1Z2QA

High-resolution solution structure of the lm5-1 fyve domain from leishmania major
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
84
structure length
84
Chain Sequence
GPLGSMGEKQSKGYWQEDEDAPACNGCGCVFTTTVRRHHCRNCGYVLCGDCSRHRAAIPMRGITEPERVCDACYLALRSSNMAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LM5-1
publication title A high-resolution solution structure of a trypanosomatid FYVE domain.
pubmed doi rcsb
source organism Leishmania major
molecule tags Membrane protein
total genus 7
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2005-03-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1z2qA00
1FBVA 5D1KB 4ZQLA 3N9OA 2CSYA 4ZDTA 2YREA 2LGGA 5J3XA 2K16A 3KQIA 4GNGA 5DINA 4R2YA 3HCUA 2YU4A 5H1TA 4XI1A 1WEMA 3U5MA 2QIZA 3L11A 3I2DA 3GL6A 4LLBA 4V3LC 1VFYA 4YC9A 4N3WA 1G25A 2KFTA 4AVXA 5C13A 1MM3A 2FSAA 4LKAA 2LGLA 4YAXA 4CCGX 3LRQA 5FB0A 1LDKC 1VYXA 3MHHA 2H0DB 2KWNA 4I7BA 3ASLA 4S3OC 4ZUXU 4AYCA 2QICA 4O64A 1WGMA 4BHWA 1WILA 4A4CA 2MIQA 3ZYQA 3HTKC 2HYED 4IC3A 4WZ3B 4W4UA 1WESA 4L7XA 2ECVA 1X4UA 2F6JA 1X4JA 1XWHA 5FB1A 4R8PK 3ZVYA 1LDJB 2ECTA 2LXPC 2ECNA 2VJFA 3L1ZB 5B8DA 1HYJA 1X4IA 3KNVA 1WENA 5G05B 3T7LA 2VPGA 5LCWB 3ZPVE 3SOXA 2G6QA 2F6NA 2FUUA 3VK6A 4AP4A 2LGKA 1MM2A 3RPGB 4B7YC 2YSMA 2MD7B 2VPEA 2ECGA 2E6SA 2H0DA 2ECWA 4IC2A 2M3HA 2Y1MA 1ZBDB 3QZVA 2G45A 2CT2A 2KWKA 2UZGA 1T1HA 4AYCB 4X3GA 2EA6A 1HYIA 1F62A 2CKLA 4YADA 2YSJA 4FK5A 4FJCA 3N9NA 4FIPA 2M85A 5C11A 4A0CD 2L75A 4LADB 4GNDA 4L58A 4N4FA 5H9MA 3O70A 4MSXA 1WEOA 2D8SA 1U6GB 2F42A 5LKTA 2VJFB 3SHBA 4GNFA 2HDPA 2ZETC 3KV6A 5LKZA 5EYAF 4AUQB 3RPGC 4UP5A 3L1XA 2LN0A 4QF2A 4LK9A 5H1VA 2MNYA 2AN6A 3N9LA 5TDWA 2EGPA 2L5UA 2C2LA 5AIUA 5AITA 4FO9A 4F52B 2BAYA 5KH9A 4PTBA 5B77A 4MVTA 4R7EA 3NG2A 4UP0A 3FL2A 3M99A 1N87A 2JMIA 1WEEA 5B79A 5TDRA 5LKUA 1K2FA 1WEWA 1WEVA 2CKLB 2MNZA 3O36A 3N9PA 2LGVA 1Z6UA 3O35A 2JMJA 4LJNA 1JOCA 2EODA 2YHNA 1WFKA 1WEQA 1WE9A 5I3LA 2K4DA 5B76A 2VPBA 3SOUA 3O33A 1Z2QA 2NAAA 2L80A 4P5OB 4YBMA 3U5NA 2LRIC 1VD4A 3C5KA 3M63A 2YYRA 4QF3A 3O37A 2XB1A 3PUQA 4A4BA 4YATA 2M1RA 3ZPV1 4YBSA 2MUMA 2I50A 2K1JA 2KGIA 1V87A 2KREA 3T6RA 3DPLR 1FP0A 1E4UA 5TRBA 3ZTGA 5LKXA 4CA1A 1CHCA 3PURA 5JG6A 2KE1A 5KH7A 2YQMA 3EB5A 4NN2A 2RSDA 1DVPA 3V43A 4PPEA 4A49A 2YQLA 1Z60A 2KWJA 3O34A 4GNEA 4YBTA 3ZNIA 4V3KC 1RMDA 2VP7A 1WEPA 2YW8A 2LXHC 2YT5A 3HCSA 1BORA 3LQHA 4Q6FA 2VJEB 3SOWA 3C6WA 2KIZA 2IDAA 2FUIA 2MD8C 3KV5A 1JM7B 2YUCA 2RI7A 2L43A 2LV9A 4I7CA 5B78A 3GV4A 4I7DA 3IHPA 4WA6A 4YABA 1IYMA 3U5PA 4GB0A 2VNFA 2ECIA 2PNXA 4WZ0A 3LQJA 4B86C 2JMDA 2YHOA 4TKPB 2YURA 3RTRB 2MT5A 2JRJA 2E6RA 2KYUA 3M62A 3O7AA 3LQIA 5KH3A 2Y43A 2MA6A 2OXQC 2K17A 2KR4A 2XEUA 5DKAA 4BBQA 2KWOA 3EB6A 2KU3A 3PHDA 2LDRA 3DQVR 2PUYA 5D1MB 1WEUA 2C2VS 4C9ZA 2Y1NA 2VPDA 2VJEA 1JM7A 3U5OA 2ECJA 5H1UA 5TBNA 2KGGA 2L0BA 2G43A 2M6MA 5G04B 2DX8A 5TABA 3N9MA 5FERA 2QJ0A 5G0FA 2CSZA 3MHSA 5D1LB 3N9QA 4WZ2A 4UI9B 5B75A 1WIMA 3ZVZB 4S3OB 3HCTA 2LQ6A 5FEYA 2MA5A
chains in the Genus database with same CATH superfamily
1FBVA 5D1KB 4ZQLA 2DJAA 3N9OA 2CSYA 2CRRA 4ZDTA 2YREA 2LGGA 5J3XA 2K16A 3KQIA 4GNGA 5DINA 4R2YA 3HCUA 2XP0A 2YU4A 5H1TA 4XI1A 3SUBA 1WEMA 3H7HA 3U5MA 2QIZA 3L11A 3I2DA 3GL6A 4LLBA 4V3LC 1VFYA 3FANA 4YC9A 4N3WA 1G25A 2KFTA 2MKEA 4AVXA 5C13A 1MM3A 2FSAA 4LKAA 2LGLA 4YAXA 4CCGX 2P57A 3LRQA 5FB0A 1LDKC 1VYXA 2IQJA 3LVQE 2L7PA 3MHHA 2H0DB 2KWNA 4I7BA 3ASLA 4S3OC 5K3QA 4ZUXU 3DDTA 4AYCA 2QICA 4O64A 1WGMA 4BHWA 1WILA 2CONA 4A4CA 2MIQA 3ZYQA 3HTKC 2HYED 5SVYA 4IC3A 4WZ3B 4W4UA 1WESA 4L7XA 2ECVA 1X4UA 3PLWA 2F6JA 1X4JA 1XWHA 5FB1A 4R8PK 3ZVYA 1LDJB 2ECTA 2LXPC 2ECNA 2VJFA 3L1ZB 5B8DA 1HYJA 1X4IA 3KNVA 1WENA 5G05B 3T7LA 2VPGA 5LCWB 3ZPVE 3SOXA 2G6QA 2F6NA 2FUUA 3VK6A 4AP4A 2LGKA 1MM2A 3RPGB 5SVIB 4B7YC 2YSMA 2MD7B 2VPEA 2ECGA 2E6SA 2H0DA 2ECWA 4IC2A 2M3HA 2Y1MA 1ZBDB 4OGCA 3QZVA 2G45A 2CT2A 2KWKA 2UZGA 1T1HA 3JUEA 4AYCB 4X3GA 2EA6A 1HYIA 4QQ4A 1F62A 2CKLA 4YADA 2LAUA 2YSJA 4FK5A 4FJCA 3O47A 3N9NA 4FIPA 2M85A 3Q1DA 5C11A 4A0CD 2L75A 4LADB 4GNDA 4L58A 4N4FA 5H9MA 3O70A 4MSXA 1WEOA 2D8SA 1U6GB 2F42A 4Z0OA 5LKTA 2VJFB 3SHBA 4GNFA 2HDPA 2ZETC 3KV6A 5SVXA 5LKZA 5EYAF 4OGEA 4AUQB 5SVIA 3RPGC 4UP5A 2RR4A 3L1XA 2LN0A 4QF2A 4LK9A 2CRWA 2KKXA 5H1VA 2MNYA 2AN6A 2EXUA 3N9LA 5TDWA 2EGPA 2L5UA 2C2LA 5AIUA 2E61A 5AITA 4FO9A 4F52B 2BAYA 5KH9A 4PTBA 5B77A 4MVTA 4R7EA 3NG2A 4UP0A 3FL2A 3M99A 1N87A 2JMIA 1WEEA 5B79A 5TDRA 5LKUA 1K2FA 1WEWA 3FAOA 2JUNA 1WEVA 2CKLB 2MNZA 3O36A 3DWDA 3N9PA 2LGVA 1Z6UA 2FFWA 3O35A 2JMJA 4LJNA 1JOCA 2EODA 2YHNA 3FEHA 1WFKA 1WEQA 1WE9A 5I3LA 2K4DA 5B76A 2VPBA 3SOUA 3O33A 1Z2QA 2NAAA 2L80A 4P5OB 4YBMA 3U5NA 2LRIC 1VD4A 2FD4A 3C5KA 3M63A 2YYRA 4QF3A 3O37A 2XB1A 3PUQA 4A4BA 4YATA 3LJUX 2M1RA 3ZPV1 4YBSA 3MDBC 2MUMA 2I50A 2K1JA 2KGIA 1DCQA 2XOYA 1V87A 2KREA 3T6RA 3DPLR 1FP0A 1E4UA 5TRBA 3ZTGA 3M7KA 5LKXA 4CA1A 1CHCA 3PURA 5JG6A 2KE1A 5KH7A 2YQMA 2YVRA 3EB5A 4NN2A 4Z0RA 2RSDA 4H9DA 1DVPA 3V43A 4PPEA 4A49A 2EGMA 1Z60A 2YQLA 2KWJA 3O34A 4GNEA 4YBTA 3ZNIA 4V3KC 1RMDA 2VP7A 1WEPA 2YW8A 2LXHC 2YT5A 3HCSA 1BORA 3LQHA 4Q6FA 4F1PA 2VJEB 3SOWA 3C6WA 2KIZA 2IDAA 2FUIA 2MD8C 3KV5A 1JM7B 2YUCA 2RI7A 2L43A 2LV9A 4I7CA 5B78A 2KKYA 3GV4A 4I7DA 3IHPA 4WA6A 4YABA 1IYMA 3U5PA 4GB0A 2VNFA 2ECIA 2PNXA 4WZ0A 2D8UA 3LQJA 3FJUB 4B86C 2JMDA 2YHOA 3T9KA 4TKPB 2YURA 1MBMA 3RTRB 2MT5A 2JM3A 2JRJA 2E6RA 2KYUA 3M62A 3O7AA 3LQIA 5KH3A 2Y43A 2MA6A 2OXQC 2K17A 3E2DA 2KR4A 2XEUA 2DSMA 5DKAA 4BBQA 2KWOA 3EB6A 2KU3A 3PHDA 2LDRA 3DQVR 3KDEC 2PUYA 5D1MB 1WEUA 2C2VS 3LDYA 3FM8C 4C9ZA 4O62A 2Y1NA 2VPDA 2VJEA 1JM7A 3U5OA 2ECJA 2M13A 5H1UA 5TBNA 2KGGA 2L0BA 2G43A 2CSVA 2M6MA 2OWAA 5G04B 2DX8A 5TABA 3N9MA 5FERA 2QJ0A 5G0FA 2CSZA 3MHSA 5D1LB 3N9QA 4WZ2A 4UI9B 3LVRE 5B75A 1WIMA 2XOZA 3ZVZB 2B0OE 4S3OB 3HCTA 2LQ6A 5FEYA 2MA5A 2XOCA
chains in the Genus database with same CATH topology
1FBVA 5D1KB 4ZQLA 3N9OA 2CSYA 4ZDTA 2YREA 2LGGA 5J3XA 2K16A 3KQIA 4GNGA 5DINA 4R2YA 3HCUA 2YU4A 5H1TA 4XI1A 1WEMA 3U5MA 2QIZA 3L11A 3I2DA 3GL6A 4LLBA 4V3LC 1VFYA 4YC9A 4N3WA 1G25A 2KFTA 4AVXA 5C13A 1MM3A 2FSAA 4LKAA 2LGLA 4YAXA 4CCGX 3LRQA 5FB0A 1LDKC 1VYXA 3MHHA 2H0DB 2KWNA 4I7BA 3ASLA 4S3OC 4ZUXU 4AYCA 2QICA 4O64A 1WGMA 4BHWA 1WILA 4A4CA 2MIQA 3ZYQA 3HTKC 2HYED 4IC3A 4WZ3B 4W4UA 1WESA 4L7XA 2ECVA 1X4UA 2F6JA 1X4JA 1XWHA 5FB1A 4R8PK 3ZVYA 1LDJB 2ECTA 2LXPC 2ECNA 2VJFA 3L1ZB 5B8DA 1HYJA 1X4IA 3KNVA 1WENA 5G05B 3T7LA 2VPGA 5LCWB 3ZPVE 3SOXA 2G6QA 2F6NA 2FUUA 3VK6A 4AP4A 2LGKA 1MM2A 3RPGB 4B7YC 2YSMA 2MD7B 2VPEA 2ECGA 2E6SA 2H0DA 2ECWA 4IC2A 2M3HA 2Y1MA 1ZBDB 3QZVA 2G45A 2CT2A 2KWKA 2UZGA 1T1HA 4AYCB 4X3GA 2EA6A 1HYIA 1F62A 2CKLA 4YADA 2YSJA 4FK5A 4FJCA 3N9NA 4FIPA 2M85A 5C11A 4A0CD 2L75A 4LADB 4GNDA 4L58A 4N4FA 5H9MA 3O70A 4MSXA 1WEOA 2D8SA 1U6GB 2F42A 5LKTA 2VJFB 3SHBA 4GNFA 2HDPA 2ZETC 3KV6A 5LKZA 5EYAF 4AUQB 3RPGC 4UP5A 3L1XA 2LN0A 4QF2A 4LK9A 5H1VA 2MNYA 2AN6A 3N9LA 5TDWA 2EGPA 2L5UA 2C2LA 5AIUA 5AITA 4FO9A 4F52B 2BAYA 5KH9A 4PTBA 5B77A 4MVTA 4R7EA 3NG2A 4UP0A 3FL2A 3M99A 1N87A 2JMIA 1WEEA 5B79A 5TDRA 5LKUA 1K2FA 1WEWA 1WEVA 2CKLB 2MNZA 3O36A 3N9PA 2LGVA 1Z6UA 3O35A 2JMJA 4LJNA 1JOCA 2EODA 2YHNA 1WFKA 1WEQA 1WE9A 5I3LA 2K4DA 5B76A 2VPBA 3SOUA 3O33A 1Z2QA 2NAAA 2L80A 4P5OB 4YBMA 3U5NA 2LRIC 1VD4A 3C5KA 3M63A 2YYRA 4QF3A 3O37A 2XB1A 3PUQA 4A4BA 4YATA 2M1RA 3ZPV1 4YBSA 2MUMA 2I50A 2K1JA 2KGIA 1V87A 2KREA 3T6RA 3DPLR 1FP0A 1E4UA 5TRBA 3ZTGA 5LKXA 4CA1A 1CHCA 3PURA 5JG6A 2KE1A 5KH7A 2YQMA 3EB5A 4NN2A 2RSDA 1DVPA 3V43A 4PPEA 4A49A 2YQLA 1Z60A 2KWJA 3O34A 4GNEA 4YBTA 3ZNIA 4V3KC 1RMDA 2VP7A 1WEPA 2YW8A 2LXHC 2YT5A 3HCSA 1BORA 3LQHA 4Q6FA 2VJEB 3SOWA 3C6WA 2KIZA 2IDAA 2FUIA 2MD8C 3KV5A 1JM7B 2YUCA 2RI7A 2L43A 2LV9A 4I7CA 5B78A 3GV4A 4I7DA 3IHPA 4WA6A 4YABA 1IYMA 3U5PA 4GB0A 2VNFA 2ECIA 2PNXA 4WZ0A 3LQJA 4B86C 2JMDA 2YHOA 4TKPB 2YURA 3RTRB 2MT5A 2JRJA 2E6RA 2KYUA 3M62A 3O7AA 3LQIA 5KH3A 2Y43A 2MA6A 2OXQC 2K17A 2KR4A 2XEUA 5DKAA 4BBQA 2KWOA 3EB6A 2KU3A 3PHDA 2LDRA 3DQVR 2PUYA 5D1MB 1WEUA 2C2VS 4C9ZA 2Y1NA 2VPDA 2VJEA 1JM7A 3U5OA 2ECJA 5H1UA 5TBNA 2KGGA 2L0BA 2G43A 2M6MA 5G04B 2DX8A 5TABA 3N9MA 5FERA 2QJ0A 5G0FA 2CSZA 3MHSA 5D1LB 3N9QA 4WZ2A 4UI9B 5B75A 1WIMA 3ZVZB 4S3OB 3HCTA 2LQ6A 5FEYA 2MA5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FBV A;  5D1K B;  4ZQL A;  3N9O A;  2CSY A;  4ZDT A;  2YRE A;  2LGG A;  5J3X A;  2K16 A;  3KQI A;  4GNG A;  5DIN A;  4R2Y A;  3HCU A;  2YU4 A;  5H1T A;  4XI1 A;  1WEM A;  3U5M A;  2QIZ A;  3L11 A;  3I2D A;  3GL6 A;  4LLB A;  4V3L C;  1VFY A;  4YC9 A;  4N3W A;  1G25 A;  2KFT A;  4AVX A;  5C13 A;  1MM3 A;  2FSA A;  4LKA A;  2LGL A;  4YAX A;  4CCG X;  3LRQ A;  5FB0 A;  1LDK C;  1VYX A;  3MHH A;  2H0D B;  2KWN A;  4I7B A;  3ASL A;  4S3O C;  4ZUX U;  4AYC A;  2QIC A;  4O64 A;  1WGM A;  4BHW A;  1WIL A;  4A4C A;  2MIQ A;  3ZYQ A;  3HTK C;  2HYE D;  4IC3 A;  4WZ3 B;  4W4U A;  1WES A;  4L7X A;  2ECV A;  1X4U A;  2F6J A;  1X4J A;  1XWH A;  5FB1 A;  4R8P K;  3ZVY A;  1LDJ B;  2ECT A;  2LXP C;  2ECN A;  2VJF A;  3L1Z B;  5B8D A;  1HYJ A;  1X4I A;  3KNV A;  1WEN A;  5G05 B;  3T7L A;  2VPG A;  5LCW B;  3ZPV E;  3SOX A;  2G6Q A;  2F6N A;  2FUU A;  3VK6 A;  4AP4 A;  2LGK A;  1MM2 A;  3RPG B;  4B7Y C;  2YSM A;  2MD7 B;  2VPE A;  2ECG A;  2E6S A;  2H0D A;  2ECW A;  4IC2 A;  2M3H A;  2Y1M A;  1ZBD B;  3QZV A;  2G45 A;  2CT2 A;  2KWK A;  2UZG A;  1T1H A;  4AYC B;  4X3G A;  2EA6 A;  1HYI A;  1F62 A;  2CKL A;  4YAD A;  2YSJ A;  4FK5 A;  4FJC A;  3N9N A;  4FIP A;  2M85 A;  5C11 A;  4A0C D;  2L75 A;  4LAD B;  4GND A;  4L58 A;  4N4F A;  5H9M A;  3O70 A;  4MSX A;  1WEO A;  2D8S A;  1U6G B;  2F42 A;  5LKT A;  2VJF B;  3SHB A;  4GNF A;  2HDP A;  2ZET C;  3KV6 A;  5LKZ A;  5EYA F;  4AUQ B;  3RPG C;  4UP5 A;  3L1X A;  2LN0 A;  4QF2 A;  4LK9 A;  5H1V A;  2MNY A;  2AN6 A;  3N9L A;  5TDW A;  2EGP A;  2L5U A;  2C2L A;  5AIU A;  5AIT A;  4FO9 A;  4F52 B;  2BAY A;  5KH9 A;  4PTB A;  5B77 A;  4MVT A;  4R7E A;  3NG2 A;  4UP0 A;  3FL2 A;  3M99 A;  1N87 A;  2JMI A;  1WEE A;  5B79 A;  5TDR A;  5LKU A;  1K2F A;  1WEW A;  1WEV A;  2CKL B;  2MNZ A;  3O36 A;  3N9P A;  2LGV A;  1Z6U A;  3O35 A;  2JMJ A;  4LJN A;  1JOC A;  2EOD A;  2YHN A;  1WFK A;  1WEQ A;  1WE9 A;  5I3L A;  2K4D A;  5B76 A;  2VPB A;  3SOU A;  3O33 A;  1Z2Q A;  2NAA A;  2L80 A;  4P5O B;  4YBM A;  3U5N A;  2LRI C;  1VD4 A;  3C5K A;  3M63 A;  2YYR A;  4QF3 A;  3O37 A;  2XB1 A;  3PUQ A;  4A4B A;  4YAT A;  2M1R A;  3ZPV 1;  4YBS A;  2MUM A;  2I50 A;  2K1J A;  2KGI A;  1V87 A;  2KRE A;  3T6R A;  3DPL R;  1FP0 A;  1E4U A;  5TRB A;  3ZTG A;  5LKX A;  4CA1 A;  1CHC A;  3PUR A;  5JG6 A;  2KE1 A;  5KH7 A;  2YQM A;  3EB5 A;  4NN2 A;  2RSD A;  1DVP A;  3V43 A;  4PPE A;  4A49 A;  2YQL A;  1Z60 A;  2KWJ A;  3O34 A;  4GNE A;  4YBT A;  3ZNI A;  4V3K C;  1RMD A;  2VP7 A;  1WEP A;  2YW8 A;  2LXH C;  2YT5 A;  3HCS A;  1BOR A;  3LQH A;  4Q6F A;  2VJE B;  3SOW A;  3C6W A;  2KIZ A;  2IDA A;  2FUI A;  2MD8 C;  3KV5 A;  1JM7 B;  2YUC A;  2RI7 A;  2L43 A;  2LV9 A;  4I7C A;  5B78 A;  3GV4 A;  4I7D A;  3IHP A;  4WA6 A;  4YAB A;  1IYM A;  3U5P A;  4GB0 A;  2VNF A;  2ECI A;  2PNX A;  4WZ0 A;  3LQJ A;  4B86 C;  2JMD A;  2YHO A;  4TKP B;  2YUR A;  3RTR B;  2MT5 A;  2JRJ A;  2E6R A;  2KYU A;  3M62 A;  3O7A A;  3LQI A;  5KH3 A;  2Y43 A;  2MA6 A;  2OXQ C;  2K17 A;  2KR4 A;  2XEU A;  5DKA A;  4BBQ A;  2KWO A;  3EB6 A;  2KU3 A;  3PHD A;  2LDR A;  3DQV R;  2PUY A;  5D1M B;  1WEU A;  2C2V S;  4C9Z A;  2Y1N A;  2VPD A;  2VJE A;  1JM7 A;  3U5O A;  2ECJ A;  5H1U A;  5TBN A;  2KGG A;  2L0B A;  2G43 A;  2M6M A;  5G04 B;  2DX8 A;  5TAB A;  3N9M A;  5FER A;  2QJ0 A;  5G0F A;  2CSZ A;  3MHS A;  5D1L B;  3N9Q A;  4WZ2 A;  4UI9 B;  5B75 A;  1WIM A;  3ZVZ B;  4S3O B;  3HCT A;  2LQ6 A;  5FEY A;  2MA5 A; 
#chains in the Genus database with same CATH topology
 1FBV A;  5D1K B;  4ZQL A;  2DJA A;  3N9O A;  2CSY A;  2CRR A;  4ZDT A;  2YRE A;  2LGG A;  5J3X A;  2K16 A;  3KQI A;  4GNG A;  5DIN A;  4R2Y A;  3HCU A;  2XP0 A;  2YU4 A;  5H1T A;  4XI1 A;  3SUB A;  1WEM A;  3H7H A;  3U5M A;  2QIZ A;  3L11 A;  3I2D A;  3GL6 A;  4LLB A;  4V3L C;  1VFY A;  3FAN A;  4YC9 A;  4N3W A;  1G25 A;  2KFT A;  2MKE A;  4AVX A;  5C13 A;  1MM3 A;  2FSA A;  4LKA A;  2LGL A;  4YAX A;  4CCG X;  2P57 A;  3LRQ A;  5FB0 A;  1LDK C;  1VYX A;  2IQJ A;  3LVQ E;  2L7P A;  3MHH A;  2H0D B;  2KWN A;  4I7B A;  3ASL A;  4S3O C;  5K3Q A;  4ZUX U;  3DDT A;  4AYC A;  2QIC A;  4O64 A;  1WGM A;  4BHW A;  1WIL A;  2CON A;  4A4C A;  2MIQ A;  3ZYQ A;  3HTK C;  2HYE D;  5SVY A;  4IC3 A;  4WZ3 B;  4W4U A;  1WES A;  4L7X A;  2ECV A;  1X4U A;  3PLW A;  2F6J A;  1X4J A;  1XWH A;  5FB1 A;  4R8P K;  3ZVY A;  1LDJ B;  2ECT A;  2LXP C;  2ECN A;  2VJF A;  3L1Z B;  5B8D A;  1HYJ A;  1X4I A;  3KNV A;  1WEN A;  5G05 B;  3T7L A;  2VPG A;  5LCW B;  3ZPV E;  3SOX A;  2G6Q A;  2F6N A;  2FUU A;  3VK6 A;  4AP4 A;  2LGK A;  1MM2 A;  3RPG B;  5SVI B;  4B7Y C;  2YSM A;  2MD7 B;  2VPE A;  2ECG A;  2E6S A;  2H0D A;  2ECW A;  4IC2 A;  2M3H A;  2Y1M A;  1ZBD B;  4OGC A;  3QZV A;  2G45 A;  2CT2 A;  2KWK A;  2UZG A;  1T1H A;  3JUE A;  4AYC B;  4X3G A;  2EA6 A;  1HYI A;  4QQ4 A;  1F62 A;  2CKL A;  4YAD A;  2LAU A;  2YSJ A;  4FK5 A;  4FJC A;  3O47 A;  3N9N A;  4FIP A;  2M85 A;  3Q1D A;  5C11 A;  4A0C D;  2L75 A;  4LAD B;  4GND A;  4L58 A;  4N4F A;  5H9M A;  3O70 A;  4MSX A;  1WEO A;  2D8S A;  1U6G B;  2F42 A;  4Z0O A;  5LKT A;  2VJF B;  3SHB A;  4GNF A;  2HDP A;  2ZET C;  3KV6 A;  5SVX A;  5LKZ A;  5EYA F;  4OGE A;  4AUQ B;  5SVI A;  3RPG C;  4UP5 A;  2RR4 A;  3L1X A;  2LN0 A;  4QF2 A;  4LK9 A;  2CRW A;  2KKX A;  5H1V A;  2MNY A;  2AN6 A;  2EXU A;  3N9L A;  5TDW A;  2EGP A;  2L5U A;  2C2L A;  5AIU A;  2E61 A;  5AIT A;  4FO9 A;  4F52 B;  2BAY A;  5KH9 A;  4PTB A;  5B77 A;  4MVT A;  4R7E A;  3NG2 A;  4UP0 A;  3FL2 A;  3M99 A;  1N87 A;  2JMI A;  1WEE A;  5B79 A;  5TDR A;  5LKU A;  1K2F A;  1WEW A;  3FAO A;  2JUN A;  1WEV A;  2CKL B;  2MNZ A;  3O36 A;  3DWD A;  3N9P A;  2LGV A;  1Z6U A;  2FFW A;  3O35 A;  2JMJ A;  4LJN A;  1JOC A;  2EOD A;  2YHN A;  3FEH A;  1WFK A;  1WEQ A;  1WE9 A;  5I3L A;  2K4D A;  5B76 A;  2VPB A;  3SOU A;  3O33 A;  1Z2Q A;  2NAA A;  2L80 A;  4P5O B;  4YBM A;  3U5N A;  2LRI C;  1VD4 A;  2FD4 A;  3C5K A;  3M63 A;  2YYR A;  4QF3 A;  3O37 A;  2XB1 A;  3PUQ A;  4A4B A;  4YAT A;  3LJU X;  2M1R A;  3ZPV 1;  4YBS A;  3MDB C;  2MUM A;  2I50 A;  2K1J A;  2KGI A;  1DCQ A;  2XOY A;  1V87 A;  2KRE A;  3T6R A;  3DPL R;  1FP0 A;  1E4U A;  5TRB A;  3ZTG A;  3M7K A;  5LKX A;  4CA1 A;  1CHC A;  3PUR A;  5JG6 A;  2KE1 A;  5KH7 A;  2YQM A;  2YVR A;  3EB5 A;  4NN2 A;  4Z0R A;  2RSD A;  4H9D A;  1DVP A;  3V43 A;  4PPE A;  4A49 A;  2EGM A;  1Z60 A;  2YQL A;  2KWJ A;  3O34 A;  4GNE A;  4YBT A;  3ZNI A;  4V3K C;  1RMD A;  2VP7 A;  1WEP A;  2YW8 A;  2LXH C;  2YT5 A;  3HCS A;  1BOR A;  3LQH A;  4Q6F A;  4F1P A;  2VJE B;  3SOW A;  3C6W A;  2KIZ A;  2IDA A;  2FUI A;  2MD8 C;  3KV5 A;  1JM7 B;  2YUC A;  2RI7 A;  2L43 A;  2LV9 A;  4I7C A;  5B78 A;  2KKY A;  3GV4 A;  4I7D A;  3IHP A;  4WA6 A;  4YAB A;  1IYM A;  3U5P A;  4GB0 A;  2VNF A;  2ECI A;  2PNX A;  4WZ0 A;  2D8U A;  3LQJ A;  3FJU B;  4B86 C;  2JMD A;  2YHO A;  3T9K A;  4TKP B;  2YUR A;  1MBM A;  3RTR B;  2MT5 A;  2JM3 A;  2JRJ A;  2E6R A;  2KYU A;  3M62 A;  3O7A A;  3LQI A;  5KH3 A;  2Y43 A;  2MA6 A;  2OXQ C;  2K17 A;  3E2D A;  2KR4 A;  2XEU A;  2DSM A;  5DKA A;  4BBQ A;  2KWO A;  3EB6 A;  2KU3 A;  3PHD A;  2LDR A;  3DQV R;  3KDE C;  2PUY A;  5D1M B;  1WEU A;  2C2V S;  3LDY A;  3FM8 C;  4C9Z A;  4O62 A;  2Y1N A;  2VPD A;  2VJE A;  1JM7 A;  3U5O A;  2ECJ A;  2M13 A;  5H1U A;  5TBN A;  2KGG A;  2L0B A;  2G43 A;  2CSV A;  2M6M A;  2OWA A;  5G04 B;  2DX8 A;  5TAB A;  3N9M A;  5FER A;  2QJ0 A;  5G0F A;  2CSZ A;  3MHS A;  5D1L B;  3N9Q A;  4WZ2 A;  4UI9 B;  3LVR E;  5B75 A;  1WIM A;  2XOZ A;  3ZVZ B;  2B0O E;  4S3O B;  3HCT A;  2LQ6 A;  5FEY A;  2MA5 A;  2XOC A; 
#chains in the Genus database with same CATH homology
 1FBV A;  5D1K B;  4ZQL A;  3N9O A;  2CSY A;  4ZDT A;  2YRE A;  2LGG A;  5J3X A;  2K16 A;  3KQI A;  4GNG A;  5DIN A;  4R2Y A;  3HCU A;  2YU4 A;  5H1T A;  4XI1 A;  1WEM A;  3U5M A;  2QIZ A;  3L11 A;  3I2D A;  3GL6 A;  4LLB A;  4V3L C;  1VFY A;  4YC9 A;  4N3W A;  1G25 A;  2KFT A;  4AVX A;  5C13 A;  1MM3 A;  2FSA A;  4LKA A;  2LGL A;  4YAX A;  4CCG X;  3LRQ A;  5FB0 A;  1LDK C;  1VYX A;  3MHH A;  2H0D B;  2KWN A;  4I7B A;  3ASL A;  4S3O C;  4ZUX U;  4AYC A;  2QIC A;  4O64 A;  1WGM A;  4BHW A;  1WIL A;  4A4C A;  2MIQ A;  3ZYQ A;  3HTK C;  2HYE D;  4IC3 A;  4WZ3 B;  4W4U A;  1WES A;  4L7X A;  2ECV A;  1X4U A;  2F6J A;  1X4J A;  1XWH A;  5FB1 A;  4R8P K;  3ZVY A;  1LDJ B;  2ECT A;  2LXP C;  2ECN A;  2VJF A;  3L1Z B;  5B8D A;  1HYJ A;  1X4I A;  3KNV A;  1WEN A;  5G05 B;  3T7L A;  2VPG A;  5LCW B;  3ZPV E;  3SOX A;  2G6Q A;  2F6N A;  2FUU A;  3VK6 A;  4AP4 A;  2LGK A;  1MM2 A;  3RPG B;  4B7Y C;  2YSM A;  2MD7 B;  2VPE A;  2ECG A;  2E6S A;  2H0D A;  2ECW A;  4IC2 A;  2M3H A;  2Y1M A;  1ZBD B;  3QZV A;  2G45 A;  2CT2 A;  2KWK A;  2UZG A;  1T1H A;  4AYC B;  4X3G A;  2EA6 A;  1HYI A;  1F62 A;  2CKL A;  4YAD A;  2YSJ A;  4FK5 A;  4FJC A;  3N9N A;  4FIP A;  2M85 A;  5C11 A;  4A0C D;  2L75 A;  4LAD B;  4GND A;  4L58 A;  4N4F A;  5H9M A;  3O70 A;  4MSX A;  1WEO A;  2D8S A;  1U6G B;  2F42 A;  5LKT A;  2VJF B;  3SHB A;  4GNF A;  2HDP A;  2ZET C;  3KV6 A;  5LKZ A;  5EYA F;  4AUQ B;  3RPG C;  4UP5 A;  3L1X A;  2LN0 A;  4QF2 A;  4LK9 A;  5H1V A;  2MNY A;  2AN6 A;  3N9L A;  5TDW A;  2EGP A;  2L5U A;  2C2L A;  5AIU A;  5AIT A;  4FO9 A;  4F52 B;  2BAY A;  5KH9 A;  4PTB A;  5B77 A;  4MVT A;  4R7E A;  3NG2 A;  4UP0 A;  3FL2 A;  3M99 A;  1N87 A;  2JMI A;  1WEE A;  5B79 A;  5TDR A;  5LKU A;  1K2F A;  1WEW A;  1WEV A;  2CKL B;  2MNZ A;  3O36 A;  3N9P A;  2LGV A;  1Z6U A;  3O35 A;  2JMJ A;  4LJN A;  1JOC A;  2EOD A;  2YHN A;  1WFK A;  1WEQ A;  1WE9 A;  5I3L A;  2K4D A;  5B76 A;  2VPB A;  3SOU A;  3O33 A;  1Z2Q A;  2NAA A;  2L80 A;  4P5O B;  4YBM A;  3U5N A;  2LRI C;  1VD4 A;  3C5K A;  3M63 A;  2YYR A;  4QF3 A;  3O37 A;  2XB1 A;  3PUQ A;  4A4B A;  4YAT A;  2M1R A;  3ZPV 1;  4YBS A;  2MUM A;  2I50 A;  2K1J A;  2KGI A;  1V87 A;  2KRE A;  3T6R A;  3DPL R;  1FP0 A;  1E4U A;  5TRB A;  3ZTG A;  5LKX A;  4CA1 A;  1CHC A;  3PUR A;  5JG6 A;  2KE1 A;  5KH7 A;  2YQM A;  3EB5 A;  4NN2 A;  2RSD A;  1DVP A;  3V43 A;  4PPE A;  4A49 A;  2YQL A;  1Z60 A;  2KWJ A;  3O34 A;  4GNE A;  4YBT A;  3ZNI A;  4V3K C;  1RMD A;  2VP7 A;  1WEP A;  2YW8 A;  2LXH C;  2YT5 A;  3HCS A;  1BOR A;  3LQH A;  4Q6F A;  2VJE B;  3SOW A;  3C6W A;  2KIZ A;  2IDA A;  2FUI A;  2MD8 C;  3KV5 A;  1JM7 B;  2YUC A;  2RI7 A;  2L43 A;  2LV9 A;  4I7C A;  5B78 A;  3GV4 A;  4I7D A;  3IHP A;  4WA6 A;  4YAB A;  1IYM A;  3U5P A;  4GB0 A;  2VNF A;  2ECI A;  2PNX A;  4WZ0 A;  3LQJ A;  4B86 C;  2JMD A;  2YHO A;  4TKP B;  2YUR A;  3RTR B;  2MT5 A;  2JRJ A;  2E6R A;  2KYU A;  3M62 A;  3O7A A;  3LQI A;  5KH3 A;  2Y43 A;  2MA6 A;  2OXQ C;  2K17 A;  2KR4 A;  2XEU A;  5DKA A;  4BBQ A;  2KWO A;  3EB6 A;  2KU3 A;  3PHD A;  2LDR A;  3DQV R;  2PUY A;  5D1M B;  1WEU A;  2C2V S;  4C9Z A;  2Y1N A;  2VPD A;  2VJE A;  1JM7 A;  3U5O A;  2ECJ A;  5H1U A;  5TBN A;  2KGG A;  2L0B A;  2G43 A;  2M6M A;  5G04 B;  2DX8 A;  5TAB A;  3N9M A;  5FER A;  2QJ0 A;  5G0F A;  2CSZ A;  3MHS A;  5D1L B;  3N9Q A;  4WZ2 A;  4UI9 B;  5B75 A;  1WIM A;  3ZVZ B;  4S3O B;  3HCT A;  2LQ6 A;  5FEY A;  2MA5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...