4QF3A

Crystal structure of human baz2b phd zinc finger in the free form
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
57
structure length
57
Chain Sequence
b'MSIMKVYCQICRKGDNEELLLLCDGCDKGCHTYCHRPKITTIPDGDWFCPACIAKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bromodomain adjacent to zinc finger domain protein 2B
publication title Molecular basis of histone tail recognition by human TIP5 PHD finger and bromodomain of the chromatin remodeling complex NoRC.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 9
structure length 57
sequence length 57
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4qf3A00
2EGPA 4LKAA 2K1JA 2OXQC 1ZBDB 2FUUA 3O33A 4ZDTA 5C13A 5C11A 2EA6A 3ZTGA 4FJCA 2E6SA 3N9NA 2ECIA 3L1ZB 5D1MB 1WE9A 2G43A 4WZ0A 1CHCA 2LN0A 2MIQA 4UP0A 3N9PA 3N9OA 4W4UA 1F62A 3VK6A 2LGGA 3DPLR 4IC3A 5J3XA 4YATA 2F42A 4P5OB 4S3OC 3ZVZB 3L11A 3IHPA 4IC2A 4AYCA 1WEQA 5D1LB 3RPGC 2CSZA 2PUYA 5I3LA 2LQ6A 1JOCA 1WEWA 2JMJA 2QIZA 1WEOA 2CSYA 2ECTA 1XWHA 1U6GB 5FEYA 3O70A 5AITA 3GL6A 3U5MA 5FB1A 3T7LA 3KNVA 4N3WA 2QJ0A 3RPGB 2CKLB 2JRJA 2LRIC 2ECWA 1WEUA 1WEEA 2ECVA 4FK5A 1WENA 1WFKA 2EODA 1DVPA 4ZQLA 4TKPB 5LKZA 4V3LC 3U5OA 3QZVA 2LXHC 2KWNA 2K4DA 4L58A 1LDJB 3ZYQA 2YQLA 4R8PK 2FSAA 2KREA 1WGMA 2VJFA 2VP7A 5D1KB 2NAAA 2K16A 2BAYA 5LKTA 1WEPA 1HYJA 4FIPA 3GV4A 4LJNA 4V3KC 1JM7A 3KV5A 5KH3A 3O35A 3ZPV1 2Y1NA 4CA1A 1VYXA 2YURA 2VJEA 1FP0A 3DQVR 2L5UA 3N9QA 3LQIA 2YREA 2G45A 3LQJA 2L80A 3LRQA 2DX8A 1T1HA 5AIUA 2YT5A 5H1VA 2VJFB 2LXPC 2KWOA 3PUQA 2MA6A 4LADB 4YBMA 4A4CA 1JM7B 4AUQB 5LCWB 2VPEA 2M1RA 2LGLA 5B8DA 2VJEB 1MM3A 2YU4A 2MD8C 4N4FA 3KQIA 3EB6A 2CKLA 3V43A 4QF2A 5EYAF 2MA5A 1BORA 3L1XA 4QF3A 4YADA 2C2VS 2F6JA 2KGGA 2IDAA 2RI7A 4I7BA 3RTRB 4PTBA 2FUIA 2L0BA 3M62A 2KFTA 4GNEA 2YSMA 5G05B 2M85A 4S3OB 1X4JA 2KWKA 4GNFA 3C6WA 4WZ2A 1K2FA 1N87A 2YHNA 3MHHA 2G6QA 4Q6FA 1G25A 1V87A 1Z60A 2YQMA 5FERA 3SOUA 2E6RA 2YUCA 1MM2A 3HCTA 5B75A 2LDRA 2VPBA 5DINA 4C9ZA 2ECNA 2M6MA 5TABA 2Y1MA 4CCGX 3O36A 4NN2A 1X4UA 2LGKA 2ECJA 2MD7B 4MVTA 1IYMA 2VPGA 5B77A 2VNFA 3ZVYA 4BHWA 2MNYA 5TRBA 1LDKC 3M63A 4I7DA 4YAXA 2C2LA 1HYIA 2H0DB 4B7YC 2KYUA 2LV9A 2AN6A 3NG2A 3O34A 3U5PA 4XI1A 3SOWA 4O64A 2Y43A 2JMDA 3ZPVE 3FL2A 2ECGA 2L43A 5JG6A 2KU3A 2HYED 3N9LA 3ZNIA 3T6RA 3EB5A 2F6NA 4R2YA 4AP4A 3MHSA 2KWJA 3C5KA 5KH9A 4LK9A 2YYRA 1WIMA 4PPEA 1X4IA 4B86C 5TBNA 5TDWA 3U5NA 2MNZA 2MUMA 1E4UA 1FBVA 2YSJA 4L7XA 3PURA 4YABA 1Z2QA 3I2DA 4LLBA 3LQHA 5DKAA 3ASLA 4GB0A 3O7AA 3M99A 4FO9A 2HDPA 3HTKC 4ZUXU 4GNDA 3PHDA 5H9MA 2K17A 4YC9A 2LGVA 4A4BA 1Z6UA 2KE1A 2I50A 4F52B 1WILA 3O37A 2H0DA 2CT2A 5H1UA 5G04B 5G0FA 1WEVA 2M3HA 5TDRA 5LKUA 2XB1A 4AYCB 3SOXA 4UI9B 2ZETC 2XEUA 2VPDA 3HCSA 1RMDA 3N9MA 4WA6A 2RSDA 4WZ3B 5H1TA 5LKXA 2L75A 4YBTA 2QICA 1VFYA 2YHOA 3SHBA 2YW8A 2JMIA 2MT5A 1WESA 5KH7A 2KR4A 1VD4A 2KGIA 2PNXA 2D8SA 4BBQA 4A49A 3HCUA 4UP5A 5B78A 4A0CD 5B76A 4I7CA 4MSXA 4X3GA 2UZGA 4AVXA 1WEMA 4YBSA 5FB0A 5B79A 2KIZA 4GNGA 3KV6A 4R7EA
chains in the Genus database with same CATH superfamily
2EGPA 4LKAA 2K1JA 2OXQC 1ZBDB 2FUUA 3O33A 4ZDTA 2CRWA 5C13A 5C11A 3O47A 2EA6A 1MBMA 3ZTGA 4F1PA 3FJUB 4FJCA 2E6SA 3N9NA 2ECIA 3L1ZB 5D1MB 1WE9A 2G43A 4WZ0A 1CHCA 2LN0A 2MIQA 4UP0A 3N9PA 3N9OA 5SVIB 4OGCA 4W4UA 1F62A 3VK6A 2LGGA 2XOZA 3DPLR 4IC3A 5J3XA 4YATA 2F42A 4P5OB 4S3OC 2JM3A 3ZVZB 3L11A 3IHPA 4IC2A 3M7KA 4AYCA 1WEQA 5D1LB 3RPGC 2CSZA 2PUYA 5I3LA 2LQ6A 1JOCA 1WEWA 2JMJA 2QIZA 1WEOA 2CSYA 5SVXA 2ECTA 1XWHA 1U6GB 5FEYA 3O70A 5AITA 3DDTA 3GL6A 3U5MA 5FB1A 2KKYA 3T7LA 3KNVA 4N3WA 4QQ4A 2QJ0A 3RPGB 2CKLB 2JRJA 2LRIC 2ECWA 1WEUA 1WEEA 3LVRE 2ECVA 4FK5A 3Q1DA 1WENA 1WFKA 2EODA 2M13A 1DVPA 4ZQLA 4TKPB 5LKZA 4V3LC 3U5OA 2XP0A 3FEHA 3QZVA 3T9KA 2LXHC 2KWNA 2K4DA 4L58A 1LDJB 2EGMA 3ZYQA 2YQLA 4R8PK 2FSAA 2CSVA 2KREA 1WGMA 3SUBA 2XOYA 2VJFA 2VP7A 5D1KB 2NAAA 2MKEA 2K16A 2BAYA 5LKTA 1WEPA 1HYJA 5K3QA 4FIPA 3GV4A 4LJNA 4V3KC 1JM7A 3KV5A 5KH3A 3O35A 3ZPV1 2Y1NA 4CA1A 1VYXA 2YURA 2VJEA 1FP0A 3DQVR 2L5UA 3N9QA 3LQIA 2YREA 2G45A 3LQJA 2L80A 3LRQA 2DX8A 1T1HA 2EXUA 5AIUA 2YT5A 5H1VA 2VJFB 2XOCA 2LXPC 2P57A 2KWOA 3DWDA 3PUQA 2MA6A 4LADB 5SVYA 4YBMA 4A4CA 1JM7B 4AUQB 5LCWB 2VPEA 2M1RA 3MDBC 2LGLA 5B8DA 2VJEB 2OWAA 1MM3A 2YU4A 2MD8C 3LJUX 4N4FA 3KQIA 3EB6A 2CKLA 3V43A 4QF2A 5EYAF 2MA5A 1BORA 3L1XA 4QF3A 4YADA 2C2VS 2F6JA 2KGGA 2IDAA 2RI7A 4I7BA 3RTRB 4PTBA 2FUIA 2L0BA 3M62A 2KFTA 4GNEA 2YSMA 5G05B 2M85A 4S3OB 1X4JA 2KWKA 4GNFA 2JUNA 3C6WA 4WZ2A 1K2FA 1N87A 2YHNA 3E2DA 3MHHA 2G6QA 4Q6FA 1G25A 1V87A 1Z60A 2YQMA 2FD4A 5FERA 3SOUA 2IQJA 2E6RA 2YUCA 1MM2A 3HCTA 5B75A 2LDRA 2VPBA 5DINA 4C9ZA 2ECNA 2FFWA 2M6MA 5TABA 2Y1MA 4CCGX 3O36A 4NN2A 2KKXA 1X4UA 2LGKA 2ECJA 2MD7B 4MVTA 1IYMA 2VPGA 5B77A 3JUEA 2VNFA 3ZVYA 4BHWA 2MNYA 5TRBA 1LDKC 3M63A 4I7DA 4YAXA 2C2LA 3FAOA 1HYIA 2H0DB 4B7YC 2KYUA 2LV9A 2AN6A 3NG2A 3O34A 3U5PA 4XI1A 3SOWA 4O64A 2Y43A 2JMDA 3ZPVE 2DJAA 3FL2A 2ECGA 2L43A 5JG6A 2KU3A 2HYED 3N9LA 3ZNIA 3H7HA 3T6RA 3EB5A 3PLWA 2F6NA 4R2YA 4AP4A 3MHSA 2KWJA 3C5KA 5KH9A 4LK9A 2YYRA 1WIMA 3KDEC 4PPEA 1X4IA 4B86C 5TBNA 2CONA 2D8UA 5TDWA 3U5NA 2MNZA 2MUMA 1E4UA 1FBVA 2YSJA 4L7XA 3PURA 4Z0OA 4YABA 1Z2QA 3I2DA 4LLBA 3LQHA 5DKAA 2DSMA 3ASLA 4GB0A 3O7AA 4O62A 2E61A 3M99A 4FO9A 2HDPA 2RR4A 3HTKC 4ZUXU 4GNDA 3PHDA 5H9MA 2K17A 4YC9A 2LGVA 4A4BA 1Z6UA 2KE1A 2I50A 4F52B 1WILA 3O37A 2H0DA 2CT2A 5H1UA 2B0OE 5G04B 2L7PA 1WEVA 5G0FA 1DCQA 2M3HA 5TDRA 2LAUA 5LKUA 2XB1A 4AYCB 3SOXA 4UI9B 2ZETC 2YVRA 2XEUA 2VPDA 3LVQE 3HCSA 1RMDA 4H9DA 3N9MA 4WA6A 2RSDA 4WZ3B 4OGEA 5H1TA 5LKXA 2L75A 4YBTA 2QICA 1VFYA 2YHOA 3SHBA 3FANA 2YW8A 2JMIA 2MT5A 1WESA 5KH7A 2KR4A 3LDYA 1VD4A 2KGIA 2PNXA 2D8SA 3FM8C 4BBQA 4A49A 3HCUA 4UP5A 5B78A 4A0CD 5B76A 4I7CA 4MSXA 4X3GA 2UZGA 4Z0RA 4AVXA 1WEMA 5SVIA 4YBSA 2CRRA 5FB0A 5B79A 2KIZA 4GNGA 3KV6A 4R7EA
chains in the Genus database with same CATH topology
2EGPA 4LKAA 2K1JA 2OXQC 1ZBDB 2FUUA 3O33A 4ZDTA 5C13A 5C11A 2EA6A 3ZTGA 4FJCA 2E6SA 3N9NA 2ECIA 3L1ZB 5D1MB 1WE9A 2G43A 4WZ0A 1CHCA 2LN0A 2MIQA 4UP0A 3N9PA 3N9OA 4W4UA 1F62A 3VK6A 2LGGA 3DPLR 4IC3A 5J3XA 4YATA 2F42A 4P5OB 4S3OC 3ZVZB 3L11A 3IHPA 4IC2A 4AYCA 1WEQA 5D1LB 3RPGC 2CSZA 2PUYA 5I3LA 2LQ6A 1JOCA 1WEWA 2JMJA 2QIZA 1WEOA 2CSYA 2ECTA 1XWHA 1U6GB 5FEYA 3O70A 5AITA 3GL6A 3U5MA 5FB1A 3T7LA 3KNVA 4N3WA 2QJ0A 3RPGB 2CKLB 2JRJA 2LRIC 2ECWA 1WEUA 1WEEA 2ECVA 4FK5A 1WENA 1WFKA 2EODA 1DVPA 4ZQLA 4TKPB 5LKZA 4V3LC 3U5OA 3QZVA 2LXHC 2KWNA 2K4DA 4L58A 1LDJB 3ZYQA 2YQLA 4R8PK 2FSAA 2KREA 1WGMA 2VJFA 2VP7A 5D1KB 2NAAA 2K16A 2BAYA 5LKTA 1WEPA 1HYJA 4FIPA 3GV4A 4LJNA 4V3KC 1JM7A 3KV5A 5KH3A 3O35A 3ZPV1 2Y1NA 4CA1A 1VYXA 2YURA 2VJEA 1FP0A 3DQVR 2L5UA 3N9QA 3LQIA 2YREA 2G45A 3LQJA 2L80A 3LRQA 2DX8A 1T1HA 5AIUA 2YT5A 5H1VA 2VJFB 2LXPC 2KWOA 3PUQA 2MA6A 4LADB 4YBMA 4A4CA 1JM7B 4AUQB 5LCWB 2VPEA 2M1RA 2LGLA 5B8DA 2VJEB 1MM3A 2YU4A 2MD8C 4N4FA 3KQIA 3EB6A 2CKLA 3V43A 4QF2A 5EYAF 2MA5A 1BORA 3L1XA 4QF3A 4YADA 2C2VS 2F6JA 2KGGA 2IDAA 2RI7A 4I7BA 3RTRB 4PTBA 2FUIA 2L0BA 3M62A 2KFTA 4GNEA 2YSMA 5G05B 2M85A 4S3OB 1X4JA 2KWKA 4GNFA 3C6WA 4WZ2A 1K2FA 1N87A 2YHNA 3MHHA 2G6QA 4Q6FA 1G25A 1V87A 1Z60A 2YQMA 5FERA 3SOUA 2E6RA 2YUCA 1MM2A 3HCTA 5B75A 2LDRA 2VPBA 5DINA 4C9ZA 2ECNA 2M6MA 5TABA 2Y1MA 4CCGX 3O36A 4NN2A 1X4UA 2LGKA 2ECJA 2MD7B 4MVTA 1IYMA 2VPGA 5B77A 2VNFA 3ZVYA 4BHWA 2MNYA 5TRBA 1LDKC 3M63A 4I7DA 4YAXA 2C2LA 1HYIA 2H0DB 4B7YC 2KYUA 2LV9A 2AN6A 3NG2A 3O34A 3U5PA 4XI1A 3SOWA 4O64A 2Y43A 2JMDA 3ZPVE 3FL2A 2ECGA 2L43A 5JG6A 2KU3A 2HYED 3N9LA 3ZNIA 3T6RA 3EB5A 2F6NA 4R2YA 4AP4A 3MHSA 2KWJA 3C5KA 5KH9A 4LK9A 2YYRA 1WIMA 4PPEA 1X4IA 4B86C 5TBNA 5TDWA 3U5NA 2MNZA 2MUMA 1E4UA 1FBVA 2YSJA 4L7XA 3PURA 4YABA 1Z2QA 3I2DA 4LLBA 3LQHA 5DKAA 3ASLA 4GB0A 3O7AA 3M99A 4FO9A 2HDPA 3HTKC 4ZUXU 4GNDA 3PHDA 5H9MA 2K17A 4YC9A 2LGVA 4A4BA 1Z6UA 2KE1A 2I50A 4F52B 1WILA 3O37A 2H0DA 2CT2A 5H1UA 5G04B 5G0FA 1WEVA 2M3HA 5TDRA 5LKUA 2XB1A 4AYCB 3SOXA 4UI9B 2ZETC 2XEUA 2VPDA 3HCSA 1RMDA 3N9MA 4WA6A 2RSDA 4WZ3B 5H1TA 5LKXA 2L75A 4YBTA 2QICA 1VFYA 2YHOA 3SHBA 2YW8A 2JMIA 2MT5A 1WESA 5KH7A 2KR4A 1VD4A 2KGIA 2PNXA 2D8SA 4BBQA 4A49A 3HCUA 4UP5A 5B78A 4A0CD 5B76A 4I7CA 4MSXA 4X3GA 2UZGA 4AVXA 1WEMA 4YBSA 5FB0A 5B79A 2KIZA 4GNGA 3KV6A 4R7EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EGP A;  4LKA A;  2K1J A;  2OXQ C;  1ZBD B;  2FUU A;  3O33 A;  4ZDT A;  5C13 A;  5C11 A;  2EA6 A;  3ZTG A;  4FJC A;  2E6S A;  3N9N A;  2ECI A;  3L1Z B;  5D1M B;  1WE9 A;  2G43 A;  4WZ0 A;  1CHC A;  2LN0 A;  2MIQ A;  4UP0 A;  3N9P A;  3N9O A;  4W4U A;  1F62 A;  3VK6 A;  2LGG A;  3DPL R;  4IC3 A;  5J3X A;  4YAT A;  2F42 A;  4P5O B;  4S3O C;  3ZVZ B;  3L11 A;  3IHP A;  4IC2 A;  4AYC A;  1WEQ A;  5D1L B;  3RPG C;  2CSZ A;  2PUY A;  5I3L A;  2LQ6 A;  1JOC A;  1WEW A;  2JMJ A;  2QIZ A;  1WEO A;  2CSY A;  2ECT A;  1XWH A;  1U6G B;  5FEY A;  3O70 A;  5AIT A;  3GL6 A;  3U5M A;  5FB1 A;  3T7L A;  3KNV A;  4N3W A;  2QJ0 A;  3RPG B;  2CKL B;  2JRJ A;  2LRI C;  2ECW A;  1WEU A;  1WEE A;  2ECV A;  4FK5 A;  1WEN A;  1WFK A;  2EOD A;  1DVP A;  4ZQL A;  4TKP B;  5LKZ A;  4V3L C;  3U5O A;  3QZV A;  2LXH C;  2KWN A;  2K4D A;  4L58 A;  1LDJ B;  3ZYQ A;  2YQL A;  4R8P K;  2FSA A;  2KRE A;  1WGM A;  2VJF A;  2VP7 A;  5D1K B;  2NAA A;  2K16 A;  2BAY A;  5LKT A;  1WEP A;  1HYJ A;  4FIP A;  3GV4 A;  4LJN A;  4V3K C;  1JM7 A;  3KV5 A;  5KH3 A;  3O35 A;  3ZPV 1;  2Y1N A;  4CA1 A;  1VYX A;  2YUR A;  2VJE A;  1FP0 A;  3DQV R;  2L5U A;  3N9Q A;  3LQI A;  2YRE A;  2G45 A;  3LQJ A;  2L80 A;  3LRQ A;  2DX8 A;  1T1H A;  5AIU A;  2YT5 A;  5H1V A;  2VJF B;  2LXP C;  2KWO A;  3PUQ A;  2MA6 A;  4LAD B;  4YBM A;  4A4C A;  1JM7 B;  4AUQ B;  5LCW B;  2VPE A;  2M1R A;  2LGL A;  5B8D A;  2VJE B;  1MM3 A;  2YU4 A;  2MD8 C;  4N4F A;  3KQI A;  3EB6 A;  2CKL A;  3V43 A;  4QF2 A;  5EYA F;  2MA5 A;  1BOR A;  3L1X A;  4QF3 A;  4YAD A;  2C2V S;  2F6J A;  2KGG A;  2IDA A;  2RI7 A;  4I7B A;  3RTR B;  4PTB A;  2FUI A;  2L0B A;  3M62 A;  2KFT A;  4GNE A;  2YSM A;  5G05 B;  2M85 A;  4S3O B;  1X4J A;  2KWK A;  4GNF A;  3C6W A;  4WZ2 A;  1K2F A;  1N87 A;  2YHN A;  3MHH A;  2G6Q A;  4Q6F A;  1G25 A;  1V87 A;  1Z60 A;  2YQM A;  5FER A;  3SOU A;  2E6R A;  2YUC A;  1MM2 A;  3HCT A;  5B75 A;  2LDR A;  2VPB A;  5DIN A;  4C9Z A;  2ECN A;  2M6M A;  5TAB A;  2Y1M A;  4CCG X;  3O36 A;  4NN2 A;  1X4U A;  2LGK A;  2ECJ A;  2MD7 B;  4MVT A;  1IYM A;  2VPG A;  5B77 A;  2VNF A;  3ZVY A;  4BHW A;  2MNY A;  5TRB A;  1LDK C;  3M63 A;  4I7D A;  4YAX A;  2C2L A;  1HYI A;  2H0D B;  4B7Y C;  2KYU A;  2LV9 A;  2AN6 A;  3NG2 A;  3O34 A;  3U5P A;  4XI1 A;  3SOW A;  4O64 A;  2Y43 A;  2JMD A;  3ZPV E;  3FL2 A;  2ECG A;  2L43 A;  5JG6 A;  2KU3 A;  2HYE D;  3N9L A;  3ZNI A;  3T6R A;  3EB5 A;  2F6N A;  4R2Y A;  4AP4 A;  3MHS A;  2KWJ A;  3C5K A;  5KH9 A;  4LK9 A;  2YYR A;  1WIM A;  4PPE A;  1X4I A;  4B86 C;  5TBN A;  5TDW A;  3U5N A;  2MNZ A;  2MUM A;  1E4U A;  1FBV A;  2YSJ A;  4L7X A;  3PUR A;  4YAB A;  1Z2Q A;  3I2D A;  4LLB A;  3LQH A;  5DKA A;  3ASL A;  4GB0 A;  3O7A A;  3M99 A;  4FO9 A;  2HDP A;  3HTK C;  4ZUX U;  4GND A;  3PHD A;  5H9M A;  2K17 A;  4YC9 A;  2LGV A;  4A4B A;  1Z6U A;  2KE1 A;  2I50 A;  4F52 B;  1WIL A;  3O37 A;  2H0D A;  2CT2 A;  5H1U A;  5G04 B;  5G0F A;  1WEV A;  2M3H A;  5TDR A;  5LKU A;  2XB1 A;  4AYC B;  3SOX A;  4UI9 B;  2ZET C;  2XEU A;  2VPD A;  3HCS A;  1RMD A;  3N9M A;  4WA6 A;  2RSD A;  4WZ3 B;  5H1T A;  5LKX A;  2L75 A;  4YBT A;  2QIC A;  1VFY A;  2YHO A;  3SHB A;  2YW8 A;  2JMI A;  2MT5 A;  1WES A;  5KH7 A;  2KR4 A;  1VD4 A;  2KGI A;  2PNX A;  2D8S A;  4BBQ A;  4A49 A;  3HCU A;  4UP5 A;  5B78 A;  4A0C D;  5B76 A;  4I7C A;  4MSX A;  4X3G A;  2UZG A;  4AVX A;  1WEM A;  4YBS A;  5FB0 A;  5B79 A;  2KIZ A;  4GNG A;  3KV6 A;  4R7E A; 
#chains in the Genus database with same CATH topology
 2EGP A;  4LKA A;  2K1J A;  2OXQ C;  1ZBD B;  2FUU A;  3O33 A;  4ZDT A;  2CRW A;  5C13 A;  5C11 A;  3O47 A;  2EA6 A;  1MBM A;  3ZTG A;  4F1P A;  3FJU B;  4FJC A;  2E6S A;  3N9N A;  2ECI A;  3L1Z B;  5D1M B;  1WE9 A;  2G43 A;  4WZ0 A;  1CHC A;  2LN0 A;  2MIQ A;  4UP0 A;  3N9P A;  3N9O A;  5SVI B;  4OGC A;  4W4U A;  1F62 A;  3VK6 A;  2LGG A;  2XOZ A;  3DPL R;  4IC3 A;  5J3X A;  4YAT A;  2F42 A;  4P5O B;  4S3O C;  2JM3 A;  3ZVZ B;  3L11 A;  3IHP A;  4IC2 A;  3M7K A;  4AYC A;  1WEQ A;  5D1L B;  3RPG C;  2CSZ A;  2PUY A;  5I3L A;  2LQ6 A;  1JOC A;  1WEW A;  2JMJ A;  2QIZ A;  1WEO A;  2CSY A;  5SVX A;  2ECT A;  1XWH A;  1U6G B;  5FEY A;  3O70 A;  5AIT A;  3DDT A;  3GL6 A;  3U5M A;  5FB1 A;  2KKY A;  3T7L A;  3KNV A;  4N3W A;  4QQ4 A;  2QJ0 A;  3RPG B;  2CKL B;  2JRJ A;  2LRI C;  2ECW A;  1WEU A;  1WEE A;  3LVR E;  2ECV A;  4FK5 A;  3Q1D A;  1WEN A;  1WFK A;  2EOD A;  2M13 A;  1DVP A;  4ZQL A;  4TKP B;  5LKZ A;  4V3L C;  3U5O A;  2XP0 A;  3FEH A;  3QZV A;  3T9K A;  2LXH C;  2KWN A;  2K4D A;  4L58 A;  1LDJ B;  2EGM A;  3ZYQ A;  2YQL A;  4R8P K;  2FSA A;  2CSV A;  2KRE A;  1WGM A;  3SUB A;  2XOY A;  2VJF A;  2VP7 A;  5D1K B;  2NAA A;  2MKE A;  2K16 A;  2BAY A;  5LKT A;  1WEP A;  1HYJ A;  5K3Q A;  4FIP A;  3GV4 A;  4LJN A;  4V3K C;  1JM7 A;  3KV5 A;  5KH3 A;  3O35 A;  3ZPV 1;  2Y1N A;  4CA1 A;  1VYX A;  2YUR A;  2VJE A;  1FP0 A;  3DQV R;  2L5U A;  3N9Q A;  3LQI A;  2YRE A;  2G45 A;  3LQJ A;  2L80 A;  3LRQ A;  2DX8 A;  1T1H A;  2EXU A;  5AIU A;  2YT5 A;  5H1V A;  2VJF B;  2XOC A;  2LXP C;  2P57 A;  2KWO A;  3DWD A;  3PUQ A;  2MA6 A;  4LAD B;  5SVY A;  4YBM A;  4A4C A;  1JM7 B;  4AUQ B;  5LCW B;  2VPE A;  2M1R A;  3MDB C;  2LGL A;  5B8D A;  2VJE B;  2OWA A;  1MM3 A;  2YU4 A;  2MD8 C;  3LJU X;  4N4F A;  3KQI A;  3EB6 A;  2CKL A;  3V43 A;  4QF2 A;  5EYA F;  2MA5 A;  1BOR A;  3L1X A;  4QF3 A;  4YAD A;  2C2V S;  2F6J A;  2KGG A;  2IDA A;  2RI7 A;  4I7B A;  3RTR B;  4PTB A;  2FUI A;  2L0B A;  3M62 A;  2KFT A;  4GNE A;  2YSM A;  5G05 B;  2M85 A;  4S3O B;  1X4J A;  2KWK A;  4GNF A;  2JUN A;  3C6W A;  4WZ2 A;  1K2F A;  1N87 A;  2YHN A;  3E2D A;  3MHH A;  2G6Q A;  4Q6F A;  1G25 A;  1V87 A;  1Z60 A;  2YQM A;  2FD4 A;  5FER A;  3SOU A;  2IQJ A;  2E6R A;  2YUC A;  1MM2 A;  3HCT A;  5B75 A;  2LDR A;  2VPB A;  5DIN A;  4C9Z A;  2ECN A;  2FFW A;  2M6M A;  5TAB A;  2Y1M A;  4CCG X;  3O36 A;  4NN2 A;  2KKX A;  1X4U A;  2LGK A;  2ECJ A;  2MD7 B;  4MVT A;  1IYM A;  2VPG A;  5B77 A;  3JUE A;  2VNF A;  3ZVY A;  4BHW A;  2MNY A;  5TRB A;  1LDK C;  3M63 A;  4I7D A;  4YAX A;  2C2L A;  3FAO A;  1HYI A;  2H0D B;  4B7Y C;  2KYU A;  2LV9 A;  2AN6 A;  3NG2 A;  3O34 A;  3U5P A;  4XI1 A;  3SOW A;  4O64 A;  2Y43 A;  2JMD A;  3ZPV E;  2DJA A;  3FL2 A;  2ECG A;  2L43 A;  5JG6 A;  2KU3 A;  2HYE D;  3N9L A;  3ZNI A;  3H7H A;  3T6R A;  3EB5 A;  3PLW A;  2F6N A;  4R2Y A;  4AP4 A;  3MHS A;  2KWJ A;  3C5K A;  5KH9 A;  4LK9 A;  2YYR A;  1WIM A;  3KDE C;  4PPE A;  1X4I A;  4B86 C;  5TBN A;  2CON A;  2D8U A;  5TDW A;  3U5N A;  2MNZ A;  2MUM A;  1E4U A;  1FBV A;  2YSJ A;  4L7X A;  3PUR A;  4Z0O A;  4YAB A;  1Z2Q A;  3I2D A;  4LLB A;  3LQH A;  5DKA A;  2DSM A;  3ASL A;  4GB0 A;  3O7A A;  4O62 A;  2E61 A;  3M99 A;  4FO9 A;  2HDP A;  2RR4 A;  3HTK C;  4ZUX U;  4GND A;  3PHD A;  5H9M A;  2K17 A;  4YC9 A;  2LGV A;  4A4B A;  1Z6U A;  2KE1 A;  2I50 A;  4F52 B;  1WIL A;  3O37 A;  2H0D A;  2CT2 A;  5H1U A;  2B0O E;  5G04 B;  2L7P A;  1WEV A;  5G0F A;  1DCQ A;  2M3H A;  5TDR A;  2LAU A;  5LKU A;  2XB1 A;  4AYC B;  3SOX A;  4UI9 B;  2ZET C;  2YVR A;  2XEU A;  2VPD A;  3LVQ E;  3HCS A;  1RMD A;  4H9D A;  3N9M A;  4WA6 A;  2RSD A;  4WZ3 B;  4OGE A;  5H1T A;  5LKX A;  2L75 A;  4YBT A;  2QIC A;  1VFY A;  2YHO A;  3SHB A;  3FAN A;  2YW8 A;  2JMI A;  2MT5 A;  1WES A;  5KH7 A;  2KR4 A;  3LDY A;  1VD4 A;  2KGI A;  2PNX A;  2D8S A;  3FM8 C;  4BBQ A;  4A49 A;  3HCU A;  4UP5 A;  5B78 A;  4A0C D;  5B76 A;  4I7C A;  4MSX A;  4X3G A;  2UZG A;  4Z0R A;  4AVX A;  1WEM A;  5SVI A;  4YBS A;  2CRR A;  5FB0 A;  5B79 A;  2KIZ A;  4GNG A;  3KV6 A;  4R7E A; 
#chains in the Genus database with same CATH homology
 2EGP A;  4LKA A;  2K1J A;  2OXQ C;  1ZBD B;  2FUU A;  3O33 A;  4ZDT A;  5C13 A;  5C11 A;  2EA6 A;  3ZTG A;  4FJC A;  2E6S A;  3N9N A;  2ECI A;  3L1Z B;  5D1M B;  1WE9 A;  2G43 A;  4WZ0 A;  1CHC A;  2LN0 A;  2MIQ A;  4UP0 A;  3N9P A;  3N9O A;  4W4U A;  1F62 A;  3VK6 A;  2LGG A;  3DPL R;  4IC3 A;  5J3X A;  4YAT A;  2F42 A;  4P5O B;  4S3O C;  3ZVZ B;  3L11 A;  3IHP A;  4IC2 A;  4AYC A;  1WEQ A;  5D1L B;  3RPG C;  2CSZ A;  2PUY A;  5I3L A;  2LQ6 A;  1JOC A;  1WEW A;  2JMJ A;  2QIZ A;  1WEO A;  2CSY A;  2ECT A;  1XWH A;  1U6G B;  5FEY A;  3O70 A;  5AIT A;  3GL6 A;  3U5M A;  5FB1 A;  3T7L A;  3KNV A;  4N3W A;  2QJ0 A;  3RPG B;  2CKL B;  2JRJ A;  2LRI C;  2ECW A;  1WEU A;  1WEE A;  2ECV A;  4FK5 A;  1WEN A;  1WFK A;  2EOD A;  1DVP A;  4ZQL A;  4TKP B;  5LKZ A;  4V3L C;  3U5O A;  3QZV A;  2LXH C;  2KWN A;  2K4D A;  4L58 A;  1LDJ B;  3ZYQ A;  2YQL A;  4R8P K;  2FSA A;  2KRE A;  1WGM A;  2VJF A;  2VP7 A;  5D1K B;  2NAA A;  2K16 A;  2BAY A;  5LKT A;  1WEP A;  1HYJ A;  4FIP A;  3GV4 A;  4LJN A;  4V3K C;  1JM7 A;  3KV5 A;  5KH3 A;  3O35 A;  3ZPV 1;  2Y1N A;  4CA1 A;  1VYX A;  2YUR A;  2VJE A;  1FP0 A;  3DQV R;  2L5U A;  3N9Q A;  3LQI A;  2YRE A;  2G45 A;  3LQJ A;  2L80 A;  3LRQ A;  2DX8 A;  1T1H A;  5AIU A;  2YT5 A;  5H1V A;  2VJF B;  2LXP C;  2KWO A;  3PUQ A;  2MA6 A;  4LAD B;  4YBM A;  4A4C A;  1JM7 B;  4AUQ B;  5LCW B;  2VPE A;  2M1R A;  2LGL A;  5B8D A;  2VJE B;  1MM3 A;  2YU4 A;  2MD8 C;  4N4F A;  3KQI A;  3EB6 A;  2CKL A;  3V43 A;  4QF2 A;  5EYA F;  2MA5 A;  1BOR A;  3L1X A;  4QF3 A;  4YAD A;  2C2V S;  2F6J A;  2KGG A;  2IDA A;  2RI7 A;  4I7B A;  3RTR B;  4PTB A;  2FUI A;  2L0B A;  3M62 A;  2KFT A;  4GNE A;  2YSM A;  5G05 B;  2M85 A;  4S3O B;  1X4J A;  2KWK A;  4GNF A;  3C6W A;  4WZ2 A;  1K2F A;  1N87 A;  2YHN A;  3MHH A;  2G6Q A;  4Q6F A;  1G25 A;  1V87 A;  1Z60 A;  2YQM A;  5FER A;  3SOU A;  2E6R A;  2YUC A;  1MM2 A;  3HCT A;  5B75 A;  2LDR A;  2VPB A;  5DIN A;  4C9Z A;  2ECN A;  2M6M A;  5TAB A;  2Y1M A;  4CCG X;  3O36 A;  4NN2 A;  1X4U A;  2LGK A;  2ECJ A;  2MD7 B;  4MVT A;  1IYM A;  2VPG A;  5B77 A;  2VNF A;  3ZVY A;  4BHW A;  2MNY A;  5TRB A;  1LDK C;  3M63 A;  4I7D A;  4YAX A;  2C2L A;  1HYI A;  2H0D B;  4B7Y C;  2KYU A;  2LV9 A;  2AN6 A;  3NG2 A;  3O34 A;  3U5P A;  4XI1 A;  3SOW A;  4O64 A;  2Y43 A;  2JMD A;  3ZPV E;  3FL2 A;  2ECG A;  2L43 A;  5JG6 A;  2KU3 A;  2HYE D;  3N9L A;  3ZNI A;  3T6R A;  3EB5 A;  2F6N A;  4R2Y A;  4AP4 A;  3MHS A;  2KWJ A;  3C5K A;  5KH9 A;  4LK9 A;  2YYR A;  1WIM A;  4PPE A;  1X4I A;  4B86 C;  5TBN A;  5TDW A;  3U5N A;  2MNZ A;  2MUM A;  1E4U A;  1FBV A;  2YSJ A;  4L7X A;  3PUR A;  4YAB A;  1Z2Q A;  3I2D A;  4LLB A;  3LQH A;  5DKA A;  3ASL A;  4GB0 A;  3O7A A;  3M99 A;  4FO9 A;  2HDP A;  3HTK C;  4ZUX U;  4GND A;  3PHD A;  5H9M A;  2K17 A;  4YC9 A;  2LGV A;  4A4B A;  1Z6U A;  2KE1 A;  2I50 A;  4F52 B;  1WIL A;  3O37 A;  2H0D A;  2CT2 A;  5H1U A;  5G04 B;  5G0F A;  1WEV A;  2M3H A;  5TDR A;  5LKU A;  2XB1 A;  4AYC B;  3SOX A;  4UI9 B;  2ZET C;  2XEU A;  2VPD A;  3HCS A;  1RMD A;  3N9M A;  4WA6 A;  2RSD A;  4WZ3 B;  5H1T A;  5LKX A;  2L75 A;  4YBT A;  2QIC A;  1VFY A;  2YHO A;  3SHB A;  2YW8 A;  2JMI A;  2MT5 A;  1WES A;  5KH7 A;  2KR4 A;  1VD4 A;  2KGI A;  2PNX A;  2D8S A;  4BBQ A;  4A49 A;  3HCU A;  4UP5 A;  5B78 A;  4A0C D;  5B76 A;  4I7C A;  4MSX A;  4X3G A;  2UZG A;  4AVX A;  1WEM A;  4YBS A;  5FB0 A;  5B79 A;  2KIZ A;  4GNG A;  3KV6 A;  4R7E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...