4QF3A

Crystal structure of human baz2b phd zinc finger in the free form
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
57
structure length
57
Chain Sequence
MSIMKVYCQICRKGDNEELLLLCDGCDKGCHTYCHRPKITTIPDGDWFCPACIAKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bromodomain adjacent to zinc finger domain protein 2B
publication title Molecular basis of histone tail recognition by human TIP5 PHD finger and bromodomain of the chromatin remodeling complex NoRC.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 9
structure length 57
sequence length 57
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4qf3A00
2KWOA 5KH7A 2YQLA 3LQJA 3KV5A 1G25A 5H1TA 3U5MA 2JMJA 4QF2A 2LGVA 2Y1NA 2HYED 3LRQA 2G45A 4FK5A 4UI9B 4X3GA 2MNZA 4PPEA 1MM2A 5D1LB 4ZDTA 3ZTGA 2F42A 2KIZA 2VJEB 3EB6A 4FJCA 1T1HA 4WA6A 3ZVZB 2K4DA 2YW8A 4LK9A 5AIUA 2FUIA 4GNDA 1WEEA 1LDKC 5C11A 2VPDA 3LQIA 5J3XA 3I2DA 1XWHA 3ZVYA 3U5PA 3N9MA 3RPGC 2E6SA 2KREA 2ECIA 1VD4A 2YREA 4FO9A 4V3KC 1FBVA 4PTBA 1ZBDB 2D8SA 2MA6A 3RPGB 2L80A 2MD8C 2K1JA 2C2VS 2PNXA 5H9MA 3ZYQA 1N87A 2KGIA 3DQVR 4GNEA 5KH3A 3N9OA 2RSDA 4IC2A 2H0DA 4P5OB 1VYXA 2ECWA 1WEOA 3EB5A 2YURA 4BHWA 4AP4A 1WEWA 4GNFA 4BBQA 4A4BA 1V87A 2YSMA 1LDJB 1WEUA 2JRJA 5TBNA 1MM3A 2EA6A 3L1ZB 1WE9A 4LADB 5AITA 5TDWA 5LKUA 4TKPB 4A49A 2CT2A 2E6RA 2M3HA 3FL2A 3MHHA 4V3LC 4LLBA 2YU4A 5D1MB 3SHBA 3ZPVE 4IC3A 3M63A 4ZUXU 1JM7A 1X4JA 3O33A 2FUUA 5FEYA 1F62A 2VP7A 2QIZA 2YT5A 2MD7B 3O7AA 3O70A 4R7EA 2M85A 4YAXA 1HYJA 3U5OA 2KWNA 1WEPA 5G04B 2HDPA 4QF3A 3U5NA 2M6MA 3IHPA 3KQIA 4YADA 4Q6FA 1X4IA 2LXHC 5B77A 2F6NA 2L0BA 5TABA 1K2FA 3KV6A 1Z2QA 2MUMA 3SOUA 2LGGA 2MT5A 2QJ0A 3O34A 4O64A 2XB1A 3O36A 3HTKC 2KYUA 4I7BA 2IDAA 1WILA 4WZ0A 1U6GB 2KR4A 4YABA 4ZQLA 3VK6A 5H1UA 5H1VA 2ZETC 1WEVA 2H0DB 2I50A 3L11A 1Z6UA 4WZ2A 5B8DA 2VJFA 4NN2A 3V43A 5DINA 5B79A 2K17A 4B7YC 3PUQA 5DKAA 4I7DA 4AUQB 4A4CA 2UZGA 3GL6A 1IYMA 5B78A 3O35A 3ZPV1 1WFKA 2LGKA 4AVXA 1JM7B 1WGMA 5FB1A 3SOWA 4A0CD 4UP5A 5LKTA 1WEQA 3T7LA 5D1KB 2YUCA 3N9NA 3PURA 2C2LA 2BAYA 3C5KA 3KNVA 5TRBA 2YHNA 2L75A 2LQ6A 1VFYA 2JMDA 4L58A 2DX8A 2CKLA 3LQHA 2M1RA 4AYCA 4I7CA 2OXQC 1Z60A 3M62A 5FB0A 2L5UA 1WIMA 1WEMA 2QICA 2VPGA 1RMDA 1DVPA 2F6JA 4F52B 2KU3A 3N9LA 3MHSA 5G0FA 3N9QA 2AN6A 2KE1A 5FERA 2ECJA 5G05B 1FP0A 2MIQA 4LJNA 4GB0A 4CCGX 4R2YA 2G6QA 3DPLR 1WESA 4W4UA 5B75A 2FSAA 4FIPA 4YC9A 5JG6A 2VPEA 5I3LA 4C9ZA 2MA5A 2Y43A 2XEUA 3HCSA 4YBTA 2K16A 4GNGA 5LKXA 3ASLA 2KWKA 2LDRA 3T6RA 2PUYA 3HCUA 2VJFB 3SOXA 2VPBA 3GV4A 3QZVA 2ECNA 2RI7A 2ECGA 2L43A 2VNFA 2VJEA 2ECVA 3L1XA 5LKZA 4N4FA 5EYAF 3N9PA 2NAAA 4YBSA 2KFTA 2KWJA 4YBMA 2YYRA 5TDRA 1BORA 1CHCA 4R8PK 2LRIC 2YHOA 3HCTA 2MNYA 4UP0A 4CA1A 1HYIA 4S3OC 4WZ3B 2YSJA 2EGPA 2ECTA 1E4UA 2KGGA 4MVTA 1JOCA 3ZNIA 3NG2A 3RTRB 2JMIA 3PHDA 3C6WA 2CKLB 2CSYA 4S3OB 4AYCB 2LXPC 4B86C 3M99A 2Y1MA 2EODA 5C13A 5LCWB 2LGLA 4XI1A 2CSZA 5KH9A 4YATA 4N3WA 2G43A 4MSXA 3O37A 2YQMA 2LN0A 5B76A 2LV9A 4L7XA 1X4UA 1WENA 4LKAA
chains in the Genus database with same CATH superfamily
4OGEA 2KWOA 2XP0A 5KH7A 2YQLA 3LQJA 3KV5A 1G25A 5H1TA 3U5MA 2JMJA 4QF2A 2LGVA 2Y1NA 2HYED 3LRQA 5K3QA 2G45A 4FK5A 4UI9B 4X3GA 2L7PA 2MNZA 4PPEA 1MM2A 5D1LB 4ZDTA 3ZTGA 2F42A 2KIZA 2VJEB 3EB6A 4FJCA 1T1HA 4WA6A 2CRWA 3ZVZB 2K4DA 2YW8A 4LK9A 5AIUA 2FUIA 4GNDA 1WEEA 1LDKC 2CRRA 5C11A 2VPDA 3LQIA 5J3XA 3I2DA 1XWHA 3ZVYA 3U5PA 3N9MA 3RPGC 2E6SA 2KREA 2ECIA 1VD4A 2YREA 4FO9A 4V3KC 1FBVA 4PTBA 1ZBDB 2D8SA 2MA6A 3JUEA 3RPGB 2L80A 2MD8C 1MBMA 2K1JA 2C2VS 2MKEA 2PNXA 5H9MA 3ZYQA 4QQ4A 1N87A 2M13A 2KGIA 3DQVR 4GNEA 5KH3A 3N9OA 2RSDA 4IC2A 2H0DA 4P5OB 1VYXA 2ECWA 1WEOA 3EB5A 2YURA 4BHWA 2YVRA 4AP4A 1WEWA 4GNFA 4BBQA 3M7KA 4A4BA 1V87A 2YSMA 1LDJB 1WEUA 2JRJA 2P57A 5TBNA 1MM3A 2EA6A 3L1ZB 1WE9A 4LADB 5AITA 5TDWA 5LKUA 3DWDA 2OWAA 4TKPB 4A49A 2CT2A 2E6RA 2M3HA 3FL2A 3MHHA 4V3LC 4LLBA 2YU4A 5D1MB 3SHBA 3ZPVE 4IC3A 3M63A 4ZUXU 1JM7A 4Z0OA 1X4JA 3O33A 3LVQE 2FUUA 5FEYA 1F62A 2VP7A 2QIZA 2YT5A 2MD7B 2XOYA 3O7AA 3O70A 4R7EA 2M85A 4YAXA 1HYJA 3U5OA 2KWNA 1WEPA 5G04B 2HDPA 4QF3A 3U5NA 2M6MA 3IHPA 3KQIA 4YADA 5SVXA 4Q6FA 1X4IA 2LXHC 5B77A 2F6NA 2L0BA 5TABA 1K2FA 3LJUX 3O47A 3E2DA 2E61A 3KV6A 1Z2QA 2MUMA 3SOUA 2LGGA 2MT5A 2KKYA 2QJ0A 5SVIA 3O34A 2CSVA 4O64A 2XB1A 3O36A 3HTKC 2KYUA 3LDYA 3FM8C 4I7BA 2IDAA 1WILA 4WZ0A 1U6GB 2KR4A 4YABA 2LAUA 2DSMA 4ZQLA 3VK6A 5H1UA 5H1VA 2ZETC 1WEVA 3FJUB 2H0DB 3Q1DA 2IQJA 2I50A 3L11A 1Z6UA 4WZ2A 5B8DA 2VJFA 4NN2A 3V43A 5DINA 5B79A 2K17A 4B7YC 3PUQA 5DKAA 4I7DA 3KDEC 3MDBC 4AUQB 4A4CA 2UZGA 3GL6A 1IYMA 4F1PA 2XOCA 5B78A 3O35A 4O62A 3ZPV1 1WFKA 2LGKA 4AVXA 1JM7B 1DCQA 2JM3A 3FAOA 2EXUA 1WGMA 5FB1A 3SOWA 4A0CD 4UP5A 5LKTA 1WEQA 3T7LA 5D1KB 2YUCA 3N9NA 3PURA 3SUBA 2C2LA 2BAYA 3C5KA 3KNVA 5TRBA 2FD4A 2YHNA 2L75A 2LQ6A 1VFYA 2JMDA 4L58A 2DX8A 2CKLA 3LQHA 2M1RA 3FANA 4AYCA 4I7CA 2OXQC 1Z60A 3LVRE 3M62A 5FB0A 2L5UA 2RR4A 1WIMA 1WEMA 2QICA 2VPGA 1RMDA 1DVPA 2F6JA 3H7HA 4F52B 2KU3A 3N9LA 3MHSA 5G0FA 3N9QA 5SVIB 2AN6A 2KE1A 5FERA 2FFWA 2ECJA 5G05B 1FP0A 2MIQA 4LJNA 4GB0A 2KKXA 4CCGX 4OGCA 4R2YA 2G6QA 3DPLR 1WESA 4W4UA 5B75A 3T9KA 2FSAA 4FIPA 4YC9A 5JG6A 2VPEA 5I3LA 4C9ZA 2MA5A 2Y43A 2XEUA 3HCSA 4YBTA 2K16A 4GNGA 5LKXA 3ASLA 2KWKA 3FEHA 2LDRA 3T6RA 2PUYA 3HCUA 2VJFB 3SOXA 2VPBA 2DJAA 3GV4A 3QZVA 2ECNA 2RI7A 2ECGA 2L43A 2VNFA 2VJEA 2ECVA 3L1XA 5LKZA 4N4FA 3DDTA 5EYAF 3N9PA 2NAAA 4YBSA 2KFTA 2KWJA 2B0OE 4YBMA 2YYRA 5TDRA 1BORA 1CHCA 2EGMA 4R8PK 2LRIC 2YHOA 2D8UA 3HCTA 2JUNA 2MNYA 4UP0A 4CA1A 1HYIA 4S3OC 4WZ3B 2YSJA 2CONA 2ECTA 2EGPA 1E4UA 2KGGA 4MVTA 1JOCA 3ZNIA 3NG2A 3RTRB 2JMIA 3PHDA 3C6WA 2CKLB 2CSYA 4S3OB 4AYCB 2LXPC 4B86C 3PLWA 4Z0RA 3M99A 2Y1MA 2EODA 5C13A 5LCWB 2LGLA 2XOZA 5SVYA 4XI1A 2CSZA 5KH9A 4YATA 4N3WA 2G43A 4MSXA 3O37A 2YQMA 2LN0A 5B76A 2LV9A 4L7XA 1X4UA 1WENA 4LKAA 4H9DA
chains in the Genus database with same CATH topology
2KWOA 5KH7A 2YQLA 3LQJA 3KV5A 1G25A 5H1TA 3U5MA 2JMJA 4QF2A 2LGVA 2Y1NA 2HYED 3LRQA 2G45A 4FK5A 4UI9B 4X3GA 2MNZA 4PPEA 1MM2A 5D1LB 4ZDTA 3ZTGA 2F42A 2KIZA 2VJEB 3EB6A 4FJCA 1T1HA 4WA6A 3ZVZB 2K4DA 2YW8A 4LK9A 5AIUA 2FUIA 4GNDA 1WEEA 1LDKC 5C11A 2VPDA 3LQIA 5J3XA 3I2DA 1XWHA 3ZVYA 3U5PA 3N9MA 3RPGC 2E6SA 2KREA 2ECIA 1VD4A 2YREA 4FO9A 4V3KC 1FBVA 4PTBA 1ZBDB 2D8SA 2MA6A 3RPGB 2L80A 2MD8C 2K1JA 2C2VS 2PNXA 5H9MA 3ZYQA 1N87A 2KGIA 3DQVR 4GNEA 5KH3A 3N9OA 2RSDA 4IC2A 2H0DA 4P5OB 1VYXA 2ECWA 1WEOA 3EB5A 2YURA 4BHWA 4AP4A 1WEWA 4GNFA 4BBQA 4A4BA 1V87A 2YSMA 1LDJB 1WEUA 2JRJA 5TBNA 1MM3A 2EA6A 3L1ZB 1WE9A 4LADB 5AITA 5TDWA 5LKUA 4TKPB 4A49A 2CT2A 2E6RA 2M3HA 3FL2A 3MHHA 4V3LC 4LLBA 2YU4A 5D1MB 3SHBA 3ZPVE 4IC3A 3M63A 4ZUXU 1JM7A 1X4JA 3O33A 2FUUA 5FEYA 1F62A 2VP7A 2QIZA 2YT5A 2MD7B 3O7AA 3O70A 4R7EA 2M85A 4YAXA 1HYJA 3U5OA 2KWNA 1WEPA 5G04B 2HDPA 4QF3A 3U5NA 2M6MA 3IHPA 3KQIA 4YADA 4Q6FA 1X4IA 2LXHC 5B77A 2F6NA 2L0BA 5TABA 1K2FA 3KV6A 1Z2QA 2MUMA 3SOUA 2LGGA 2MT5A 2QJ0A 3O34A 4O64A 2XB1A 3O36A 3HTKC 2KYUA 4I7BA 2IDAA 1WILA 4WZ0A 1U6GB 2KR4A 4YABA 4ZQLA 3VK6A 5H1UA 5H1VA 2ZETC 1WEVA 2H0DB 2I50A 3L11A 1Z6UA 4WZ2A 5B8DA 2VJFA 4NN2A 3V43A 5DINA 5B79A 2K17A 4B7YC 3PUQA 5DKAA 4I7DA 4AUQB 4A4CA 2UZGA 3GL6A 1IYMA 5B78A 3O35A 3ZPV1 1WFKA 2LGKA 4AVXA 1JM7B 1WGMA 5FB1A 3SOWA 4A0CD 4UP5A 5LKTA 1WEQA 3T7LA 5D1KB 2YUCA 3N9NA 3PURA 2C2LA 2BAYA 3C5KA 3KNVA 5TRBA 2YHNA 2L75A 2LQ6A 1VFYA 2JMDA 4L58A 2DX8A 2CKLA 3LQHA 2M1RA 4AYCA 4I7CA 2OXQC 1Z60A 3M62A 5FB0A 2L5UA 1WIMA 1WEMA 2QICA 2VPGA 1RMDA 1DVPA 2F6JA 4F52B 2KU3A 3N9LA 3MHSA 5G0FA 3N9QA 2AN6A 2KE1A 5FERA 2ECJA 5G05B 1FP0A 2MIQA 4LJNA 4GB0A 4CCGX 4R2YA 2G6QA 3DPLR 1WESA 4W4UA 5B75A 2FSAA 4FIPA 4YC9A 5JG6A 2VPEA 5I3LA 4C9ZA 2MA5A 2Y43A 2XEUA 3HCSA 4YBTA 2K16A 4GNGA 5LKXA 3ASLA 2KWKA 2LDRA 3T6RA 2PUYA 3HCUA 2VJFB 3SOXA 2VPBA 3GV4A 3QZVA 2ECNA 2RI7A 2ECGA 2L43A 2VNFA 2VJEA 2ECVA 3L1XA 5LKZA 4N4FA 5EYAF 3N9PA 2NAAA 4YBSA 2KFTA 2KWJA 4YBMA 2YYRA 5TDRA 1BORA 1CHCA 4R8PK 2LRIC 2YHOA 3HCTA 2MNYA 4UP0A 4CA1A 1HYIA 4S3OC 4WZ3B 2YSJA 2EGPA 2ECTA 1E4UA 2KGGA 4MVTA 1JOCA 3ZNIA 3NG2A 3RTRB 2JMIA 3PHDA 3C6WA 2CKLB 2CSYA 4S3OB 4AYCB 2LXPC 4B86C 3M99A 2Y1MA 2EODA 5C13A 5LCWB 2LGLA 4XI1A 2CSZA 5KH9A 4YATA 4N3WA 2G43A 4MSXA 3O37A 2YQMA 2LN0A 5B76A 2LV9A 4L7XA 1X4UA 1WENA 4LKAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KWO A;  5KH7 A;  2YQL A;  3LQJ A;  3KV5 A;  1G25 A;  5H1T A;  3U5M A;  2JMJ A;  4QF2 A;  2LGV A;  2Y1N A;  2HYE D;  3LRQ A;  2G45 A;  4FK5 A;  4UI9 B;  4X3G A;  2MNZ A;  4PPE A;  1MM2 A;  5D1L B;  4ZDT A;  3ZTG A;  2F42 A;  2KIZ A;  2VJE B;  3EB6 A;  4FJC A;  1T1H A;  4WA6 A;  3ZVZ B;  2K4D A;  2YW8 A;  4LK9 A;  5AIU A;  2FUI A;  4GND A;  1WEE A;  1LDK C;  5C11 A;  2VPD A;  3LQI A;  5J3X A;  3I2D A;  1XWH A;  3ZVY A;  3U5P A;  3N9M A;  3RPG C;  2E6S A;  2KRE A;  2ECI A;  1VD4 A;  2YRE A;  4FO9 A;  4V3K C;  1FBV A;  4PTB A;  1ZBD B;  2D8S A;  2MA6 A;  3RPG B;  2L80 A;  2MD8 C;  2K1J A;  2C2V S;  2PNX A;  5H9M A;  3ZYQ A;  1N87 A;  2KGI A;  3DQV R;  4GNE A;  5KH3 A;  3N9O A;  2RSD A;  4IC2 A;  2H0D A;  4P5O B;  1VYX A;  2ECW A;  1WEO A;  3EB5 A;  2YUR A;  4BHW A;  4AP4 A;  1WEW A;  4GNF A;  4BBQ A;  4A4B A;  1V87 A;  2YSM A;  1LDJ B;  1WEU A;  2JRJ A;  5TBN A;  1MM3 A;  2EA6 A;  3L1Z B;  1WE9 A;  4LAD B;  5AIT A;  5TDW A;  5LKU A;  4TKP B;  4A49 A;  2CT2 A;  2E6R A;  2M3H A;  3FL2 A;  3MHH A;  4V3L C;  4LLB A;  2YU4 A;  5D1M B;  3SHB A;  3ZPV E;  4IC3 A;  3M63 A;  4ZUX U;  1JM7 A;  1X4J A;  3O33 A;  2FUU A;  5FEY A;  1F62 A;  2VP7 A;  2QIZ A;  2YT5 A;  2MD7 B;  3O7A A;  3O70 A;  4R7E A;  2M85 A;  4YAX A;  1HYJ A;  3U5O A;  2KWN A;  1WEP A;  5G04 B;  2HDP A;  4QF3 A;  3U5N A;  2M6M A;  3IHP A;  3KQI A;  4YAD A;  4Q6F A;  1X4I A;  2LXH C;  5B77 A;  2F6N A;  2L0B A;  5TAB A;  1K2F A;  3KV6 A;  1Z2Q A;  2MUM A;  3SOU A;  2LGG A;  2MT5 A;  2QJ0 A;  3O34 A;  4O64 A;  2XB1 A;  3O36 A;  3HTK C;  2KYU A;  4I7B A;  2IDA A;  1WIL A;  4WZ0 A;  1U6G B;  2KR4 A;  4YAB A;  4ZQL A;  3VK6 A;  5H1U A;  5H1V A;  2ZET C;  1WEV A;  2H0D B;  2I50 A;  3L11 A;  1Z6U A;  4WZ2 A;  5B8D A;  2VJF A;  4NN2 A;  3V43 A;  5DIN A;  5B79 A;  2K17 A;  4B7Y C;  3PUQ A;  5DKA A;  4I7D A;  4AUQ B;  4A4C A;  2UZG A;  3GL6 A;  1IYM A;  5B78 A;  3O35 A;  3ZPV 1;  1WFK A;  2LGK A;  4AVX A;  1JM7 B;  1WGM A;  5FB1 A;  3SOW A;  4A0C D;  4UP5 A;  5LKT A;  1WEQ A;  3T7L A;  5D1K B;  2YUC A;  3N9N A;  3PUR A;  2C2L A;  2BAY A;  3C5K A;  3KNV A;  5TRB A;  2YHN A;  2L75 A;  2LQ6 A;  1VFY A;  2JMD A;  4L58 A;  2DX8 A;  2CKL A;  3LQH A;  2M1R A;  4AYC A;  4I7C A;  2OXQ C;  1Z60 A;  3M62 A;  5FB0 A;  2L5U A;  1WIM A;  1WEM A;  2QIC A;  2VPG A;  1RMD A;  1DVP A;  2F6J A;  4F52 B;  2KU3 A;  3N9L A;  3MHS A;  5G0F A;  3N9Q A;  2AN6 A;  2KE1 A;  5FER A;  2ECJ A;  5G05 B;  1FP0 A;  2MIQ A;  4LJN A;  4GB0 A;  4CCG X;  4R2Y A;  2G6Q A;  3DPL R;  1WES A;  4W4U A;  5B75 A;  2FSA A;  4FIP A;  4YC9 A;  5JG6 A;  2VPE A;  5I3L A;  4C9Z A;  2MA5 A;  2Y43 A;  2XEU A;  3HCS A;  4YBT A;  2K16 A;  4GNG A;  5LKX A;  3ASL A;  2KWK A;  2LDR A;  3T6R A;  2PUY A;  3HCU A;  2VJF B;  3SOX A;  2VPB A;  3GV4 A;  3QZV A;  2ECN A;  2RI7 A;  2ECG A;  2L43 A;  2VNF A;  2VJE A;  2ECV A;  3L1X A;  5LKZ A;  4N4F A;  5EYA F;  3N9P A;  2NAA A;  4YBS A;  2KFT A;  2KWJ A;  4YBM A;  2YYR A;  5TDR A;  1BOR A;  1CHC A;  4R8P K;  2LRI C;  2YHO A;  3HCT A;  2MNY A;  4UP0 A;  4CA1 A;  1HYI A;  4S3O C;  4WZ3 B;  2YSJ A;  2EGP A;  2ECT A;  1E4U A;  2KGG A;  4MVT A;  1JOC A;  3ZNI A;  3NG2 A;  3RTR B;  2JMI A;  3PHD A;  3C6W A;  2CKL B;  2CSY A;  4S3O B;  4AYC B;  2LXP C;  4B86 C;  3M99 A;  2Y1M A;  2EOD A;  5C13 A;  5LCW B;  2LGL A;  4XI1 A;  2CSZ A;  5KH9 A;  4YAT A;  4N3W A;  2G43 A;  4MSX A;  3O37 A;  2YQM A;  2LN0 A;  5B76 A;  2LV9 A;  4L7X A;  1X4U A;  1WEN A;  4LKA A; 
#chains in the Genus database with same CATH topology
 4OGE A;  2KWO A;  2XP0 A;  5KH7 A;  2YQL A;  3LQJ A;  3KV5 A;  1G25 A;  5H1T A;  3U5M A;  2JMJ A;  4QF2 A;  2LGV A;  2Y1N A;  2HYE D;  3LRQ A;  5K3Q A;  2G45 A;  4FK5 A;  4UI9 B;  4X3G A;  2L7P A;  2MNZ A;  4PPE A;  1MM2 A;  5D1L B;  4ZDT A;  3ZTG A;  2F42 A;  2KIZ A;  2VJE B;  3EB6 A;  4FJC A;  1T1H A;  4WA6 A;  2CRW A;  3ZVZ B;  2K4D A;  2YW8 A;  4LK9 A;  5AIU A;  2FUI A;  4GND A;  1WEE A;  1LDK C;  2CRR A;  5C11 A;  2VPD A;  3LQI A;  5J3X A;  3I2D A;  1XWH A;  3ZVY A;  3U5P A;  3N9M A;  3RPG C;  2E6S A;  2KRE A;  2ECI A;  1VD4 A;  2YRE A;  4FO9 A;  4V3K C;  1FBV A;  4PTB A;  1ZBD B;  2D8S A;  2MA6 A;  3JUE A;  3RPG B;  2L80 A;  2MD8 C;  1MBM A;  2K1J A;  2C2V S;  2MKE A;  2PNX A;  5H9M A;  3ZYQ A;  4QQ4 A;  1N87 A;  2M13 A;  2KGI A;  3DQV R;  4GNE A;  5KH3 A;  3N9O A;  2RSD A;  4IC2 A;  2H0D A;  4P5O B;  1VYX A;  2ECW A;  1WEO A;  3EB5 A;  2YUR A;  4BHW A;  2YVR A;  4AP4 A;  1WEW A;  4GNF A;  4BBQ A;  3M7K A;  4A4B A;  1V87 A;  2YSM A;  1LDJ B;  1WEU A;  2JRJ A;  2P57 A;  5TBN A;  1MM3 A;  2EA6 A;  3L1Z B;  1WE9 A;  4LAD B;  5AIT A;  5TDW A;  5LKU A;  3DWD A;  2OWA A;  4TKP B;  4A49 A;  2CT2 A;  2E6R A;  2M3H A;  3FL2 A;  3MHH A;  4V3L C;  4LLB A;  2YU4 A;  5D1M B;  3SHB A;  3ZPV E;  4IC3 A;  3M63 A;  4ZUX U;  1JM7 A;  4Z0O A;  1X4J A;  3O33 A;  3LVQ E;  2FUU A;  5FEY A;  1F62 A;  2VP7 A;  2QIZ A;  2YT5 A;  2MD7 B;  2XOY A;  3O7A A;  3O70 A;  4R7E A;  2M85 A;  4YAX A;  1HYJ A;  3U5O A;  2KWN A;  1WEP A;  5G04 B;  2HDP A;  4QF3 A;  3U5N A;  2M6M A;  3IHP A;  3KQI A;  4YAD A;  5SVX A;  4Q6F A;  1X4I A;  2LXH C;  5B77 A;  2F6N A;  2L0B A;  5TAB A;  1K2F A;  3LJU X;  3O47 A;  3E2D A;  2E61 A;  3KV6 A;  1Z2Q A;  2MUM A;  3SOU A;  2LGG A;  2MT5 A;  2KKY A;  2QJ0 A;  5SVI A;  3O34 A;  2CSV A;  4O64 A;  2XB1 A;  3O36 A;  3HTK C;  2KYU A;  3LDY A;  3FM8 C;  4I7B A;  2IDA A;  1WIL A;  4WZ0 A;  1U6G B;  2KR4 A;  4YAB A;  2LAU A;  2DSM A;  4ZQL A;  3VK6 A;  5H1U A;  5H1V A;  2ZET C;  1WEV A;  3FJU B;  2H0D B;  3Q1D A;  2IQJ A;  2I50 A;  3L11 A;  1Z6U A;  4WZ2 A;  5B8D A;  2VJF A;  4NN2 A;  3V43 A;  5DIN A;  5B79 A;  2K17 A;  4B7Y C;  3PUQ A;  5DKA A;  4I7D A;  3KDE C;  3MDB C;  4AUQ B;  4A4C A;  2UZG A;  3GL6 A;  1IYM A;  4F1P A;  2XOC A;  5B78 A;  3O35 A;  4O62 A;  3ZPV 1;  1WFK A;  2LGK A;  4AVX A;  1JM7 B;  1DCQ A;  2JM3 A;  3FAO A;  2EXU A;  1WGM A;  5FB1 A;  3SOW A;  4A0C D;  4UP5 A;  5LKT A;  1WEQ A;  3T7L A;  5D1K B;  2YUC A;  3N9N A;  3PUR A;  3SUB A;  2C2L A;  2BAY A;  3C5K A;  3KNV A;  5TRB A;  2FD4 A;  2YHN A;  2L75 A;  2LQ6 A;  1VFY A;  2JMD A;  4L58 A;  2DX8 A;  2CKL A;  3LQH A;  2M1R A;  3FAN A;  4AYC A;  4I7C A;  2OXQ C;  1Z60 A;  3LVR E;  3M62 A;  5FB0 A;  2L5U A;  2RR4 A;  1WIM A;  1WEM A;  2QIC A;  2VPG A;  1RMD A;  1DVP A;  2F6J A;  3H7H A;  4F52 B;  2KU3 A;  3N9L A;  3MHS A;  5G0F A;  3N9Q A;  5SVI B;  2AN6 A;  2KE1 A;  5FER A;  2FFW A;  2ECJ A;  5G05 B;  1FP0 A;  2MIQ A;  4LJN A;  4GB0 A;  2KKX A;  4CCG X;  4OGC A;  4R2Y A;  2G6Q A;  3DPL R;  1WES A;  4W4U A;  5B75 A;  3T9K A;  2FSA A;  4FIP A;  4YC9 A;  5JG6 A;  2VPE A;  5I3L A;  4C9Z A;  2MA5 A;  2Y43 A;  2XEU A;  3HCS A;  4YBT A;  2K16 A;  4GNG A;  5LKX A;  3ASL A;  2KWK A;  3FEH A;  2LDR A;  3T6R A;  2PUY A;  3HCU A;  2VJF B;  3SOX A;  2VPB A;  2DJA A;  3GV4 A;  3QZV A;  2ECN A;  2RI7 A;  2ECG A;  2L43 A;  2VNF A;  2VJE A;  2ECV A;  3L1X A;  5LKZ A;  4N4F A;  3DDT A;  5EYA F;  3N9P A;  2NAA A;  4YBS A;  2KFT A;  2KWJ A;  2B0O E;  4YBM A;  2YYR A;  5TDR A;  1BOR A;  1CHC A;  2EGM A;  4R8P K;  2LRI C;  2YHO A;  2D8U A;  3HCT A;  2JUN A;  2MNY A;  4UP0 A;  4CA1 A;  1HYI A;  4S3O C;  4WZ3 B;  2YSJ A;  2CON A;  2ECT A;  2EGP A;  1E4U A;  2KGG A;  4MVT A;  1JOC A;  3ZNI A;  3NG2 A;  3RTR B;  2JMI A;  3PHD A;  3C6W A;  2CKL B;  2CSY A;  4S3O B;  4AYC B;  2LXP C;  4B86 C;  3PLW A;  4Z0R A;  3M99 A;  2Y1M A;  2EOD A;  5C13 A;  5LCW B;  2LGL A;  2XOZ A;  5SVY A;  4XI1 A;  2CSZ A;  5KH9 A;  4YAT A;  4N3W A;  2G43 A;  4MSX A;  3O37 A;  2YQM A;  2LN0 A;  5B76 A;  2LV9 A;  4L7X A;  1X4U A;  1WEN A;  4LKA A;  4H9D A; 
#chains in the Genus database with same CATH homology
 2KWO A;  5KH7 A;  2YQL A;  3LQJ A;  3KV5 A;  1G25 A;  5H1T A;  3U5M A;  2JMJ A;  4QF2 A;  2LGV A;  2Y1N A;  2HYE D;  3LRQ A;  2G45 A;  4FK5 A;  4UI9 B;  4X3G A;  2MNZ A;  4PPE A;  1MM2 A;  5D1L B;  4ZDT A;  3ZTG A;  2F42 A;  2KIZ A;  2VJE B;  3EB6 A;  4FJC A;  1T1H A;  4WA6 A;  3ZVZ B;  2K4D A;  2YW8 A;  4LK9 A;  5AIU A;  2FUI A;  4GND A;  1WEE A;  1LDK C;  5C11 A;  2VPD A;  3LQI A;  5J3X A;  3I2D A;  1XWH A;  3ZVY A;  3U5P A;  3N9M A;  3RPG C;  2E6S A;  2KRE A;  2ECI A;  1VD4 A;  2YRE A;  4FO9 A;  4V3K C;  1FBV A;  4PTB A;  1ZBD B;  2D8S A;  2MA6 A;  3RPG B;  2L80 A;  2MD8 C;  2K1J A;  2C2V S;  2PNX A;  5H9M A;  3ZYQ A;  1N87 A;  2KGI A;  3DQV R;  4GNE A;  5KH3 A;  3N9O A;  2RSD A;  4IC2 A;  2H0D A;  4P5O B;  1VYX A;  2ECW A;  1WEO A;  3EB5 A;  2YUR A;  4BHW A;  4AP4 A;  1WEW A;  4GNF A;  4BBQ A;  4A4B A;  1V87 A;  2YSM A;  1LDJ B;  1WEU A;  2JRJ A;  5TBN A;  1MM3 A;  2EA6 A;  3L1Z B;  1WE9 A;  4LAD B;  5AIT A;  5TDW A;  5LKU A;  4TKP B;  4A49 A;  2CT2 A;  2E6R A;  2M3H A;  3FL2 A;  3MHH A;  4V3L C;  4LLB A;  2YU4 A;  5D1M B;  3SHB A;  3ZPV E;  4IC3 A;  3M63 A;  4ZUX U;  1JM7 A;  1X4J A;  3O33 A;  2FUU A;  5FEY A;  1F62 A;  2VP7 A;  2QIZ A;  2YT5 A;  2MD7 B;  3O7A A;  3O70 A;  4R7E A;  2M85 A;  4YAX A;  1HYJ A;  3U5O A;  2KWN A;  1WEP A;  5G04 B;  2HDP A;  4QF3 A;  3U5N A;  2M6M A;  3IHP A;  3KQI A;  4YAD A;  4Q6F A;  1X4I A;  2LXH C;  5B77 A;  2F6N A;  2L0B A;  5TAB A;  1K2F A;  3KV6 A;  1Z2Q A;  2MUM A;  3SOU A;  2LGG A;  2MT5 A;  2QJ0 A;  3O34 A;  4O64 A;  2XB1 A;  3O36 A;  3HTK C;  2KYU A;  4I7B A;  2IDA A;  1WIL A;  4WZ0 A;  1U6G B;  2KR4 A;  4YAB A;  4ZQL A;  3VK6 A;  5H1U A;  5H1V A;  2ZET C;  1WEV A;  2H0D B;  2I50 A;  3L11 A;  1Z6U A;  4WZ2 A;  5B8D A;  2VJF A;  4NN2 A;  3V43 A;  5DIN A;  5B79 A;  2K17 A;  4B7Y C;  3PUQ A;  5DKA A;  4I7D A;  4AUQ B;  4A4C A;  2UZG A;  3GL6 A;  1IYM A;  5B78 A;  3O35 A;  3ZPV 1;  1WFK A;  2LGK A;  4AVX A;  1JM7 B;  1WGM A;  5FB1 A;  3SOW A;  4A0C D;  4UP5 A;  5LKT A;  1WEQ A;  3T7L A;  5D1K B;  2YUC A;  3N9N A;  3PUR A;  2C2L A;  2BAY A;  3C5K A;  3KNV A;  5TRB A;  2YHN A;  2L75 A;  2LQ6 A;  1VFY A;  2JMD A;  4L58 A;  2DX8 A;  2CKL A;  3LQH A;  2M1R A;  4AYC A;  4I7C A;  2OXQ C;  1Z60 A;  3M62 A;  5FB0 A;  2L5U A;  1WIM A;  1WEM A;  2QIC A;  2VPG A;  1RMD A;  1DVP A;  2F6J A;  4F52 B;  2KU3 A;  3N9L A;  3MHS A;  5G0F A;  3N9Q A;  2AN6 A;  2KE1 A;  5FER A;  2ECJ A;  5G05 B;  1FP0 A;  2MIQ A;  4LJN A;  4GB0 A;  4CCG X;  4R2Y A;  2G6Q A;  3DPL R;  1WES A;  4W4U A;  5B75 A;  2FSA A;  4FIP A;  4YC9 A;  5JG6 A;  2VPE A;  5I3L A;  4C9Z A;  2MA5 A;  2Y43 A;  2XEU A;  3HCS A;  4YBT A;  2K16 A;  4GNG A;  5LKX A;  3ASL A;  2KWK A;  2LDR A;  3T6R A;  2PUY A;  3HCU A;  2VJF B;  3SOX A;  2VPB A;  3GV4 A;  3QZV A;  2ECN A;  2RI7 A;  2ECG A;  2L43 A;  2VNF A;  2VJE A;  2ECV A;  3L1X A;  5LKZ A;  4N4F A;  5EYA F;  3N9P A;  2NAA A;  4YBS A;  2KFT A;  2KWJ A;  4YBM A;  2YYR A;  5TDR A;  1BOR A;  1CHC A;  4R8P K;  2LRI C;  2YHO A;  3HCT A;  2MNY A;  4UP0 A;  4CA1 A;  1HYI A;  4S3O C;  4WZ3 B;  2YSJ A;  2EGP A;  2ECT A;  1E4U A;  2KGG A;  4MVT A;  1JOC A;  3ZNI A;  3NG2 A;  3RTR B;  2JMI A;  3PHD A;  3C6W A;  2CKL B;  2CSY A;  4S3O B;  4AYC B;  2LXP C;  4B86 C;  3M99 A;  2Y1M A;  2EOD A;  5C13 A;  5LCW B;  2LGL A;  4XI1 A;  2CSZ A;  5KH9 A;  4YAT A;  4N3W A;  2G43 A;  4MSX A;  3O37 A;  2YQM A;  2LN0 A;  5B76 A;  2LV9 A;  4L7X A;  1X4U A;  1WEN A;  4LKA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...