  5B77 A;  1WGM A;  1HYI A;  1VD4 A;  2KIZ A;  2AN6 A;  2M85 A;  3KQI A;  4S3O C;  3SOX A;  4BHW A;  2KWO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...