4QF3A

Crystal structure of human baz2b phd zinc finger in the free form
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
57
structure length
57
Chain Sequence
MSIMKVYCQICRKGDNEELLLLCDGCDKGCHTYCHRPKITTIPDGDWFCPACIAKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular basis of histone tail recognition by human TIP5 PHD finger and bromodomain of the chromatin remodeling complex NoRC.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Bromodomain adjacent to zinc finger domain protein 2B
total genus 9
structure length 57
sequence length 57
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4qf3A00
4YAXA 2XB1A 2D8SA 3M63A 3EB5A 3QZVA 2FSAA 2F42A 2MNZA 5FB0A 5B77A 2JRJA 4FIPA 4AP4A 5TRBA 5H1VA 1Z6UA 1WEPA 4CA1A 3VK6A 1U6GB 4PTBA 3RTRB 4WZ3B 2PNXA 1JM7B 4YADA 4N3WA 4V3LC 3HCTA 4AYCB 5TDRA 2MA5A 2XEUA 5FERA 2ECGA 3N9MA 1WIMA 5D1KB 2ECWA 5B75A 4NN2A 3ZNIA 2MA6A 2VP7A 3HCSA 4FJCA 2KE1A 4A0CD 2YT5A 2LQ6A 4I7BA 3O35A 1LDJB 4AYCA 5H9MA 2KWJA 2L5UA 2VJEB 5LCWB 3SOXA 4FO9A 4GNDA 4WZ2A 5B8DA 2I50A 2VPEA 2RI7A 2YW8A 2H0DA 3M62A 2CT2A 3N9PA 3O36A 2YU4A 3EB6A 4TKPB 3L11A 2M6MA 3KV6A 5LKZA 2UZGA 1E4UA 3M99A 4WA6A 1VD4A 2K1JA 2HYED 4A4CA 3T7LA 1XWHA 4PPEA 3C5KA 1HYJA 2RSDA 3DPLR 4N4FA 3RPGB 5AITA 1DVPA 3KQIA 2M1RA 3U5OA 2JMIA 5D1LB 1WGMA 3C6WA 2MD7B 3LRQA 1F62A 4WZ0A 2QJ0A 4R8PK 4W4UA 3HTKC 5JG6A 1BORA 2VJEA 4A4BA 5D1MB 4BHWA 2KREA 2KFTA 2VNFA 4A49A 1WFKA 5J3XA 3PUQA 2KR4A 4YATA 3N9OA 2EA6A 2MNYA 4YBSA 2YHOA 4YC9A 4O64A 4QF3A 1WEUA 5G05B 3N9QA 5LKXA 2VPDA 2MUMA 2FUUA 2K16A 4B7YC 2G6QA 4FK5A 3ZPVE 4S3OB 2LV9A 5FEYA 1VYXA 3ZVZB 2C2VS 3KV5A 3ASLA 2F6NA 2YHNA 2YQMA 4BBQA 1FP0A 4B86C 5H1UA 4LKAA 4LJNA 3V43A 1JM7A 3NG2A 1FBVA 2KIZA 3ZVYA 1HYIA 2Y1MA 4F52B 2VJFA 1V87A 2ECVA 2K4DA 2MIQA 5G0FA 1WEOA 3T6RA 4YABA 3MHHA 2EGPA 5I3LA 2CSZA 4R2YA 4R7EA 2JMDA 1VFYA 1IYMA 4LLBA 3RPGC 4IC3A 1CHCA 1WESA 2IDAA 2LGVA 3GV4A 2E6RA 2VJFB 4YBTA 1K2FA 3LQHA 2LGKA 2YYRA 5B78A 3O7AA 2LGGA 2ECNA 2Y1NA 1N87A 1Z60A 2L80A 2QICA 2ECIA 4I7CA 2C2LA 2FUIA 2QIZA 5DINA 2M3HA 2BAYA 2G43A 2YREA 4MVTA 4L7XA 2L43A 3N9LA 2EODA 4UP0A 5KH3A 1LDKC 2MT5A 5LKTA 3O34A 1X4UA 2K17A 4X3GA 3U5NA 5C13A 4I7DA 2OXQC 2G45A 2DX8A 2KGGA 4GNGA 5G04B 4YBMA 4Q6FA 4L58A 4GB0A 1WENA 3PURA 1RMDA 1X4IA 2Y43A 5B76A 1WEQA 5TDWA 3SOUA 5AIUA 2LN0A 3ZTGA 3L1XA 2LXHC 3I2DA 2ZETC 2YUCA 3PHDA 3ZYQA 4LADB 2LDRA 1MM2A 4UI9B 5LKUA 3O33A 5TABA 4CCGX 3SOWA 3IHPA 4GNEA 5DKAA 2KWNA 2LGLA 5KH9A 3O70A 3U5MA 2MD8C 1JOCA 4ZQLA 1WEEA 5B79A 4LK9A 4P5OB 2KGIA 3LQJA 3GL6A 4QF2A 1WEWA 2HDPA 2VPGA 2KWKA 3MHSA 2CKLA 4GNFA 1G25A 3L1ZB 2AN6A 4XI1A 4AUQB 3DQVR 2YURA 2LRIC 1ZBDB 5TBNA 3HCUA 1T1HA 2YSJA 2L75A 3LQIA 4S3OC 5KH7A 3O37A 2ECJA 5H1TA 2L0BA 2YSMA 3KNVA 2LXPC 2VPBA 2KWOA 4ZUXU 2NAAA 2H0DB 2F6JA 1WILA 3U5PA 5C11A 4V3KC 3FL2A 1WEVA 2KU3A 5FB1A 1Z2QA 4UP5A 1WEMA 3ZPV1 4AVXA 2KYUA 2CKLB 1WE9A 2CSYA 4MSXA 4ZDTA 4C9ZA 5EYAF 1X4JA 2E6SA 3N9NA 4IC2A 2JMJA 2PUYA 2YQLA 2ECTA 2M85A 1MM3A 3SHBA
chains in the Genus database with same CATH superfamily
2M13A 4YAXA 3LVQE 2XB1A 2D8SA 3M63A 3EB5A 3QZVA 2FSAA 2F42A 2E61A 2MNZA 5FB0A 5B77A 2JRJA 5K3QA 4FIPA 4AP4A 4O62A 5TRBA 5H1VA 1Z6UA 1WEPA 4CA1A 3VK6A 2JM3A 1U6GB 4PTBA 3RTRB 4WZ3B 2CONA 2PNXA 2EXUA 1JM7B 4YADA 4N3WA 4V3LC 3HCTA 4AYCB 5TDRA 2MA5A 2XEUA 5FERA 2ECGA 3N9MA 1WIMA 5D1KB 3O47A 2ECWA 5B75A 4NN2A 3ZNIA 2XP0A 2MA6A 2VP7A 3HCSA 4FJCA 2KE1A 4A0CD 2YT5A 2LQ6A 4I7BA 3O35A 1LDJB 2IQJA 3Q1DA 5H9MA 4AYCA 2KWJA 2L5UA 2VJEB 5LCWB 3SOXA 4FO9A 4GNDA 4WZ2A 5B8DA 2I50A 2VPEA 3DWDA 2RI7A 2YW8A 2H0DA 3M62A 2CT2A 3N9PA 3O36A 3FEHA 4H9DA 3T9KA 2YU4A 3M7KA 3EB6A 4QQ4A 4TKPB 3L11A 2M6MA 3KV6A 5LKZA 2UZGA 3LDYA 1E4UA 3M99A 4WA6A 1VD4A 2K1JA 2CRWA 1MBMA 2HYED 4A4CA 3FANA 3T7LA 1XWHA 4PPEA 3C5KA 1HYJA 2RSDA 3DPLR 4N4FA 3RPGB 5AITA 1DVPA 2EGMA 3KQIA 2FD4A 2M1RA 2YVRA 3U5OA 2JMIA 5D1LB 1WGMA 3C6WA 2MD7B 3LRQA 1F62A 4WZ0A 2QJ0A 4R8PK 4W4UA 3HTKC 5JG6A 2CSVA 1BORA 2VJEA 5D1MB 4A4BA 2KREA 4BHWA 2KFTA 2VNFA 4A49A 1WFKA 5J3XA 3PUQA 2P57A 2KR4A 4YATA 3N9OA 2EA6A 2MNYA 5SVIA 3PLWA 4YBSA 2YHOA 2DSMA 4YC9A 4O64A 4QF3A 1WEUA 5G05B 3N9QA 5LKXA 2VPDA 2MUMA 2FUUA 4OGCA 2K16A 2G6QA 4B7YC 4FK5A 3ZPVE 4S3OB 2LV9A 5FEYA 1VYXA 3ZVZB 2C2VS 3KV5A 3ASLA 2F6NA 2YHNA 2OWAA 2YQMA 2JUNA 4BBQA 1FP0A 4B86C 5H1UA 4LKAA 4LJNA 3V43A 1JM7A 3NG2A 1FBVA 2KIZA 3ZVYA 1HYIA 2Y1MA 3LVRE 4F52B 2VJFA 1V87A 2ECVA 2K4DA 2MIQA 5G0FA 1WEOA 3T6RA 4YABA 3MHHA 2EGPA 2XOYA 5I3LA 2CSZA 4R2YA 4R7EA 2JMDA 1VFYA 3JUEA 1IYMA 4LLBA 3RPGC 4IC3A 1CHCA 1WESA 2IDAA 2LGVA 3GV4A 3E2DA 2DJAA 3MDBC 2E6RA 2VJFB 4YBTA 1K2FA 3LQHA 2LGKA 2YYRA 5B78A 3O7AA 5SVYA 2L7PA 2LGGA 2ECNA 2Y1NA 1N87A 1Z60A 2L80A 2QICA 2ECIA 4I7CA 2C2LA 2FUIA 2QIZA 2KKYA 5DINA 2M3HA 2BAYA 2G43A 2YREA 4MVTA 4Z0RA 4L7XA 2L43A 3N9LA 2EODA 4UP0A 5KH3A 1LDKC 2MT5A 5LKTA 3O34A 1X4UA 2K17A 4X3GA 3U5NA 5SVIB 5C13A 4I7DA 2OXQC 2G45A 2DX8A 2KGGA 4GNGA 5G04B 4YBMA 4Q6FA 3DDTA 4L58A 4GB0A 2B0OE 1WENA 3PURA 1DCQA 1RMDA 1X4IA 2Y43A 5B76A 1WEQA 5TDWA 3SOUA 5AIUA 2LN0A 3ZTGA 3L1XA 3FM8C 2LXHC 3I2DA 2ZETC 2YUCA 3PHDA 3ZYQA 4F1PA 4LADB 2LDRA 1MM2A 4UI9B 5LKUA 3O33A 5TABA 4CCGX 3SOWA 2LAUA 3IHPA 4GNEA 5DKAA 2KWNA 2FFWA 2LGLA 5KH9A 3O70A 3U5MA 2MD8C 1JOCA 3FJUB 4ZQLA 1WEEA 5B79A 4LK9A 4P5OB 2KGIA 2KKXA 3LQJA 3GL6A 4QF2A 1WEWA 2HDPA 2VPGA 2KWKA 3MHSA 2CKLA 2MKEA 4GNFA 3L1ZB 2AN6A 1G25A 4XI1A 4AUQB 3DQVR 3LJUX 2YURA 2LRIC 1ZBDB 5TBNA 3HCUA 1T1HA 2YSJA 2L75A 3FAOA 3LQIA 4S3OC 5KH7A 2XOZA 4Z0OA 3O37A 2CRRA 2ECJA 5H1TA 2L0BA 2YSMA 3KNVA 2LXPC 2RR4A 3H7HA 2VPBA 2KWOA 3SUBA 2XOCA 4ZUXU 2NAAA 2H0DB 2F6JA 1WILA 3U5PA 5C11A 4V3KC 3FL2A 5SVXA 1WEVA 3KDEC 2KU3A 2D8UA 5FB1A 1Z2QA 4UP5A 1WEMA 3ZPV1 4AVXA 2KYUA 2CKLB 1WE9A 2CSYA 4MSXA 4ZDTA 4C9ZA 5EYAF 1X4JA 2E6SA 3N9NA 4IC2A 2JMJA 2PUYA 4OGEA 2YQLA 2ECTA 2M85A 1MM3A 3SHBA
chains in the Genus database with same CATH topology
4YAXA 2XB1A 2D8SA 3M63A 3EB5A 3QZVA 2FSAA 2F42A 2MNZA 5FB0A 5B77A 2JRJA 4FIPA 4AP4A 5TRBA 5H1VA 1Z6UA 1WEPA 4CA1A 3VK6A 1U6GB 4PTBA 3RTRB 4WZ3B 2PNXA 1JM7B 4YADA 4N3WA 4V3LC 3HCTA 4AYCB 5TDRA 2MA5A 2XEUA 5FERA 2ECGA 3N9MA 1WIMA 5D1KB 2ECWA 5B75A 4NN2A 3ZNIA 2MA6A 2VP7A 3HCSA 4FJCA 2KE1A 4A0CD 2YT5A 2LQ6A 4I7BA 3O35A 1LDJB 4AYCA 5H9MA 2KWJA 2L5UA 2VJEB 5LCWB 3SOXA 4FO9A 4GNDA 4WZ2A 5B8DA 2I50A 2VPEA 2RI7A 2YW8A 2H0DA 3M62A 2CT2A 3N9PA 3O36A 2YU4A 3EB6A 4TKPB 3L11A 2M6MA 3KV6A 5LKZA 2UZGA 1E4UA 3M99A 4WA6A 1VD4A 2K1JA 2HYED 4A4CA 3T7LA 1XWHA 4PPEA 3C5KA 1HYJA 2RSDA 3DPLR 4N4FA 3RPGB 5AITA 1DVPA 3KQIA 2M1RA 3U5OA 2JMIA 5D1LB 1WGMA 3C6WA 2MD7B 3LRQA 1F62A 4WZ0A 2QJ0A 4R8PK 4W4UA 3HTKC 5JG6A 1BORA 2VJEA 4A4BA 5D1MB 4BHWA 2KREA 2KFTA 2VNFA 4A49A 1WFKA 5J3XA 3PUQA 2KR4A 4YATA 3N9OA 2EA6A 2MNYA 4YBSA 2YHOA 4YC9A 4O64A 4QF3A 1WEUA 5G05B 3N9QA 5LKXA 2VPDA 2MUMA 2FUUA 2K16A 4B7YC 2G6QA 4FK5A 3ZPVE 4S3OB 2LV9A 5FEYA 1VYXA 3ZVZB 2C2VS 3KV5A 3ASLA 2F6NA 2YHNA 2YQMA 4BBQA 1FP0A 4B86C 5H1UA 4LKAA 4LJNA 3V43A 1JM7A 3NG2A 1FBVA 2KIZA 3ZVYA 1HYIA 2Y1MA 4F52B 2VJFA 1V87A 2ECVA 2K4DA 2MIQA 5G0FA 1WEOA 3T6RA 4YABA 3MHHA 2EGPA 5I3LA 2CSZA 4R2YA 4R7EA 2JMDA 1VFYA 1IYMA 4LLBA 3RPGC 4IC3A 1CHCA 1WESA 2IDAA 2LGVA 3GV4A 2E6RA 2VJFB 4YBTA 1K2FA 3LQHA 2LGKA 2YYRA 5B78A 3O7AA 2LGGA 2ECNA 2Y1NA 1N87A 1Z60A 2L80A 2QICA 2ECIA 4I7CA 2C2LA 2FUIA 2QIZA 5DINA 2M3HA 2BAYA 2G43A 2YREA 4MVTA 4L7XA 2L43A 3N9LA 2EODA 4UP0A 5KH3A 1LDKC 2MT5A 5LKTA 3O34A 1X4UA 2K17A 4X3GA 3U5NA 5C13A 4I7DA 2OXQC 2G45A 2DX8A 2KGGA 4GNGA 5G04B 4YBMA 4Q6FA 4L58A 4GB0A 1WENA 3PURA 1RMDA 1X4IA 2Y43A 5B76A 1WEQA 5TDWA 3SOUA 5AIUA 2LN0A 3ZTGA 3L1XA 2LXHC 3I2DA 2ZETC 2YUCA 3PHDA 3ZYQA 4LADB 2LDRA 1MM2A 4UI9B 5LKUA 3O33A 5TABA 4CCGX 3SOWA 3IHPA 4GNEA 5DKAA 2KWNA 2LGLA 5KH9A 3O70A 3U5MA 2MD8C 1JOCA 4ZQLA 1WEEA 5B79A 4LK9A 4P5OB 2KGIA 3LQJA 3GL6A 4QF2A 1WEWA 2HDPA 2VPGA 2KWKA 3MHSA 2CKLA 4GNFA 1G25A 3L1ZB 2AN6A 4XI1A 4AUQB 3DQVR 2YURA 2LRIC 1ZBDB 5TBNA 3HCUA 1T1HA 2YSJA 2L75A 3LQIA 4S3OC 5KH7A 3O37A 2ECJA 5H1TA 2L0BA 2YSMA 3KNVA 2LXPC 2VPBA 2KWOA 4ZUXU 2NAAA 2H0DB 2F6JA 1WILA 3U5PA 5C11A 4V3KC 3FL2A 1WEVA 2KU3A 5FB1A 1Z2QA 4UP5A 1WEMA 3ZPV1 4AVXA 2KYUA 2CKLB 1WE9A 2CSYA 4MSXA 4ZDTA 4C9ZA 5EYAF 1X4JA 2E6SA 3N9NA 4IC2A 2JMJA 2PUYA 2YQLA 2ECTA 2M85A 1MM3A 3SHBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YAX A;  2XB1 A;  2D8S A;  3M63 A;  3EB5 A;  3QZV A;  2FSA A;  2F42 A;  2MNZ A;  5FB0 A;  5B77 A;  2JRJ A;  4FIP A;  4AP4 A;  5TRB A;  5H1V A;  1Z6U A;  1WEP A;  4CA1 A;  3VK6 A;  1U6G B;  4PTB A;  3RTR B;  4WZ3 B;  2PNX A;  1JM7 B;  4YAD A;  4N3W A;  4V3L C;  3HCT A;  4AYC B;  5TDR A;  2MA5 A;  2XEU A;  5FER A;  2ECG A;  3N9M A;  1WIM A;  5D1K B;  2ECW A;  5B75 A;  4NN2 A;  3ZNI A;  2MA6 A;  2VP7 A;  3HCS A;  4FJC A;  2KE1 A;  4A0C D;  2YT5 A;  2LQ6 A;  4I7B A;  3O35 A;  1LDJ B;  4AYC A;  5H9M A;  2KWJ A;  2L5U A;  2VJE B;  5LCW B;  3SOX A;  4FO9 A;  4GND A;  4WZ2 A;  5B8D A;  2I50 A;  2VPE A;  2RI7 A;  2YW8 A;  2H0D A;  3M62 A;  2CT2 A;  3N9P A;  3O36 A;  2YU4 A;  3EB6 A;  4TKP B;  3L11 A;  2M6M A;  3KV6 A;  5LKZ A;  2UZG A;  1E4U A;  3M99 A;  4WA6 A;  1VD4 A;  2K1J A;  2HYE D;  4A4C A;  3T7L A;  1XWH A;  4PPE A;  3C5K A;  1HYJ A;  2RSD A;  3DPL R;  4N4F A;  3RPG B;  5AIT A;  1DVP A;  3KQI A;  2M1R A;  3U5O A;  2JMI A;  5D1L B;  1WGM A;  3C6W A;  2MD7 B;  3LRQ A;  1F62 A;  4WZ0 A;  2QJ0 A;  4R8P K;  4W4U A;  3HTK C;  5JG6 A;  1BOR A;  2VJE A;  4A4B A;  5D1M B;  4BHW A;  2KRE A;  2KFT A;  2VNF A;  4A49 A;  1WFK A;  5J3X A;  3PUQ A;  2KR4 A;  4YAT A;  3N9O A;  2EA6 A;  2MNY A;  4YBS A;  2YHO A;  4YC9 A;  4O64 A;  4QF3 A;  1WEU A;  5G05 B;  3N9Q A;  5LKX A;  2VPD A;  2MUM A;  2FUU A;  2K16 A;  4B7Y C;  2G6Q A;  4FK5 A;  3ZPV E;  4S3O B;  2LV9 A;  5FEY A;  1VYX A;  3ZVZ B;  2C2V S;  3KV5 A;  3ASL A;  2F6N A;  2YHN A;  2YQM A;  4BBQ A;  1FP0 A;  4B86 C;  5H1U A;  4LKA A;  4LJN A;  3V43 A;  1JM7 A;  3NG2 A;  1FBV A;  2KIZ A;  3ZVY A;  1HYI A;  2Y1M A;  4F52 B;  2VJF A;  1V87 A;  2ECV A;  2K4D A;  2MIQ A;  5G0F A;  1WEO A;  3T6R A;  4YAB A;  3MHH A;  2EGP A;  5I3L A;  2CSZ A;  4R2Y A;  4R7E A;  2JMD A;  1VFY A;  1IYM A;  4LLB A;  3RPG C;  4IC3 A;  1CHC A;  1WES A;  2IDA A;  2LGV A;  3GV4 A;  2E6R A;  2VJF B;  4YBT A;  1K2F A;  3LQH A;  2LGK A;  2YYR A;  5B78 A;  3O7A A;  2LGG A;  2ECN A;  2Y1N A;  1N87 A;  1Z60 A;  2L80 A;  2QIC A;  2ECI A;  4I7C A;  2C2L A;  2FUI A;  2QIZ A;  5DIN A;  2M3H A;  2BAY A;  2G43 A;  2YRE A;  4MVT A;  4L7X A;  2L43 A;  3N9L A;  2EOD A;  4UP0 A;  5KH3 A;  1LDK C;  2MT5 A;  5LKT A;  3O34 A;  1X4U A;  2K17 A;  4X3G A;  3U5N A;  5C13 A;  4I7D A;  2OXQ C;  2G45 A;  2DX8 A;  2KGG A;  4GNG A;  5G04 B;  4YBM A;  4Q6F A;  4L58 A;  4GB0 A;  1WEN A;  3PUR A;  1RMD A;  1X4I A;  2Y43 A;  5B76 A;  1WEQ A;  5TDW A;  3SOU A;  5AIU A;  2LN0 A;  3ZTG A;  3L1X A;  2LXH C;  3I2D A;  2ZET C;  2YUC A;  3PHD A;  3ZYQ A;  4LAD B;  2LDR A;  1MM2 A;  4UI9 B;  5LKU A;  3O33 A;  5TAB A;  4CCG X;  3SOW A;  3IHP A;  4GNE A;  5DKA A;  2KWN A;  2LGL A;  5KH9 A;  3O70 A;  3U5M A;  2MD8 C;  1JOC A;  4ZQL A;  1WEE A;  5B79 A;  4LK9 A;  4P5O B;  2KGI A;  3LQJ A;  3GL6 A;  4QF2 A;  1WEW A;  2HDP A;  2VPG A;  2KWK A;  3MHS A;  2CKL A;  4GNF A;  1G25 A;  3L1Z B;  2AN6 A;  4XI1 A;  4AUQ B;  3DQV R;  2YUR A;  2LRI C;  1ZBD B;  5TBN A;  3HCU A;  1T1H A;  2YSJ A;  2L75 A;  3LQI A;  4S3O C;  5KH7 A;  3O37 A;  2ECJ A;  5H1T A;  2L0B A;  2YSM A;  3KNV A;  2LXP C;  2VPB A;  2KWO A;  4ZUX U;  2NAA A;  2H0D B;  2F6J A;  1WIL A;  3U5P A;  5C11 A;  4V3K C;  3FL2 A;  1WEV A;  2KU3 A;  5FB1 A;  1Z2Q A;  4UP5 A;  1WEM A;  3ZPV 1;  4AVX A;  2KYU A;  2CKL B;  1WE9 A;  2CSY A;  4MSX A;  4ZDT A;  4C9Z A;  5EYA F;  1X4J A;  2E6S A;  3N9N A;  4IC2 A;  2JMJ A;  2PUY A;  2YQL A;  2ECT A;  2M85 A;  1MM3 A;  3SHB A; 
#chains in the Genus database with same CATH topology
 2M13 A;  4YAX A;  3LVQ E;  2XB1 A;  2D8S A;  3M63 A;  3EB5 A;  3QZV A;  2FSA A;  2F42 A;  2E61 A;  2MNZ A;  5FB0 A;  5B77 A;  2JRJ A;  5K3Q A;  4FIP A;  4AP4 A;  4O62 A;  5TRB A;  5H1V A;  1Z6U A;  1WEP A;  4CA1 A;  3VK6 A;  2JM3 A;  1U6G B;  4PTB A;  3RTR B;  4WZ3 B;  2CON A;  2PNX A;  2EXU A;  1JM7 B;  4YAD A;  4N3W A;  4V3L C;  3HCT A;  4AYC B;  5TDR A;  2MA5 A;  2XEU A;  5FER A;  2ECG A;  3N9M A;  1WIM A;  5D1K B;  3O47 A;  2ECW A;  5B75 A;  4NN2 A;  3ZNI A;  2XP0 A;  2MA6 A;  2VP7 A;  3HCS A;  4FJC A;  2KE1 A;  4A0C D;  2YT5 A;  2LQ6 A;  4I7B A;  3O35 A;  1LDJ B;  2IQJ A;  3Q1D A;  5H9M A;  4AYC A;  2KWJ A;  2L5U A;  2VJE B;  5LCW B;  3SOX A;  4FO9 A;  4GND A;  4WZ2 A;  5B8D A;  2I50 A;  2VPE A;  3DWD A;  2RI7 A;  2YW8 A;  2H0D A;  3M62 A;  2CT2 A;  3N9P A;  3O36 A;  3FEH A;  4H9D A;  3T9K A;  2YU4 A;  3M7K A;  3EB6 A;  4QQ4 A;  4TKP B;  3L11 A;  2M6M A;  3KV6 A;  5LKZ A;  2UZG A;  3LDY A;  1E4U A;  3M99 A;  4WA6 A;  1VD4 A;  2K1J A;  2CRW A;  1MBM A;  2HYE D;  4A4C A;  3FAN A;  3T7L A;  1XWH A;  4PPE A;  3C5K A;  1HYJ A;  2RSD A;  3DPL R;  4N4F A;  3RPG B;  5AIT A;  1DVP A;  2EGM A;  3KQI A;  2FD4 A;  2M1R A;  2YVR A;  3U5O A;  2JMI A;  5D1L B;  1WGM A;  3C6W A;  2MD7 B;  3LRQ A;  1F62 A;  4WZ0 A;  2QJ0 A;  4R8P K;  4W4U A;  3HTK C;  5JG6 A;  2CSV A;  1BOR A;  2VJE A;  5D1M B;  4A4B A;  2KRE A;  4BHW A;  2KFT A;  2VNF A;  4A49 A;  1WFK A;  5J3X A;  3PUQ A;  2P57 A;  2KR4 A;  4YAT A;  3N9O A;  2EA6 A;  2MNY A;  5SVI A;  3PLW A;  4YBS A;  2YHO A;  2DSM A;  4YC9 A;  4O64 A;  4QF3 A;  1WEU A;  5G05 B;  3N9Q A;  5LKX A;  2VPD A;  2MUM A;  2FUU A;  4OGC A;  2K16 A;  2G6Q A;  4B7Y C;  4FK5 A;  3ZPV E;  4S3O B;  2LV9 A;  5FEY A;  1VYX A;  3ZVZ B;  2C2V S;  3KV5 A;  3ASL A;  2F6N A;  2YHN A;  2OWA A;  2YQM A;  2JUN A;  4BBQ A;  1FP0 A;  4B86 C;  5H1U A;  4LKA A;  4LJN A;  3V43 A;  1JM7 A;  3NG2 A;  1FBV A;  2KIZ A;  3ZVY A;  1HYI A;  2Y1M A;  3LVR E;  4F52 B;  2VJF A;  1V87 A;  2ECV A;  2K4D A;  2MIQ A;  5G0F A;  1WEO A;  3T6R A;  4YAB A;  3MHH A;  2EGP A;  2XOY A;  5I3L A;  2CSZ A;  4R2Y A;  4R7E A;  2JMD A;  1VFY A;  3JUE A;  1IYM A;  4LLB A;  3RPG C;  4IC3 A;  1CHC A;  1WES A;  2IDA A;  2LGV A;  3GV4 A;  3E2D A;  2DJA A;  3MDB C;  2E6R A;  2VJF B;  4YBT A;  1K2F A;  3LQH A;  2LGK A;  2YYR A;  5B78 A;  3O7A A;  5SVY A;  2L7P A;  2LGG A;  2ECN A;  2Y1N A;  1N87 A;  1Z60 A;  2L80 A;  2QIC A;  2ECI A;  4I7C A;  2C2L A;  2FUI A;  2QIZ A;  2KKY A;  5DIN A;  2M3H A;  2BAY A;  2G43 A;  2YRE A;  4MVT A;  4Z0R A;  4L7X A;  2L43 A;  3N9L A;  2EOD A;  4UP0 A;  5KH3 A;  1LDK C;  2MT5 A;  5LKT A;  3O34 A;  1X4U A;  2K17 A;  4X3G A;  3U5N A;  5SVI B;  5C13 A;  4I7D A;  2OXQ C;  2G45 A;  2DX8 A;  2KGG A;  4GNG A;  5G04 B;  4YBM A;  4Q6F A;  3DDT A;  4L58 A;  4GB0 A;  2B0O E;  1WEN A;  3PUR A;  1DCQ A;  1RMD A;  1X4I A;  2Y43 A;  5B76 A;  1WEQ A;  5TDW A;  3SOU A;  5AIU A;  2LN0 A;  3ZTG A;  3L1X A;  3FM8 C;  2LXH C;  3I2D A;  2ZET C;  2YUC A;  3PHD A;  3ZYQ A;  4F1P A;  4LAD B;  2LDR A;  1MM2 A;  4UI9 B;  5LKU A;  3O33 A;  5TAB A;  4CCG X;  3SOW A;  2LAU A;  3IHP A;  4GNE A;  5DKA A;  2KWN A;  2FFW A;  2LGL A;  5KH9 A;  3O70 A;  3U5M A;  2MD8 C;  1JOC A;  3FJU B;  4ZQL A;  1WEE A;  5B79 A;  4LK9 A;  4P5O B;  2KGI A;  2KKX A;  3LQJ A;  3GL6 A;  4QF2 A;  1WEW A;  2HDP A;  2VPG A;  2KWK A;  3MHS A;  2CKL A;  2MKE A;  4GNF A;  3L1Z B;  2AN6 A;  1G25 A;  4XI1 A;  4AUQ B;  3DQV R;  3LJU X;  2YUR A;  2LRI C;  1ZBD B;  5TBN A;  3HCU A;  1T1H A;  2YSJ A;  2L75 A;  3FAO A;  3LQI A;  4S3O C;  5KH7 A;  2XOZ A;  4Z0O A;  3O37 A;  2CRR A;  2ECJ A;  5H1T A;  2L0B A;  2YSM A;  3KNV A;  2LXP C;  2RR4 A;  3H7H A;  2VPB A;  2KWO A;  3SUB A;  2XOC A;  4ZUX U;  2NAA A;  2H0D B;  2F6J A;  1WIL A;  3U5P A;  5C11 A;  4V3K C;  3FL2 A;  5SVX A;  1WEV A;  3KDE C;  2KU3 A;  2D8U A;  5FB1 A;  1Z2Q A;  4UP5 A;  1WEM A;  3ZPV 1;  4AVX A;  2KYU A;  2CKL B;  1WE9 A;  2CSY A;  4MSX A;  4ZDT A;  4C9Z A;  5EYA F;  1X4J A;  2E6S A;  3N9N A;  4IC2 A;  2JMJ A;  2PUY A;  4OGE A;  2YQL A;  2ECT A;  2M85 A;  1MM3 A;  3SHB A; 
#chains in the Genus database with same CATH homology
 4YAX A;  2XB1 A;  2D8S A;  3M63 A;  3EB5 A;  3QZV A;  2FSA A;  2F42 A;  2MNZ A;  5FB0 A;  5B77 A;  2JRJ A;  4FIP A;  4AP4 A;  5TRB A;  5H1V A;  1Z6U A;  1WEP A;  4CA1 A;  3VK6 A;  1U6G B;  4PTB A;  3RTR B;  4WZ3 B;  2PNX A;  1JM7 B;  4YAD A;  4N3W A;  4V3L C;  3HCT A;  4AYC B;  5TDR A;  2MA5 A;  2XEU A;  5FER A;  2ECG A;  3N9M A;  1WIM A;  5D1K B;  2ECW A;  5B75 A;  4NN2 A;  3ZNI A;  2MA6 A;  2VP7 A;  3HCS A;  4FJC A;  2KE1 A;  4A0C D;  2YT5 A;  2LQ6 A;  4I7B A;  3O35 A;  1LDJ B;  4AYC A;  5H9M A;  2KWJ A;  2L5U A;  2VJE B;  5LCW B;  3SOX A;  4FO9 A;  4GND A;  4WZ2 A;  5B8D A;  2I50 A;  2VPE A;  2RI7 A;  2YW8 A;  2H0D A;  3M62 A;  2CT2 A;  3N9P A;  3O36 A;  2YU4 A;  3EB6 A;  4TKP B;  3L11 A;  2M6M A;  3KV6 A;  5LKZ A;  2UZG A;  1E4U A;  3M99 A;  4WA6 A;  1VD4 A;  2K1J A;  2HYE D;  4A4C A;  3T7L A;  1XWH A;  4PPE A;  3C5K A;  1HYJ A;  2RSD A;  3DPL R;  4N4F A;  3RPG B;  5AIT A;  1DVP A;  3KQI A;  2M1R A;  3U5O A;  2JMI A;  5D1L B;  1WGM A;  3C6W A;  2MD7 B;  3LRQ A;  1F62 A;  4WZ0 A;  2QJ0 A;  4R8P K;  4W4U A;  3HTK C;  5JG6 A;  1BOR A;  2VJE A;  4A4B A;  5D1M B;  4BHW A;  2KRE A;  2KFT A;  2VNF A;  4A49 A;  1WFK A;  5J3X A;  3PUQ A;  2KR4 A;  4YAT A;  3N9O A;  2EA6 A;  2MNY A;  4YBS A;  2YHO A;  4YC9 A;  4O64 A;  4QF3 A;  1WEU A;  5G05 B;  3N9Q A;  5LKX A;  2VPD A;  2MUM A;  2FUU A;  2K16 A;  4B7Y C;  2G6Q A;  4FK5 A;  3ZPV E;  4S3O B;  2LV9 A;  5FEY A;  1VYX A;  3ZVZ B;  2C2V S;  3KV5 A;  3ASL A;  2F6N A;  2YHN A;  2YQM A;  4BBQ A;  1FP0 A;  4B86 C;  5H1U A;  4LKA A;  4LJN A;  3V43 A;  1JM7 A;  3NG2 A;  1FBV A;  2KIZ A;  3ZVY A;  1HYI A;  2Y1M A;  4F52 B;  2VJF A;  1V87 A;  2ECV A;  2K4D A;  2MIQ A;  5G0F A;  1WEO A;  3T6R A;  4YAB A;  3MHH A;  2EGP A;  5I3L A;  2CSZ A;  4R2Y A;  4R7E A;  2JMD A;  1VFY A;  1IYM A;  4LLB A;  3RPG C;  4IC3 A;  1CHC A;  1WES A;  2IDA A;  2LGV A;  3GV4 A;  2E6R A;  2VJF B;  4YBT A;  1K2F A;  3LQH A;  2LGK A;  2YYR A;  5B78 A;  3O7A A;  2LGG A;  2ECN A;  2Y1N A;  1N87 A;  1Z60 A;  2L80 A;  2QIC A;  2ECI A;  4I7C A;  2C2L A;  2FUI A;  2QIZ A;  5DIN A;  2M3H A;  2BAY A;  2G43 A;  2YRE A;  4MVT A;  4L7X A;  2L43 A;  3N9L A;  2EOD A;  4UP0 A;  5KH3 A;  1LDK C;  2MT5 A;  5LKT A;  3O34 A;  1X4U A;  2K17 A;  4X3G A;  3U5N A;  5C13 A;  4I7D A;  2OXQ C;  2G45 A;  2DX8 A;  2KGG A;  4GNG A;  5G04 B;  4YBM A;  4Q6F A;  4L58 A;  4GB0 A;  1WEN A;  3PUR A;  1RMD A;  1X4I A;  2Y43 A;  5B76 A;  1WEQ A;  5TDW A;  3SOU A;  5AIU A;  2LN0 A;  3ZTG A;  3L1X A;  2LXH C;  3I2D A;  2ZET C;  2YUC A;  3PHD A;  3ZYQ A;  4LAD B;  2LDR A;  1MM2 A;  4UI9 B;  5LKU A;  3O33 A;  5TAB A;  4CCG X;  3SOW A;  3IHP A;  4GNE A;  5DKA A;  2KWN A;  2LGL A;  5KH9 A;  3O70 A;  3U5M A;  2MD8 C;  1JOC A;  4ZQL A;  1WEE A;  5B79 A;  4LK9 A;  4P5O B;  2KGI A;  3LQJ A;  3GL6 A;  4QF2 A;  1WEW A;  2HDP A;  2VPG A;  2KWK A;  3MHS A;  2CKL A;  4GNF A;  1G25 A;  3L1Z B;  2AN6 A;  4XI1 A;  4AUQ B;  3DQV R;  2YUR A;  2LRI C;  1ZBD B;  5TBN A;  3HCU A;  1T1H A;  2YSJ A;  2L75 A;  3LQI A;  4S3O C;  5KH7 A;  3O37 A;  2ECJ A;  5H1T A;  2L0B A;  2YSM A;  3KNV A;  2LXP C;  2VPB A;  2KWO A;  4ZUX U;  2NAA A;  2H0D B;  2F6J A;  1WIL A;  3U5P A;  5C11 A;  4V3K C;  3FL2 A;  1WEV A;  2KU3 A;  5FB1 A;  1Z2Q A;  4UP5 A;  1WEM A;  3ZPV 1;  4AVX A;  2KYU A;  2CKL B;  1WE9 A;  2CSY A;  4MSX A;  4ZDT A;  4C9Z A;  5EYA F;  1X4J A;  2E6S A;  3N9N A;  4IC2 A;  2JMJ A;  2PUY A;  2YQL A;  2ECT A;  2M85 A;  1MM3 A;  3SHB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...