1Z2QA

High-resolution solution structure of the lm5-1 fyve domain from leishmania major
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
84
structure length
84
Chain Sequence
GPLGSMGEKQSKGYWQEDEDAPACNGCGCVFTTTVRRHHCRNCGYVLCGDCSRHRAAIPMRGITEPERVCDACYLALRSSNMAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A high-resolution solution structure of a trypanosomatid FYVE domain.
pubmed doi rcsb
source organism Leishmania major
molecule tags Membrane protein
molecule keywords LM5-1
total genus 7
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2005-03-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1z2qA00
1MM2A 2VPEA 2LXPC 3SOUA 2YU4A 4YAXA 1VD4A 4AYCA 4A0CD 4UP5A 3HCSA 1WEPA 4WZ3B 5H9MA 1RMDA 2EA6A 2M6MA 2MD8C 4GNFA 2QICA 1G25A 2C2VS 4V3KC 5B8DA 5KH7A 2BAYA 3N9LA 2E6SA 4LK9A 4NN2A 4L7XA 5H1UA 4F52B 3T6RA 4YBMA 2KWJA 3FL2A 1U6GB 2ZETC 1K2FA 2KWNA 4YATA 2KYUA 2YHNA 4LJNA 2KGIA 2KIZA 2L5UA 2KGGA 1Z2QA 3O33A 4WZ2A 5TBNA 4I7DA 2CKLA 4B86C 1LDKC 2YQMA 1T1HA 1F62A 2H0DB 3C5KA 2YURA 4MVTA 1MM3A 4LLBA 2NAAA 2CSZA 2EGPA 5FB0A 2MA5A 2I50A 4R8PK 5J3XA 3L1ZB 3PHDA 2UZGA 5G05B 2CKLB 2L0BA 3N9QA 2PNXA 2KE1A 2LGGA 2D8SA 2LGKA 3ZVYA 4AP4A 2L75A 5TRBA 5H1VA 4CCGX 1WEOA 3U5NA 2OXQC 3VK6A 2VJFA 2KWKA 1N87A 5FERA 4N4FA 2XEUA 5AIUA 2KREA 5KH9A 2XB1A 2YUCA 2YYRA 3U5MA 3KNVA 1X4UA 2DX8A 3N9MA 3M99A 5C13A 5EYAF 3O37A 3DQVR 2M1RA 2M85A 3L1XA 2F6NA 4QF2A 3KV6A 5D1LB 4UP0A 2LGLA 2K4DA 2LXHC 2L80A 2CT2A 2KU3A 4FIPA 4O64A 2VP7A 3LRQA 4FJCA 4Q6FA 2K17A 3HTKC 3RPGC 2F6JA 5LCWB 5DKAA 3HCTA 2ECTA 1WEUA 2VNFA 1Z60A 5H1TA 2MT5A 5KH3A 1JM7B 1WEWA 2VPBA 3ZPV1 3EB6A 2JMDA 2G6QA 4WA6A 1XWHA 3N9OA 2LGVA 4ZDTA 3ASLA 1E4UA 4YBSA 3IHPA 4MSXA 2ECNA 3LQHA 4AYCB 5JG6A 4B7YC 3ZPVE 1WEVA 5G0FA 3C6WA 4V3LC 5LKXA 2YQLA 1JM7A 3PUQA 4L58A 2HDPA 2E6RA 1LDJB 3I2DA 3GV4A 2FUUA 4GNGA 2HYED 4R2YA 2KWOA 3T7LA 5TDWA 2Y1NA 2VPGA 2ECVA 2KR4A 3DPLR 3ZNIA 3O7AA 2RSDA 4TKPB 4LKAA 2G45A 3SOXA 3QZVA 2MA6A 5B79A 3M62A 2LQ6A 4PTBA 4IC2A 5D1MB 2G43A 4WZ0A 2K16A 1FBVA 4ZUXU 3O35A 3M63A 5B75A 3O34A 1Z6UA 1ZBDB 3GL6A 3ZTGA 2K1JA 5AITA 2KFTA 4AVXA 2QJ0A 3N9NA 4BBQA 1JOCA 2LN0A 3U5PA 2FUIA 5LKUA 3ZVZB 3NG2A 2FSAA 2H0DA 1FP0A 3L11A 1WEQA 1HYIA 4YABA 3N9PA 2L43A 5B78A 3PURA 4YADA 3O70A 3ZYQA 2VJEA 4R7EA 3KQIA 4A4BA 2ECJA 1CHCA 3U5OA 2QIZA 1HYJA 1DVPA 4QF3A 4N3WA 4I7CA 2PUYA 3MHHA 4FO9A 1VFYA 2AN6A 2VJFB 4CA1A 2CSYA 1BORA 4AUQB 1WILA 3EB5A 5C11A 1WEMA 2JRJA 2Y43A 4GNDA 1WENA 4UI9B 4PPEA 2YREA 4BHWA 4C9ZA 1WE9A 2YT5A 5B77A 4FK5A 2YW8A 4GNEA 5TDRA 4W4UA 3O36A 4IC3A 1X4IA 2IDAA 4ZQLA 4I7BA 5I3LA 4S3OB 1WEEA 5B76A 4LADB 2MUMA 2YSMA 5G04B 4A49A 3RTRB 3MHSA 3LQIA 2JMJA 2VJEB 2LRIC 1IYMA 2ECWA 4X3GA 2M3HA 4GB0A 3V43A 3LQJA 3RPGB 5DINA 5LKTA 5TABA 2C2LA 4S3OC 2LDRA 1V87A 2EODA 1WESA 4XI1A 1WFKA 2LV9A 5FB1A 4P5OB 2YHOA 3SOWA 4A4CA 5LKZA 4YBTA 1WGMA 2Y1MA 2MD7B 1WIMA 2MIQA 3SHBA 2JMIA 2ECGA 4YC9A 5FEYA 2MNYA 3KV5A 5D1KB 1VYXA 3HCUA 2RI7A 2VPDA 2ECIA 2MNZA 1X4JA 2F42A 2YSJA
chains in the Genus database with same CATH superfamily
2EXUA 1MM2A 2KKYA 2VPEA 3KDEC 2LXPC 3SOUA 2YU4A 4YAXA 1VD4A 4AYCA 2RR4A 4A0CD 4UP5A 3HCSA 1WEPA 4WZ3B 5H9MA 4O62A 1RMDA 2EA6A 2M6MA 2MD8C 4GNFA 2QICA 1G25A 2C2VS 4Z0RA 4V3KC 5B8DA 5KH7A 3O47A 2BAYA 3N9LA 2E6SA 4LK9A 4NN2A 4L7XA 5H1UA 4F52B 3T6RA 4YBMA 2KWJA 3FL2A 1U6GB 2ZETC 1K2FA 2KWNA 4YATA 2KYUA 2YHNA 4LJNA 2KGIA 2KIZA 2L5UA 4OGEA 2KGGA 1Z2QA 3FEHA 3O33A 4WZ2A 5TBNA 4I7DA 2CKLA 4B86C 3JUEA 1LDKC 2YQMA 1T1HA 1F62A 2H0DB 3Q1DA 3DDTA 3C5KA 2YURA 4MVTA 1MM3A 2KKXA 4LLBA 2NAAA 2CSZA 2EGPA 5FB0A 2MA5A 2I50A 3FANA 4R8PK 3SUBA 5SVYA 5J3XA 2P57A 3L1ZB 3PHDA 2UZGA 5G05B 2CKLB 2L0BA 3N9QA 2PNXA 2KE1A 2LGGA 2D8SA 2LGKA 3ZVYA 2B0OE 2LAUA 4AP4A 2L75A 5TRBA 5H1VA 4CCGX 1WEOA 3U5NA 2OXQC 3VK6A 2VJFA 2KWKA 1N87A 5FERA 4N4FA 2XEUA 5SVIA 5AIUA 2KREA 5KH9A 2DJAA 2XB1A 2YUCA 2YYRA 3U5MA 3KNVA 3H7HA 1X4UA 2DX8A 2FD4A 5SVXA 3N9MA 3M99A 5C13A 5EYAF 3O37A 2M13A 3DQVR 3LDYA 2M1RA 2M85A 3L1XA 3LJUX 2F6NA 4QF2A 3KV6A 5D1LB 4UP0A 2LGLA 2K4DA 2LXHC 2L80A 2CT2A 2KU3A 4FIPA 2XOCA 4O64A 2VP7A 3LRQA 4FJCA 4Q6FA 2K17A 4Z0OA 2CONA 5K3QA 3HTKC 3RPGC 2F6JA 5LCWB 2CRWA 5DKAA 3DWDA 4H9DA 3HCTA 2IQJA 2ECTA 1WEUA 2VNFA 3MDBC 1Z60A 5H1TA 2MT5A 5KH3A 3FAOA 1JM7B 2XP0A 1WEWA 3LVQE 2VPBA 3EB6A 3ZPV1 2JMDA 2G6QA 4WA6A 3T9KA 1XWHA 3N9OA 2LGVA 4ZDTA 3ASLA 1E4UA 4YBSA 3IHPA 1MBMA 4MSXA 2ECNA 3LQHA 4AYCB 5JG6A 4B7YC 5SVIB 3ZPVE 1WEVA 5G0FA 3C6WA 4V3LC 5LKXA 2YQLA 1JM7A 3PUQA 4L58A 2HDPA 2JUNA 2OWAA 2E6RA 1LDJB 3I2DA 3GV4A 2FUUA 4GNGA 4OGCA 2HYED 4R2YA 2KWOA 3T7LA 5TDWA 2Y1NA 2VPGA 2ECVA 2KR4A 3DPLR 3ZNIA 3O7AA 2CSVA 2RSDA 4TKPB 4LKAA 2G45A 2DSMA 4QQ4A 3SOXA 3QZVA 2MA6A 5B79A 3M62A 2LQ6A 4PTBA 4IC2A 5D1MB 2JM3A 2G43A 4WZ0A 2K16A 1FBVA 4ZUXU 3O35A 3M63A 5B75A 3O34A 1Z6UA 1ZBDB 3GL6A 3ZTGA 2K1JA 5AITA 2KFTA 4AVXA 2QJ0A 3N9NA 2XOYA 4BBQA 1JOCA 2LN0A 3U5PA 2FUIA 5LKUA 3ZVZB 3NG2A 2FSAA 2H0DA 1FP0A 3L11A 1WEQA 1HYIA 4YABA 3N9PA 2L43A 5B78A 3PURA 4YADA 3O70A 3ZYQA 2VJEA 4R7EA 3KQIA 4A4BA 2ECJA 1CHCA 3U5OA 2QIZA 1HYJA 1DVPA 4QF3A 4N3WA 4I7CA 2PUYA 3MHHA 4FO9A 1VFYA 2AN6A 2VJFB 3M7KA 4CA1A 2CSYA 1BORA 4AUQB 1WILA 2EGMA 3EB5A 2E61A 5C11A 1WEMA 2JRJA 2Y43A 4GNDA 1WENA 4UI9B 3PLWA 4PPEA 2YREA 4BHWA 4C9ZA 1WE9A 2YT5A 5B77A 4FK5A 3E2DA 2YW8A 4GNEA 2CRRA 5TDRA 2L7PA 4W4UA 3O36A 4IC3A 1X4IA 2IDAA 4ZQLA 4I7BA 5I3LA 4S3OB 2MKEA 1WEEA 5B76A 4LADB 2MUMA 2YSMA 2FFWA 5G04B 4A49A 4F1PA 3RTRB 3MHSA 3LQIA 2JMJA 1DCQA 2VJEB 2LRIC 1IYMA 2ECWA 4X3GA 2M3HA 4GB0A 3V43A 3LQJA 3RPGB 5DINA 5LKTA 5TABA 2C2LA 4S3OC 2LDRA 1V87A 2EODA 1WESA 4XI1A 1WFKA 2LV9A 5FB1A 4P5OB 2YHOA 3SOWA 4A4CA 5LKZA 4YBTA 1WGMA 2Y1MA 3FJUB 2MD7B 1WIMA 2MIQA 3SHBA 2JMIA 2D8UA 2ECGA 4YC9A 5FEYA 2MNYA 3KV5A 5D1KB 1VYXA 3HCUA 3LVRE 2RI7A 2VPDA 3FM8C 2XOZA 2ECIA 2MNZA 1X4JA 2F42A 2YVRA 2YSJA
chains in the Genus database with same CATH topology
1MM2A 2VPEA 2LXPC 3SOUA 2YU4A 4YAXA 1VD4A 4AYCA 4A0CD 4UP5A 3HCSA 1WEPA 4WZ3B 5H9MA 1RMDA 2EA6A 2M6MA 2MD8C 4GNFA 2QICA 1G25A 2C2VS 4V3KC 5B8DA 5KH7A 2BAYA 3N9LA 2E6SA 4LK9A 4NN2A 4L7XA 5H1UA 4F52B 3T6RA 4YBMA 2KWJA 3FL2A 1U6GB 2ZETC 1K2FA 2KWNA 4YATA 2KYUA 2YHNA 4LJNA 2KGIA 2KIZA 2L5UA 2KGGA 1Z2QA 3O33A 4WZ2A 5TBNA 4I7DA 2CKLA 4B86C 1LDKC 2YQMA 1T1HA 1F62A 2H0DB 3C5KA 2YURA 4MVTA 1MM3A 4LLBA 2NAAA 2CSZA 2EGPA 5FB0A 2MA5A 2I50A 4R8PK 5J3XA 3L1ZB 3PHDA 2UZGA 5G05B 2CKLB 2L0BA 3N9QA 2PNXA 2KE1A 2LGGA 2D8SA 2LGKA 3ZVYA 4AP4A 2L75A 5TRBA 5H1VA 4CCGX 1WEOA 3U5NA 2OXQC 3VK6A 2VJFA 2KWKA 1N87A 5FERA 4N4FA 2XEUA 5AIUA 2KREA 5KH9A 2XB1A 2YUCA 2YYRA 3U5MA 3KNVA 1X4UA 2DX8A 3N9MA 3M99A 5C13A 5EYAF 3O37A 3DQVR 2M1RA 2M85A 3L1XA 2F6NA 4QF2A 3KV6A 5D1LB 4UP0A 2LGLA 2K4DA 2LXHC 2L80A 2CT2A 2KU3A 4FIPA 4O64A 2VP7A 3LRQA 4FJCA 4Q6FA 2K17A 3HTKC 3RPGC 2F6JA 5LCWB 5DKAA 3HCTA 2ECTA 1WEUA 2VNFA 1Z60A 5H1TA 2MT5A 5KH3A 1JM7B 1WEWA 2VPBA 3ZPV1 3EB6A 2JMDA 2G6QA 4WA6A 1XWHA 3N9OA 2LGVA 4ZDTA 3ASLA 1E4UA 4YBSA 3IHPA 4MSXA 2ECNA 3LQHA 4AYCB 5JG6A 4B7YC 3ZPVE 1WEVA 5G0FA 3C6WA 4V3LC 5LKXA 2YQLA 1JM7A 3PUQA 4L58A 2HDPA 2E6RA 1LDJB 3I2DA 3GV4A 2FUUA 4GNGA 2HYED 4R2YA 2KWOA 3T7LA 5TDWA 2Y1NA 2VPGA 2ECVA 2KR4A 3DPLR 3ZNIA 3O7AA 2RSDA 4TKPB 4LKAA 2G45A 3SOXA 3QZVA 2MA6A 5B79A 3M62A 2LQ6A 4PTBA 4IC2A 5D1MB 2G43A 4WZ0A 2K16A 1FBVA 4ZUXU 3O35A 3M63A 5B75A 3O34A 1Z6UA 1ZBDB 3GL6A 3ZTGA 2K1JA 5AITA 2KFTA 4AVXA 2QJ0A 3N9NA 4BBQA 1JOCA 2LN0A 3U5PA 2FUIA 5LKUA 3ZVZB 3NG2A 2FSAA 2H0DA 1FP0A 3L11A 1WEQA 1HYIA 4YABA 3N9PA 2L43A 5B78A 3PURA 4YADA 3O70A 3ZYQA 2VJEA 4R7EA 3KQIA 4A4BA 2ECJA 1CHCA 3U5OA 2QIZA 1HYJA 1DVPA 4QF3A 4N3WA 4I7CA 2PUYA 3MHHA 4FO9A 1VFYA 2AN6A 2VJFB 4CA1A 2CSYA 1BORA 4AUQB 1WILA 3EB5A 5C11A 1WEMA 2JRJA 2Y43A 4GNDA 1WENA 4UI9B 4PPEA 2YREA 4BHWA 4C9ZA 1WE9A 2YT5A 5B77A 4FK5A 2YW8A 4GNEA 5TDRA 4W4UA 3O36A 4IC3A 1X4IA 2IDAA 4ZQLA 4I7BA 5I3LA 4S3OB 1WEEA 5B76A 4LADB 2MUMA 2YSMA 5G04B 4A49A 3RTRB 3MHSA 3LQIA 2JMJA 2VJEB 2LRIC 1IYMA 2ECWA 4X3GA 2M3HA 4GB0A 3V43A 3LQJA 3RPGB 5DINA 5LKTA 5TABA 2C2LA 4S3OC 2LDRA 1V87A 2EODA 1WESA 4XI1A 1WFKA 2LV9A 5FB1A 4P5OB 2YHOA 3SOWA 4A4CA 5LKZA 4YBTA 1WGMA 2Y1MA 2MD7B 1WIMA 2MIQA 3SHBA 2JMIA 2ECGA 4YC9A 5FEYA 2MNYA 3KV5A 5D1KB 1VYXA 3HCUA 2RI7A 2VPDA 2ECIA 2MNZA 1X4JA 2F42A 2YSJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MM2 A;  2VPE A;  2LXP C;  3SOU A;  2YU4 A;  4YAX A;  1VD4 A;  4AYC A;  4A0C D;  4UP5 A;  3HCS A;  1WEP A;  4WZ3 B;  5H9M A;  1RMD A;  2EA6 A;  2M6M A;  2MD8 C;  4GNF A;  2QIC A;  1G25 A;  2C2V S;  4V3K C;  5B8D A;  5KH7 A;  2BAY A;  3N9L A;  2E6S A;  4LK9 A;  4NN2 A;  4L7X A;  5H1U A;  4F52 B;  3T6R A;  4YBM A;  2KWJ A;  3FL2 A;  1U6G B;  2ZET C;  1K2F A;  2KWN A;  4YAT A;  2KYU A;  2YHN A;  4LJN A;  2KGI A;  2KIZ A;  2L5U A;  2KGG A;  1Z2Q A;  3O33 A;  4WZ2 A;  5TBN A;  4I7D A;  2CKL A;  4B86 C;  1LDK C;  2YQM A;  1T1H A;  1F62 A;  2H0D B;  3C5K A;  2YUR A;  4MVT A;  1MM3 A;  4LLB A;  2NAA A;  2CSZ A;  2EGP A;  5FB0 A;  2MA5 A;  2I50 A;  4R8P K;  5J3X A;  3L1Z B;  3PHD A;  2UZG A;  5G05 B;  2CKL B;  2L0B A;  3N9Q A;  2PNX A;  2KE1 A;  2LGG A;  2D8S A;  2LGK A;  3ZVY A;  4AP4 A;  2L75 A;  5TRB A;  5H1V A;  4CCG X;  1WEO A;  3U5N A;  2OXQ C;  3VK6 A;  2VJF A;  2KWK A;  1N87 A;  5FER A;  4N4F A;  2XEU A;  5AIU A;  2KRE A;  5KH9 A;  2XB1 A;  2YUC A;  2YYR A;  3U5M A;  3KNV A;  1X4U A;  2DX8 A;  3N9M A;  3M99 A;  5C13 A;  5EYA F;  3O37 A;  3DQV R;  2M1R A;  2M85 A;  3L1X A;  2F6N A;  4QF2 A;  3KV6 A;  5D1L B;  4UP0 A;  2LGL A;  2K4D A;  2LXH C;  2L80 A;  2CT2 A;  2KU3 A;  4FIP A;  4O64 A;  2VP7 A;  3LRQ A;  4FJC A;  4Q6F A;  2K17 A;  3HTK C;  3RPG C;  2F6J A;  5LCW B;  5DKA A;  3HCT A;  2ECT A;  1WEU A;  2VNF A;  1Z60 A;  5H1T A;  2MT5 A;  5KH3 A;  1JM7 B;  1WEW A;  2VPB A;  3ZPV 1;  3EB6 A;  2JMD A;  2G6Q A;  4WA6 A;  1XWH A;  3N9O A;  2LGV A;  4ZDT A;  3ASL A;  1E4U A;  4YBS A;  3IHP A;  4MSX A;  2ECN A;  3LQH A;  4AYC B;  5JG6 A;  4B7Y C;  3ZPV E;  1WEV A;  5G0F A;  3C6W A;  4V3L C;  5LKX A;  2YQL A;  1JM7 A;  3PUQ A;  4L58 A;  2HDP A;  2E6R A;  1LDJ B;  3I2D A;  3GV4 A;  2FUU A;  4GNG A;  2HYE D;  4R2Y A;  2KWO A;  3T7L A;  5TDW A;  2Y1N A;  2VPG A;  2ECV A;  2KR4 A;  3DPL R;  3ZNI A;  3O7A A;  2RSD A;  4TKP B;  4LKA A;  2G45 A;  3SOX A;  3QZV A;  2MA6 A;  5B79 A;  3M62 A;  2LQ6 A;  4PTB A;  4IC2 A;  5D1M B;  2G43 A;  4WZ0 A;  2K16 A;  1FBV A;  4ZUX U;  3O35 A;  3M63 A;  5B75 A;  3O34 A;  1Z6U A;  1ZBD B;  3GL6 A;  3ZTG A;  2K1J A;  5AIT A;  2KFT A;  4AVX A;  2QJ0 A;  3N9N A;  4BBQ A;  1JOC A;  2LN0 A;  3U5P A;  2FUI A;  5LKU A;  3ZVZ B;  3NG2 A;  2FSA A;  2H0D A;  1FP0 A;  3L11 A;  1WEQ A;  1HYI A;  4YAB A;  3N9P A;  2L43 A;  5B78 A;  3PUR A;  4YAD A;  3O70 A;  3ZYQ A;  2VJE A;  4R7E A;  3KQI A;  4A4B A;  2ECJ A;  1CHC A;  3U5O A;  2QIZ A;  1HYJ A;  1DVP A;  4QF3 A;  4N3W A;  4I7C A;  2PUY A;  3MHH A;  4FO9 A;  1VFY A;  2AN6 A;  2VJF B;  4CA1 A;  2CSY A;  1BOR A;  4AUQ B;  1WIL A;  3EB5 A;  5C11 A;  1WEM A;  2JRJ A;  2Y43 A;  4GND A;  1WEN A;  4UI9 B;  4PPE A;  2YRE A;  4BHW A;  4C9Z A;  1WE9 A;  2YT5 A;  5B77 A;  4FK5 A;  2YW8 A;  4GNE A;  5TDR A;  4W4U A;  3O36 A;  4IC3 A;  1X4I A;  2IDA A;  4ZQL A;  4I7B A;  5I3L A;  4S3O B;  1WEE A;  5B76 A;  4LAD B;  2MUM A;  2YSM A;  5G04 B;  4A49 A;  3RTR B;  3MHS A;  3LQI A;  2JMJ A;  2VJE B;  2LRI C;  1IYM A;  2ECW A;  4X3G A;  2M3H A;  4GB0 A;  3V43 A;  3LQJ A;  3RPG B;  5DIN A;  5LKT A;  5TAB A;  2C2L A;  4S3O C;  2LDR A;  1V87 A;  2EOD A;  1WES A;  4XI1 A;  1WFK A;  2LV9 A;  5FB1 A;  4P5O B;  2YHO A;  3SOW A;  4A4C A;  5LKZ A;  4YBT A;  1WGM A;  2Y1M A;  2MD7 B;  1WIM A;  2MIQ A;  3SHB A;  2JMI A;  2ECG A;  4YC9 A;  5FEY A;  2MNY A;  3KV5 A;  5D1K B;  1VYX A;  3HCU A;  2RI7 A;  2VPD A;  2ECI A;  2MNZ A;  1X4J A;  2F42 A;  2YSJ A; 
#chains in the Genus database with same CATH topology
 2EXU A;  1MM2 A;  2KKY A;  2VPE A;  3KDE C;  2LXP C;  3SOU A;  2YU4 A;  4YAX A;  1VD4 A;  4AYC A;  2RR4 A;  4A0C D;  4UP5 A;  3HCS A;  1WEP A;  4WZ3 B;  5H9M A;  4O62 A;  1RMD A;  2EA6 A;  2M6M A;  2MD8 C;  4GNF A;  2QIC A;  1G25 A;  2C2V S;  4Z0R A;  4V3K C;  5B8D A;  5KH7 A;  3O47 A;  2BAY A;  3N9L A;  2E6S A;  4LK9 A;  4NN2 A;  4L7X A;  5H1U A;  4F52 B;  3T6R A;  4YBM A;  2KWJ A;  3FL2 A;  1U6G B;  2ZET C;  1K2F A;  2KWN A;  4YAT A;  2KYU A;  2YHN A;  4LJN A;  2KGI A;  2KIZ A;  2L5U A;  4OGE A;  2KGG A;  1Z2Q A;  3FEH A;  3O33 A;  4WZ2 A;  5TBN A;  4I7D A;  2CKL A;  4B86 C;  3JUE A;  1LDK C;  2YQM A;  1T1H A;  1F62 A;  2H0D B;  3Q1D A;  3DDT A;  3C5K A;  2YUR A;  4MVT A;  1MM3 A;  2KKX A;  4LLB A;  2NAA A;  2CSZ A;  2EGP A;  5FB0 A;  2MA5 A;  2I50 A;  3FAN A;  4R8P K;  3SUB A;  5SVY A;  5J3X A;  2P57 A;  3L1Z B;  3PHD A;  2UZG A;  5G05 B;  2CKL B;  2L0B A;  3N9Q A;  2PNX A;  2KE1 A;  2LGG A;  2D8S A;  2LGK A;  3ZVY A;  2B0O E;  2LAU A;  4AP4 A;  2L75 A;  5TRB A;  5H1V A;  4CCG X;  1WEO A;  3U5N A;  2OXQ C;  3VK6 A;  2VJF A;  2KWK A;  1N87 A;  5FER A;  4N4F A;  2XEU A;  5SVI A;  5AIU A;  2KRE A;  5KH9 A;  2DJA A;  2XB1 A;  2YUC A;  2YYR A;  3U5M A;  3KNV A;  3H7H A;  1X4U A;  2DX8 A;  2FD4 A;  5SVX A;  3N9M A;  3M99 A;  5C13 A;  5EYA F;  3O37 A;  2M13 A;  3DQV R;  3LDY A;  2M1R A;  2M85 A;  3L1X A;  3LJU X;  2F6N A;  4QF2 A;  3KV6 A;  5D1L B;  4UP0 A;  2LGL A;  2K4D A;  2LXH C;  2L80 A;  2CT2 A;  2KU3 A;  4FIP A;  2XOC A;  4O64 A;  2VP7 A;  3LRQ A;  4FJC A;  4Q6F A;  2K17 A;  4Z0O A;  2CON A;  5K3Q A;  3HTK C;  3RPG C;  2F6J A;  5LCW B;  2CRW A;  5DKA A;  3DWD A;  4H9D A;  3HCT A;  2IQJ A;  2ECT A;  1WEU A;  2VNF A;  3MDB C;  1Z60 A;  5H1T A;  2MT5 A;  5KH3 A;  3FAO A;  1JM7 B;  2XP0 A;  1WEW A;  3LVQ E;  2VPB A;  3EB6 A;  3ZPV 1;  2JMD A;  2G6Q A;  4WA6 A;  3T9K A;  1XWH A;  3N9O A;  2LGV A;  4ZDT A;  3ASL A;  1E4U A;  4YBS A;  3IHP A;  1MBM A;  4MSX A;  2ECN A;  3LQH A;  4AYC B;  5JG6 A;  4B7Y C;  5SVI B;  3ZPV E;  1WEV A;  5G0F A;  3C6W A;  4V3L C;  5LKX A;  2YQL A;  1JM7 A;  3PUQ A;  4L58 A;  2HDP A;  2JUN A;  2OWA A;  2E6R A;  1LDJ B;  3I2D A;  3GV4 A;  2FUU A;  4GNG A;  4OGC A;  2HYE D;  4R2Y A;  2KWO A;  3T7L A;  5TDW A;  2Y1N A;  2VPG A;  2ECV A;  2KR4 A;  3DPL R;  3ZNI A;  3O7A A;  2CSV A;  2RSD A;  4TKP B;  4LKA A;  2G45 A;  2DSM A;  4QQ4 A;  3SOX A;  3QZV A;  2MA6 A;  5B79 A;  3M62 A;  2LQ6 A;  4PTB A;  4IC2 A;  5D1M B;  2JM3 A;  2G43 A;  4WZ0 A;  2K16 A;  1FBV A;  4ZUX U;  3O35 A;  3M63 A;  5B75 A;  3O34 A;  1Z6U A;  1ZBD B;  3GL6 A;  3ZTG A;  2K1J A;  5AIT A;  2KFT A;  4AVX A;  2QJ0 A;  3N9N A;  2XOY A;  4BBQ A;  1JOC A;  2LN0 A;  3U5P A;  2FUI A;  5LKU A;  3ZVZ B;  3NG2 A;  2FSA A;  2H0D A;  1FP0 A;  3L11 A;  1WEQ A;  1HYI A;  4YAB A;  3N9P A;  2L43 A;  5B78 A;  3PUR A;  4YAD A;  3O70 A;  3ZYQ A;  2VJE A;  4R7E A;  3KQI A;  4A4B A;  2ECJ A;  1CHC A;  3U5O A;  2QIZ A;  1HYJ A;  1DVP A;  4QF3 A;  4N3W A;  4I7C A;  2PUY A;  3MHH A;  4FO9 A;  1VFY A;  2AN6 A;  2VJF B;  3M7K A;  4CA1 A;  2CSY A;  1BOR A;  4AUQ B;  1WIL A;  2EGM A;  3EB5 A;  2E61 A;  5C11 A;  1WEM A;  2JRJ A;  2Y43 A;  4GND A;  1WEN A;  4UI9 B;  3PLW A;  4PPE A;  2YRE A;  4BHW A;  4C9Z A;  1WE9 A;  2YT5 A;  5B77 A;  4FK5 A;  3E2D A;  2YW8 A;  4GNE A;  2CRR A;  5TDR A;  2L7P A;  4W4U A;  3O36 A;  4IC3 A;  1X4I A;  2IDA A;  4ZQL A;  4I7B A;  5I3L A;  4S3O B;  2MKE A;  1WEE A;  5B76 A;  4LAD B;  2MUM A;  2YSM A;  2FFW A;  5G04 B;  4A49 A;  4F1P A;  3RTR B;  3MHS A;  3LQI A;  2JMJ A;  1DCQ A;  2VJE B;  2LRI C;  1IYM A;  2ECW A;  4X3G A;  2M3H A;  4GB0 A;  3V43 A;  3LQJ A;  3RPG B;  5DIN A;  5LKT A;  5TAB A;  2C2L A;  4S3O C;  2LDR A;  1V87 A;  2EOD A;  1WES A;  4XI1 A;  1WFK A;  2LV9 A;  5FB1 A;  4P5O B;  2YHO A;  3SOW A;  4A4C A;  5LKZ A;  4YBT A;  1WGM A;  2Y1M A;  3FJU B;  2MD7 B;  1WIM A;  2MIQ A;  3SHB A;  2JMI A;  2D8U A;  2ECG A;  4YC9 A;  5FEY A;  2MNY A;  3KV5 A;  5D1K B;  1VYX A;  3HCU A;  3LVR E;  2RI7 A;  2VPD A;  3FM8 C;  2XOZ A;  2ECI A;  2MNZ A;  1X4J A;  2F42 A;  2YVR A;  2YSJ A; 
#chains in the Genus database with same CATH homology
 1MM2 A;  2VPE A;  2LXP C;  3SOU A;  2YU4 A;  4YAX A;  1VD4 A;  4AYC A;  4A0C D;  4UP5 A;  3HCS A;  1WEP A;  4WZ3 B;  5H9M A;  1RMD A;  2EA6 A;  2M6M A;  2MD8 C;  4GNF A;  2QIC A;  1G25 A;  2C2V S;  4V3K C;  5B8D A;  5KH7 A;  2BAY A;  3N9L A;  2E6S A;  4LK9 A;  4NN2 A;  4L7X A;  5H1U A;  4F52 B;  3T6R A;  4YBM A;  2KWJ A;  3FL2 A;  1U6G B;  2ZET C;  1K2F A;  2KWN A;  4YAT A;  2KYU A;  2YHN A;  4LJN A;  2KGI A;  2KIZ A;  2L5U A;  2KGG A;  1Z2Q A;  3O33 A;  4WZ2 A;  5TBN A;  4I7D A;  2CKL A;  4B86 C;  1LDK C;  2YQM A;  1T1H A;  1F62 A;  2H0D B;  3C5K A;  2YUR A;  4MVT A;  1MM3 A;  4LLB A;  2NAA A;  2CSZ A;  2EGP A;  5FB0 A;  2MA5 A;  2I50 A;  4R8P K;  5J3X A;  3L1Z B;  3PHD A;  2UZG A;  5G05 B;  2CKL B;  2L0B A;  3N9Q A;  2PNX A;  2KE1 A;  2LGG A;  2D8S A;  2LGK A;  3ZVY A;  4AP4 A;  2L75 A;  5TRB A;  5H1V A;  4CCG X;  1WEO A;  3U5N A;  2OXQ C;  3VK6 A;  2VJF A;  2KWK A;  1N87 A;  5FER A;  4N4F A;  2XEU A;  5AIU A;  2KRE A;  5KH9 A;  2XB1 A;  2YUC A;  2YYR A;  3U5M A;  3KNV A;  1X4U A;  2DX8 A;  3N9M A;  3M99 A;  5C13 A;  5EYA F;  3O37 A;  3DQV R;  2M1R A;  2M85 A;  3L1X A;  2F6N A;  4QF2 A;  3KV6 A;  5D1L B;  4UP0 A;  2LGL A;  2K4D A;  2LXH C;  2L80 A;  2CT2 A;  2KU3 A;  4FIP A;  4O64 A;  2VP7 A;  3LRQ A;  4FJC A;  4Q6F A;  2K17 A;  3HTK C;  3RPG C;  2F6J A;  5LCW B;  5DKA A;  3HCT A;  2ECT A;  1WEU A;  2VNF A;  1Z60 A;  5H1T A;  2MT5 A;  5KH3 A;  1JM7 B;  1WEW A;  2VPB A;  3ZPV 1;  3EB6 A;  2JMD A;  2G6Q A;  4WA6 A;  1XWH A;  3N9O A;  2LGV A;  4ZDT A;  3ASL A;  1E4U A;  4YBS A;  3IHP A;  4MSX A;  2ECN A;  3LQH A;  4AYC B;  5JG6 A;  4B7Y C;  3ZPV E;  1WEV A;  5G0F A;  3C6W A;  4V3L C;  5LKX A;  2YQL A;  1JM7 A;  3PUQ A;  4L58 A;  2HDP A;  2E6R A;  1LDJ B;  3I2D A;  3GV4 A;  2FUU A;  4GNG A;  2HYE D;  4R2Y A;  2KWO A;  3T7L A;  5TDW A;  2Y1N A;  2VPG A;  2ECV A;  2KR4 A;  3DPL R;  3ZNI A;  3O7A A;  2RSD A;  4TKP B;  4LKA A;  2G45 A;  3SOX A;  3QZV A;  2MA6 A;  5B79 A;  3M62 A;  2LQ6 A;  4PTB A;  4IC2 A;  5D1M B;  2G43 A;  4WZ0 A;  2K16 A;  1FBV A;  4ZUX U;  3O35 A;  3M63 A;  5B75 A;  3O34 A;  1Z6U A;  1ZBD B;  3GL6 A;  3ZTG A;  2K1J A;  5AIT A;  2KFT A;  4AVX A;  2QJ0 A;  3N9N A;  4BBQ A;  1JOC A;  2LN0 A;  3U5P A;  2FUI A;  5LKU A;  3ZVZ B;  3NG2 A;  2FSA A;  2H0D A;  1FP0 A;  3L11 A;  1WEQ A;  1HYI A;  4YAB A;  3N9P A;  2L43 A;  5B78 A;  3PUR A;  4YAD A;  3O70 A;  3ZYQ A;  2VJE A;  4R7E A;  3KQI A;  4A4B A;  2ECJ A;  1CHC A;  3U5O A;  2QIZ A;  1HYJ A;  1DVP A;  4QF3 A;  4N3W A;  4I7C A;  2PUY A;  3MHH A;  4FO9 A;  1VFY A;  2AN6 A;  2VJF B;  4CA1 A;  2CSY A;  1BOR A;  4AUQ B;  1WIL A;  3EB5 A;  5C11 A;  1WEM A;  2JRJ A;  2Y43 A;  4GND A;  1WEN A;  4UI9 B;  4PPE A;  2YRE A;  4BHW A;  4C9Z A;  1WE9 A;  2YT5 A;  5B77 A;  4FK5 A;  2YW8 A;  4GNE A;  5TDR A;  4W4U A;  3O36 A;  4IC3 A;  1X4I A;  2IDA A;  4ZQL A;  4I7B A;  5I3L A;  4S3O B;  1WEE A;  5B76 A;  4LAD B;  2MUM A;  2YSM A;  5G04 B;  4A49 A;  3RTR B;  3MHS A;  3LQI A;  2JMJ A;  2VJE B;  2LRI C;  1IYM A;  2ECW A;  4X3G A;  2M3H A;  4GB0 A;  3V43 A;  3LQJ A;  3RPG B;  5DIN A;  5LKT A;  5TAB A;  2C2L A;  4S3O C;  2LDR A;  1V87 A;  2EOD A;  1WES A;  4XI1 A;  1WFK A;  2LV9 A;  5FB1 A;  4P5O B;  2YHO A;  3SOW A;  4A4C A;  5LKZ A;  4YBT A;  1WGM A;  2Y1M A;  2MD7 B;  1WIM A;  2MIQ A;  3SHB A;  2JMI A;  2ECG A;  4YC9 A;  5FEY A;  2MNY A;  3KV5 A;  5D1K B;  1VYX A;  3HCU A;  2RI7 A;  2VPD A;  2ECI A;  2MNZ A;  1X4J A;  2F42 A;  2YSJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...