1Z2QA

High-resolution solution structure of the lm5-1 fyve domain from leishmania major
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
84
structure length
84
Chain Sequence
b'GPLGSMGEKQSKGYWQEDEDAPACNGCGCVFTTTVRRHHCRNCGYVLCGDCSRHRAAIPMRGITEPERVCDACYLALRSSNMAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LM5-1
publication title A high-resolution solution structure of a trypanosomatid FYVE domain.
pubmed doi rcsb
source organism Leishmania major
molecule tags Membrane protein
total genus 7
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2005-03-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1z2qA00
3LQIA 5LKXA 2L5UA 2QJ0A 3HTKC 4YABA 4Q6FA 5LCWB 5G05B 5TBNA 3O37A 2MIQA 2YU4A 2ECGA 2PUYA 4GNGA 2F6NA 4CA1A 2Y1NA 2FUUA 2K17A 4R8PK 3T7LA 1WEOA 5H9MA 5B8DA 5G0FA 3RTRB 2H0DA 4BHWA 2VPBA 2Y43A 2VJEA 1WEQA 3PURA 1JM7B 2ZETC 4FO9A 3ZPVE 3O34A 2UZGA 5KH7A 4YAXA 4FJCA 2ECNA 2DX8A 4NN2A 1X4IA 2LRIC 3QZVA 4A49A 2LGGA 5J3XA 2YSJA 3L1ZB 1WGMA 4P5OB 2CSYA 3ZYQA 1N87A 5KH9A 2JRJA 2QICA 4AYCB 4ZQLA 3EB5A 4L7XA 3ZPV1 5LKZA 2KE1A 2MA5A 2YQMA 4WZ2A 5LKUA 2M85A 5H1VA 2BAYA 4LLBA 1WILA 4YBTA 1VYXA 2VPGA 5FB1A 3ZTGA 5B75A 2HYED 5H1UA 2YREA 2LXHC 1CHCA 3U5PA 1E4UA 2YQLA 3FL2A 4YBMA 5B77A 1FP0A 3ZVZB 4QF3A 3N9MA 2YSMA 4R7EA 2E6RA 5C11A 4YADA 3VK6A 2RI7A 2CKLB 3O70A 4UI9B 1Z2QA 3U5NA 1WEPA 2KGGA 1WEWA 2K1JA 1WENA 2HDPA 2MUMA 1V87A 5I3LA 4I7DA 4FK5A 5TRBA 3GL6A 3M99A 5D1KB 2LGLA 3N9QA 2EODA 2K4DA 2XEUA 2KWNA 2VJFA 3M63A 2LDRA 4CCGX 1VFYA 3U5MA 1X4JA 3SOWA 2F6JA 2L80A 4F52B 1HYIA 4GNDA 2MNYA 1XWHA 2L0BA 2MD7B 5FB0A 1WEMA 5D1LB 2ECIA 4XI1A 1LDJB 2G6QA 2C2LA 1WFKA 4N3WA 5TABA 5AIUA 4LK9A 5B76A 2PNXA 2LQ6A 5EYAF 5FERA 3MHSA 4GNFA 4I7CA 3KQIA 1RMDA 1MM3A 4QF2A 3LQHA 5FEYA 4S3OC 3O35A 4V3LC 2YW8A 2YUCA 2YT5A 4AUQB 4IC3A 4AP4A 2F42A 2KREA 1IYMA 4S3OB 4A0CD 4ZUXU 2M6MA 2VNFA 3N9PA 2L75A 3NG2A 1JM7A 1VD4A 3M62A 4B86C 2QIZA 4ZDTA 4WZ0A 2VP7A 4PPEA 4X3GA 2FUIA 3ASLA 3U5OA 2RSDA 2MA6A 4AVXA 1JOCA 1Z60A 1WEVA 4N4FA 2MNZA 2ECJA 3EB6A 3KV5A 2LN0A 1Z6UA 3L11A 4AYCA 2JMDA 4YATA 2IDAA 3C6WA 2NAAA 2KYUA 1WEUA 1K2FA 2Y1MA 2H0DB 4IC2A 2ECVA 2YHNA 3GV4A 2CSZA 2FSAA 5TDWA 5H1TA 1FBVA 4A4CA 3N9OA 4GNEA 4UP0A 4WA6A 3O33A 4FIPA 3DQVR 2I50A 2KFTA 4L58A 4W4UA 3HCUA 5D1MB 5KH3A 5TDRA 3HCTA 4YC9A 2CKLA 4C9ZA 2D8SA 1X4UA 2KR4A 3SOUA 2XB1A 3L1XA 2M1RA 5B78A 1F62A 2M3HA 4B7YC 1MM2A 1WE9A 2G45A 1U6GB 1WIMA 3LQJA 4I7BA 3SOXA 3MHHA 2LGVA 2EA6A 1DVPA 1HYJA 4LADB 4YBSA 3RPGC 2LV9A 2EGPA 3LRQA 3HCSA 2LGKA 2YHOA 3N9LA 4PTBA 4LJNA 3RPGB 2YYRA 2KWJA 2VPDA 5DINA 1T1HA 3O36A 2C2VS 4MVTA 1WEEA 2E6SA 2ECWA 3V43A 2KIZA 2K16A 5JG6A 1ZBDB 2VJFB 2KU3A 2KGIA 5AITA 4TKPB 2MD8C 4R2YA 4V3KC 3O7AA 2AN6A 3T6RA 5LKTA 2OXQC 3PHDA 3KNVA 1BORA 5B79A 1LDKC 3ZVYA 2YURA 3IHPA 4BBQA 2MT5A 2JMIA 3KV6A 3DPLR 4WZ3B 1G25A 2CT2A 2VPEA 5G04B 2ECTA 4LKAA 3C5KA 5C13A 2JMJA 4O64A 2L43A 5DKAA 4GB0A 2KWKA 2VJEB 3N9NA 2KWOA 3ZNIA 2LXPC 4A4BA 1WESA 3PUQA 4MSXA 3SHBA 2G43A 4UP5A 3I2DA
chains in the Genus database with same CATH superfamily
3LQIA 5LKXA 2L5UA 4Z0OA 2QJ0A 3HTKC 4YABA 4Q6FA 2KKXA 4OGEA 5LCWB 5G05B 5TBNA 3O37A 3O47A 2MIQA 2YU4A 3Q1DA 2ECGA 2PUYA 4GNGA 2F6NA 4CA1A 4OGCA 2Y1NA 2FUUA 2K17A 4R8PK 3T7LA 1WEOA 5H9MA 5B8DA 3SUBA 5G0FA 3RTRB 2H0DA 4BHWA 2P57A 2VPBA 2Y43A 2VJEA 3FAOA 1WEQA 3PURA 4QQ4A 1JM7B 2ZETC 3LJUX 4FO9A 3ZPVE 3O34A 2UZGA 5KH7A 4YAXA 4FJCA 2ECNA 2DX8A 4NN2A 1X4IA 2LRIC 3QZVA 4A49A 2LGGA 2YSJA 5J3XA 3L1ZB 1WGMA 4P5OB 2CSYA 3ZYQA 1N87A 5KH9A 2JRJA 2QICA 4AYCB 4ZQLA 3EB5A 4L7XA 3ZPV1 5LKZA 2RR4A 2KE1A 2MA5A 2YQMA 4WZ2A 5LKUA 2M85A 5H1VA 2BAYA 4LLBA 1WILA 4YBTA 1VYXA 2VPGA 2XOZA 5FB1A 3ZTGA 5B75A 2HYED 5H1UA 2YREA 2LXHC 2CSVA 1CHCA 3U5PA 1E4UA 2YQLA 3FL2A 4YBMA 5B77A 1FP0A 3ZVZB 4QF3A 3N9MA 5SVYA 2YSMA 4R7EA 2E6RA 3DDTA 5C11A 4YADA 3VK6A 2RI7A 2CKLB 3O70A 4UI9B 1Z2QA 3U5NA 1WEPA 2KGGA 1WEWA 2K1JA 1WENA 2HDPA 3E2DA 2MUMA 2E61A 1V87A 5I3LA 4I7DA 4FK5A 5TRBA 3GL6A 3M99A 5D1KB 3LVRE 2LGLA 3N9QA 2EODA 2K4DA 2XEUA 2KWNA 2VJFA 2IQJA 3M63A 2LDRA 2OWAA 4CCGX 1VFYA 3U5MA 1X4JA 2KKYA 3SOWA 2F6JA 2L80A 4F52B 1HYIA 4GNDA 2MNYA 1XWHA 2L0BA 2MD7B 5FB0A 1WEMA 2FFWA 5D1LB 2ECIA 2XOYA 4XI1A 1LDJB 2B0OE 2G6QA 2C2LA 1WFKA 4N3WA 5TABA 5AIUA 4LK9A 1DCQA 2DJAA 5B76A 2PNXA 2LQ6A 5EYAF 5FERA 3MHSA 4GNFA 4I7CA 3KQIA 1RMDA 1MM3A 4QF2A 3LQHA 5FEYA 3FM8C 3T9KA 4S3OC 3O35A 4V3LC 2YW8A 2YUCA 2DSMA 2YT5A 4AUQB 4IC3A 4AP4A 2JM3A 2F42A 2KREA 1IYMA 4S3OB 4A0CD 4ZUXU 2M6MA 2VNFA 3N9PA 3FANA 2L75A 3NG2A 1JM7A 1VD4A 3M62A 5SVIB 4B86C 2QIZA 4ZDTA 4WZ0A 4F1PA 2VP7A 4PPEA 4X3GA 2FUIA 3ASLA 3U5OA 2LAUA 2RSDA 2MA6A 4AVXA 1JOCA 2MKEA 1Z60A 2XP0A 1WEVA 4N4FA 2MNZA 2ECJA 3EB6A 3KV5A 2LN0A 1Z6UA 3L11A 4AYCA 2JMDA 4YATA 2IDAA 3C6WA 2NAAA 4O62A 2JUNA 2KYUA 1WEUA 1K2FA 2Y1MA 2H0DB 4IC2A 2ECVA 2YHNA 3GV4A 2CSZA 2FSAA 5TDWA 5H1TA 1FBVA 5K3QA 4A4CA 3N9OA 4GNEA 4UP0A 5SVIA 4WA6A 3O33A 4FIPA 3DQVR 2YVRA 2I50A 2KFTA 4L58A 4W4UA 3HCUA 2XOCA 5D1MB 5KH3A 5TDRA 3HCTA 4YC9A 2CKLA 4C9ZA 2D8SA 1X4UA 2KR4A 2EXUA 3SOUA 2XB1A 3L1XA 1MBMA 2M1RA 5B78A 3LVQE 3MDBC 1F62A 2M3HA 3KDEC 4B7YC 1MM2A 1WE9A 2G45A 1U6GB 1WIMA 3LQJA 4I7BA 2L7PA 3MHHA 3SOXA 2LGVA 3H7HA 2EA6A 2M13A 1DVPA 3PLWA 1HYJA 4LADB 3M7KA 4YBSA 3RPGC 3JUEA 2LV9A 2EGPA 3LRQA 3HCSA 2LGKA 5SVXA 2YHOA 3N9LA 4PTBA 4LJNA 3RPGB 2CONA 2CRWA 2YYRA 4Z0RA 2KWJA 2VPDA 5DINA 1T1HA 3O36A 2C2VS 4MVTA 1WEEA 4H9DA 2E6SA 2ECWA 3V43A 2KIZA 2K16A 5JG6A 1ZBDB 2VJFB 2KU3A 2KGIA 5AITA 4TKPB 2MD8C 2CRRA 4R2YA 4V3KC 3O7AA 3DWDA 2AN6A 3T6RA 5LKTA 2OXQC 3PHDA 3KNVA 1BORA 5B79A 1LDKC 3ZVYA 2YURA 3IHPA 3FEHA 4BBQA 2MT5A 2JMIA 3KV6A 3DPLR 4WZ3B 1G25A 2FD4A 2CT2A 2VPEA 5G04B 2ECTA 4LKAA 3C5KA 5C13A 2JMJA 4O64A 2L43A 5DKAA 4GB0A 2KWKA 2VJEB 3N9NA 2KWOA 3ZNIA 2LXPC 4A4BA 1WESA 3PUQA 4MSXA 2EGMA 3SHBA 2G43A 4UP5A 3LDYA 2D8UA 3I2DA 3FJUB
chains in the Genus database with same CATH topology
3LQIA 5LKXA 2L5UA 2QJ0A 3HTKC 4YABA 4Q6FA 5LCWB 5G05B 5TBNA 3O37A 2MIQA 2YU4A 2ECGA 2PUYA 4GNGA 2F6NA 4CA1A 2Y1NA 2FUUA 2K17A 4R8PK 3T7LA 1WEOA 5H9MA 5B8DA 5G0FA 3RTRB 2H0DA 4BHWA 2VPBA 2Y43A 2VJEA 1WEQA 3PURA 1JM7B 2ZETC 4FO9A 3ZPVE 3O34A 2UZGA 5KH7A 4YAXA 4FJCA 2ECNA 2DX8A 4NN2A 1X4IA 2LRIC 3QZVA 4A49A 2LGGA 5J3XA 2YSJA 3L1ZB 1WGMA 4P5OB 2CSYA 3ZYQA 1N87A 5KH9A 2JRJA 2QICA 4AYCB 4ZQLA 3EB5A 4L7XA 3ZPV1 5LKZA 2KE1A 2MA5A 2YQMA 4WZ2A 5LKUA 2M85A 5H1VA 2BAYA 4LLBA 1WILA 4YBTA 1VYXA 2VPGA 5FB1A 3ZTGA 5B75A 2HYED 5H1UA 2YREA 2LXHC 1CHCA 3U5PA 1E4UA 2YQLA 3FL2A 4YBMA 5B77A 1FP0A 3ZVZB 4QF3A 3N9MA 2YSMA 4R7EA 2E6RA 5C11A 4YADA 3VK6A 2RI7A 2CKLB 3O70A 4UI9B 1Z2QA 3U5NA 1WEPA 2KGGA 1WEWA 2K1JA 1WENA 2HDPA 2MUMA 1V87A 5I3LA 4I7DA 4FK5A 5TRBA 3GL6A 3M99A 5D1KB 2LGLA 3N9QA 2EODA 2K4DA 2XEUA 2KWNA 2VJFA 3M63A 2LDRA 4CCGX 1VFYA 3U5MA 1X4JA 3SOWA 2F6JA 2L80A 4F52B 1HYIA 4GNDA 2MNYA 1XWHA 2L0BA 2MD7B 5FB0A 1WEMA 5D1LB 2ECIA 4XI1A 1LDJB 2G6QA 2C2LA 1WFKA 4N3WA 5TABA 5AIUA 4LK9A 5B76A 2PNXA 2LQ6A 5EYAF 5FERA 3MHSA 4GNFA 4I7CA 3KQIA 1RMDA 1MM3A 4QF2A 3LQHA 5FEYA 4S3OC 3O35A 4V3LC 2YW8A 2YUCA 2YT5A 4AUQB 4IC3A 4AP4A 2F42A 2KREA 1IYMA 4S3OB 4A0CD 4ZUXU 2M6MA 2VNFA 3N9PA 2L75A 3NG2A 1JM7A 1VD4A 3M62A 4B86C 2QIZA 4ZDTA 4WZ0A 2VP7A 4PPEA 4X3GA 2FUIA 3ASLA 3U5OA 2RSDA 2MA6A 4AVXA 1JOCA 1Z60A 1WEVA 4N4FA 2MNZA 2ECJA 3EB6A 3KV5A 2LN0A 1Z6UA 3L11A 4AYCA 2JMDA 4YATA 2IDAA 3C6WA 2NAAA 2KYUA 1WEUA 1K2FA 2Y1MA 2H0DB 4IC2A 2ECVA 2YHNA 3GV4A 2CSZA 2FSAA 5TDWA 5H1TA 1FBVA 4A4CA 3N9OA 4GNEA 4UP0A 4WA6A 3O33A 4FIPA 3DQVR 2I50A 2KFTA 4L58A 4W4UA 3HCUA 5D1MB 5KH3A 5TDRA 3HCTA 4YC9A 2CKLA 4C9ZA 2D8SA 1X4UA 2KR4A 3SOUA 2XB1A 3L1XA 2M1RA 5B78A 1F62A 2M3HA 4B7YC 1MM2A 1WE9A 2G45A 1U6GB 1WIMA 3LQJA 4I7BA 3SOXA 3MHHA 2LGVA 2EA6A 1DVPA 1HYJA 4LADB 4YBSA 3RPGC 2LV9A 2EGPA 3LRQA 3HCSA 2LGKA 2YHOA 3N9LA 4PTBA 4LJNA 3RPGB 2YYRA 2KWJA 2VPDA 5DINA 1T1HA 3O36A 2C2VS 4MVTA 1WEEA 2E6SA 2ECWA 3V43A 2KIZA 2K16A 5JG6A 1ZBDB 2VJFB 2KU3A 2KGIA 5AITA 4TKPB 2MD8C 4R2YA 4V3KC 3O7AA 2AN6A 3T6RA 5LKTA 2OXQC 3PHDA 3KNVA 1BORA 5B79A 1LDKC 3ZVYA 2YURA 3IHPA 4BBQA 2MT5A 2JMIA 3KV6A 3DPLR 4WZ3B 1G25A 2CT2A 2VPEA 5G04B 2ECTA 4LKAA 3C5KA 5C13A 2JMJA 4O64A 2L43A 5DKAA 4GB0A 2KWKA 2VJEB 3N9NA 2KWOA 3ZNIA 2LXPC 4A4BA 1WESA 3PUQA 4MSXA 3SHBA 2G43A 4UP5A 3I2DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LQI A;  5LKX A;  2L5U A;  2QJ0 A;  3HTK C;  4YAB A;  4Q6F A;  5LCW B;  5G05 B;  5TBN A;  3O37 A;  2MIQ A;  2YU4 A;  2ECG A;  2PUY A;  4GNG A;  2F6N A;  4CA1 A;  2Y1N A;  2FUU A;  2K17 A;  4R8P K;  3T7L A;  1WEO A;  5H9M A;  5B8D A;  5G0F A;  3RTR B;  2H0D A;  4BHW A;  2VPB A;  2Y43 A;  2VJE A;  1WEQ A;  3PUR A;  1JM7 B;  2ZET C;  4FO9 A;  3ZPV E;  3O34 A;  2UZG A;  5KH7 A;  4YAX A;  4FJC A;  2ECN A;  2DX8 A;  4NN2 A;  1X4I A;  2LRI C;  3QZV A;  4A49 A;  2LGG A;  5J3X A;  2YSJ A;  3L1Z B;  1WGM A;  4P5O B;  2CSY A;  3ZYQ A;  1N87 A;  5KH9 A;  2JRJ A;  2QIC A;  4AYC B;  4ZQL A;  3EB5 A;  4L7X A;  3ZPV 1;  5LKZ A;  2KE1 A;  2MA5 A;  2YQM A;  4WZ2 A;  5LKU A;  2M85 A;  5H1V A;  2BAY A;  4LLB A;  1WIL A;  4YBT A;  1VYX A;  2VPG A;  5FB1 A;  3ZTG A;  5B75 A;  2HYE D;  5H1U A;  2YRE A;  2LXH C;  1CHC A;  3U5P A;  1E4U A;  2YQL A;  3FL2 A;  4YBM A;  5B77 A;  1FP0 A;  3ZVZ B;  4QF3 A;  3N9M A;  2YSM A;  4R7E A;  2E6R A;  5C11 A;  4YAD A;  3VK6 A;  2RI7 A;  2CKL B;  3O70 A;  4UI9 B;  1Z2Q A;  3U5N A;  1WEP A;  2KGG A;  1WEW A;  2K1J A;  1WEN A;  2HDP A;  2MUM A;  1V87 A;  5I3L A;  4I7D A;  4FK5 A;  5TRB A;  3GL6 A;  3M99 A;  5D1K B;  2LGL A;  3N9Q A;  2EOD A;  2K4D A;  2XEU A;  2KWN A;  2VJF A;  3M63 A;  2LDR A;  4CCG X;  1VFY A;  3U5M A;  1X4J A;  3SOW A;  2F6J A;  2L80 A;  4F52 B;  1HYI A;  4GND A;  2MNY A;  1XWH A;  2L0B A;  2MD7 B;  5FB0 A;  1WEM A;  5D1L B;  2ECI A;  4XI1 A;  1LDJ B;  2G6Q A;  2C2L A;  1WFK A;  4N3W A;  5TAB A;  5AIU A;  4LK9 A;  5B76 A;  2PNX A;  2LQ6 A;  5EYA F;  5FER A;  3MHS A;  4GNF A;  4I7C A;  3KQI A;  1RMD A;  1MM3 A;  4QF2 A;  3LQH A;  5FEY A;  4S3O C;  3O35 A;  4V3L C;  2YW8 A;  2YUC A;  2YT5 A;  4AUQ B;  4IC3 A;  4AP4 A;  2F42 A;  2KRE A;  1IYM A;  4S3O B;  4A0C D;  4ZUX U;  2M6M A;  2VNF A;  3N9P A;  2L75 A;  3NG2 A;  1JM7 A;  1VD4 A;  3M62 A;  4B86 C;  2QIZ A;  4ZDT A;  4WZ0 A;  2VP7 A;  4PPE A;  4X3G A;  2FUI A;  3ASL A;  3U5O A;  2RSD A;  2MA6 A;  4AVX A;  1JOC A;  1Z60 A;  1WEV A;  4N4F A;  2MNZ A;  2ECJ A;  3EB6 A;  3KV5 A;  2LN0 A;  1Z6U A;  3L11 A;  4AYC A;  2JMD A;  4YAT A;  2IDA A;  3C6W A;  2NAA A;  2KYU A;  1WEU A;  1K2F A;  2Y1M A;  2H0D B;  4IC2 A;  2ECV A;  2YHN A;  3GV4 A;  2CSZ A;  2FSA A;  5TDW A;  5H1T A;  1FBV A;  4A4C A;  3N9O A;  4GNE A;  4UP0 A;  4WA6 A;  3O33 A;  4FIP A;  3DQV R;  2I50 A;  2KFT A;  4L58 A;  4W4U A;  3HCU A;  5D1M B;  5KH3 A;  5TDR A;  3HCT A;  4YC9 A;  2CKL A;  4C9Z A;  2D8S A;  1X4U A;  2KR4 A;  3SOU A;  2XB1 A;  3L1X A;  2M1R A;  5B78 A;  1F62 A;  2M3H A;  4B7Y C;  1MM2 A;  1WE9 A;  2G45 A;  1U6G B;  1WIM A;  3LQJ A;  4I7B A;  3SOX A;  3MHH A;  2LGV A;  2EA6 A;  1DVP A;  1HYJ A;  4LAD B;  4YBS A;  3RPG C;  2LV9 A;  2EGP A;  3LRQ A;  3HCS A;  2LGK A;  2YHO A;  3N9L A;  4PTB A;  4LJN A;  3RPG B;  2YYR A;  2KWJ A;  2VPD A;  5DIN A;  1T1H A;  3O36 A;  2C2V S;  4MVT A;  1WEE A;  2E6S A;  2ECW A;  3V43 A;  2KIZ A;  2K16 A;  5JG6 A;  1ZBD B;  2VJF B;  2KU3 A;  2KGI A;  5AIT A;  4TKP B;  2MD8 C;  4R2Y A;  4V3K C;  3O7A A;  2AN6 A;  3T6R A;  5LKT A;  2OXQ C;  3PHD A;  3KNV A;  1BOR A;  5B79 A;  1LDK C;  3ZVY A;  2YUR A;  3IHP A;  4BBQ A;  2MT5 A;  2JMI A;  3KV6 A;  3DPL R;  4WZ3 B;  1G25 A;  2CT2 A;  2VPE A;  5G04 B;  2ECT A;  4LKA A;  3C5K A;  5C13 A;  2JMJ A;  4O64 A;  2L43 A;  5DKA A;  4GB0 A;  2KWK A;  2VJE B;  3N9N A;  2KWO A;  3ZNI A;  2LXP C;  4A4B A;  1WES A;  3PUQ A;  4MSX A;  3SHB A;  2G43 A;  4UP5 A;  3I2D A; 
#chains in the Genus database with same CATH topology
 3LQI A;  5LKX A;  2L5U A;  4Z0O A;  2QJ0 A;  3HTK C;  4YAB A;  4Q6F A;  2KKX A;  4OGE A;  5LCW B;  5G05 B;  5TBN A;  3O37 A;  3O47 A;  2MIQ A;  2YU4 A;  3Q1D A;  2ECG A;  2PUY A;  4GNG A;  2F6N A;  4CA1 A;  4OGC A;  2Y1N A;  2FUU A;  2K17 A;  4R8P K;  3T7L A;  1WEO A;  5H9M A;  5B8D A;  3SUB A;  5G0F A;  3RTR B;  2H0D A;  4BHW A;  2P57 A;  2VPB A;  2Y43 A;  2VJE A;  3FAO A;  1WEQ A;  3PUR A;  4QQ4 A;  1JM7 B;  2ZET C;  3LJU X;  4FO9 A;  3ZPV E;  3O34 A;  2UZG A;  5KH7 A;  4YAX A;  4FJC A;  2ECN A;  2DX8 A;  4NN2 A;  1X4I A;  2LRI C;  3QZV A;  4A49 A;  2LGG A;  2YSJ A;  5J3X A;  3L1Z B;  1WGM A;  4P5O B;  2CSY A;  3ZYQ A;  1N87 A;  5KH9 A;  2JRJ A;  2QIC A;  4AYC B;  4ZQL A;  3EB5 A;  4L7X A;  3ZPV 1;  5LKZ A;  2RR4 A;  2KE1 A;  2MA5 A;  2YQM A;  4WZ2 A;  5LKU A;  2M85 A;  5H1V A;  2BAY A;  4LLB A;  1WIL A;  4YBT A;  1VYX A;  2VPG A;  2XOZ A;  5FB1 A;  3ZTG A;  5B75 A;  2HYE D;  5H1U A;  2YRE A;  2LXH C;  2CSV A;  1CHC A;  3U5P A;  1E4U A;  2YQL A;  3FL2 A;  4YBM A;  5B77 A;  1FP0 A;  3ZVZ B;  4QF3 A;  3N9M A;  5SVY A;  2YSM A;  4R7E A;  2E6R A;  3DDT A;  5C11 A;  4YAD A;  3VK6 A;  2RI7 A;  2CKL B;  3O70 A;  4UI9 B;  1Z2Q A;  3U5N A;  1WEP A;  2KGG A;  1WEW A;  2K1J A;  1WEN A;  2HDP A;  3E2D A;  2MUM A;  2E61 A;  1V87 A;  5I3L A;  4I7D A;  4FK5 A;  5TRB A;  3GL6 A;  3M99 A;  5D1K B;  3LVR E;  2LGL A;  3N9Q A;  2EOD A;  2K4D A;  2XEU A;  2KWN A;  2VJF A;  2IQJ A;  3M63 A;  2LDR A;  2OWA A;  4CCG X;  1VFY A;  3U5M A;  1X4J A;  2KKY A;  3SOW A;  2F6J A;  2L80 A;  4F52 B;  1HYI A;  4GND A;  2MNY A;  1XWH A;  2L0B A;  2MD7 B;  5FB0 A;  1WEM A;  2FFW A;  5D1L B;  2ECI A;  2XOY A;  4XI1 A;  1LDJ B;  2B0O E;  2G6Q A;  2C2L A;  1WFK A;  4N3W A;  5TAB A;  5AIU A;  4LK9 A;  1DCQ A;  2DJA A;  5B76 A;  2PNX A;  2LQ6 A;  5EYA F;  5FER A;  3MHS A;  4GNF A;  4I7C A;  3KQI A;  1RMD A;  1MM3 A;  4QF2 A;  3LQH A;  5FEY A;  3FM8 C;  3T9K A;  4S3O C;  3O35 A;  4V3L C;  2YW8 A;  2YUC A;  2DSM A;  2YT5 A;  4AUQ B;  4IC3 A;  4AP4 A;  2JM3 A;  2F42 A;  2KRE A;  1IYM A;  4S3O B;  4A0C D;  4ZUX U;  2M6M A;  2VNF A;  3N9P A;  3FAN A;  2L75 A;  3NG2 A;  1JM7 A;  1VD4 A;  3M62 A;  5SVI B;  4B86 C;  2QIZ A;  4ZDT A;  4WZ0 A;  4F1P A;  2VP7 A;  4PPE A;  4X3G A;  2FUI A;  3ASL A;  3U5O A;  2LAU A;  2RSD A;  2MA6 A;  4AVX A;  1JOC A;  2MKE A;  1Z60 A;  2XP0 A;  1WEV A;  4N4F A;  2MNZ A;  2ECJ A;  3EB6 A;  3KV5 A;  2LN0 A;  1Z6U A;  3L11 A;  4AYC A;  2JMD A;  4YAT A;  2IDA A;  3C6W A;  2NAA A;  4O62 A;  2JUN A;  2KYU A;  1WEU A;  1K2F A;  2Y1M A;  2H0D B;  4IC2 A;  2ECV A;  2YHN A;  3GV4 A;  2CSZ A;  2FSA A;  5TDW A;  5H1T A;  1FBV A;  5K3Q A;  4A4C A;  3N9O A;  4GNE A;  4UP0 A;  5SVI A;  4WA6 A;  3O33 A;  4FIP A;  3DQV R;  2YVR A;  2I50 A;  2KFT A;  4L58 A;  4W4U A;  3HCU A;  2XOC A;  5D1M B;  5KH3 A;  5TDR A;  3HCT A;  4YC9 A;  2CKL A;  4C9Z A;  2D8S A;  1X4U A;  2KR4 A;  2EXU A;  3SOU A;  2XB1 A;  3L1X A;  1MBM A;  2M1R A;  5B78 A;  3LVQ E;  3MDB C;  1F62 A;  2M3H A;  3KDE C;  4B7Y C;  1MM2 A;  1WE9 A;  2G45 A;  1U6G B;  1WIM A;  3LQJ A;  4I7B A;  2L7P A;  3MHH A;  3SOX A;  2LGV A;  3H7H A;  2EA6 A;  2M13 A;  1DVP A;  3PLW A;  1HYJ A;  4LAD B;  3M7K A;  4YBS A;  3RPG C;  3JUE A;  2LV9 A;  2EGP A;  3LRQ A;  3HCS A;  2LGK A;  5SVX A;  2YHO A;  3N9L A;  4PTB A;  4LJN A;  3RPG B;  2CON A;  2CRW A;  2YYR A;  4Z0R A;  2KWJ A;  2VPD A;  5DIN A;  1T1H A;  3O36 A;  2C2V S;  4MVT A;  1WEE A;  4H9D A;  2E6S A;  2ECW A;  3V43 A;  2KIZ A;  2K16 A;  5JG6 A;  1ZBD B;  2VJF B;  2KU3 A;  2KGI A;  5AIT A;  4TKP B;  2MD8 C;  2CRR A;  4R2Y A;  4V3K C;  3O7A A;  3DWD A;  2AN6 A;  3T6R A;  5LKT A;  2OXQ C;  3PHD A;  3KNV A;  1BOR A;  5B79 A;  1LDK C;  3ZVY A;  2YUR A;  3IHP A;  3FEH A;  4BBQ A;  2MT5 A;  2JMI A;  3KV6 A;  3DPL R;  4WZ3 B;  1G25 A;  2FD4 A;  2CT2 A;  2VPE A;  5G04 B;  2ECT A;  4LKA A;  3C5K A;  5C13 A;  2JMJ A;  4O64 A;  2L43 A;  5DKA A;  4GB0 A;  2KWK A;  2VJE B;  3N9N A;  2KWO A;  3ZNI A;  2LXP C;  4A4B A;  1WES A;  3PUQ A;  4MSX A;  2EGM A;  3SHB A;  2G43 A;  4UP5 A;  3LDY A;  2D8U A;  3I2D A;  3FJU B; 
#chains in the Genus database with same CATH homology
 3LQI A;  5LKX A;  2L5U A;  2QJ0 A;  3HTK C;  4YAB A;  4Q6F A;  5LCW B;  5G05 B;  5TBN A;  3O37 A;  2MIQ A;  2YU4 A;  2ECG A;  2PUY A;  4GNG A;  2F6N A;  4CA1 A;  2Y1N A;  2FUU A;  2K17 A;  4R8P K;  3T7L A;  1WEO A;  5H9M A;  5B8D A;  5G0F A;  3RTR B;  2H0D A;  4BHW A;  2VPB A;  2Y43 A;  2VJE A;  1WEQ A;  3PUR A;  1JM7 B;  2ZET C;  4FO9 A;  3ZPV E;  3O34 A;  2UZG A;  5KH7 A;  4YAX A;  4FJC A;  2ECN A;  2DX8 A;  4NN2 A;  1X4I A;  2LRI C;  3QZV A;  4A49 A;  2LGG A;  5J3X A;  2YSJ A;  3L1Z B;  1WGM A;  4P5O B;  2CSY A;  3ZYQ A;  1N87 A;  5KH9 A;  2JRJ A;  2QIC A;  4AYC B;  4ZQL A;  3EB5 A;  4L7X A;  3ZPV 1;  5LKZ A;  2KE1 A;  2MA5 A;  2YQM A;  4WZ2 A;  5LKU A;  2M85 A;  5H1V A;  2BAY A;  4LLB A;  1WIL A;  4YBT A;  1VYX A;  2VPG A;  5FB1 A;  3ZTG A;  5B75 A;  2HYE D;  5H1U A;  2YRE A;  2LXH C;  1CHC A;  3U5P A;  1E4U A;  2YQL A;  3FL2 A;  4YBM A;  5B77 A;  1FP0 A;  3ZVZ B;  4QF3 A;  3N9M A;  2YSM A;  4R7E A;  2E6R A;  5C11 A;  4YAD A;  3VK6 A;  2RI7 A;  2CKL B;  3O70 A;  4UI9 B;  1Z2Q A;  3U5N A;  1WEP A;  2KGG A;  1WEW A;  2K1J A;  1WEN A;  2HDP A;  2MUM A;  1V87 A;  5I3L A;  4I7D A;  4FK5 A;  5TRB A;  3GL6 A;  3M99 A;  5D1K B;  2LGL A;  3N9Q A;  2EOD A;  2K4D A;  2XEU A;  2KWN A;  2VJF A;  3M63 A;  2LDR A;  4CCG X;  1VFY A;  3U5M A;  1X4J A;  3SOW A;  2F6J A;  2L80 A;  4F52 B;  1HYI A;  4GND A;  2MNY A;  1XWH A;  2L0B A;  2MD7 B;  5FB0 A;  1WEM A;  5D1L B;  2ECI A;  4XI1 A;  1LDJ B;  2G6Q A;  2C2L A;  1WFK A;  4N3W A;  5TAB A;  5AIU A;  4LK9 A;  5B76 A;  2PNX A;  2LQ6 A;  5EYA F;  5FER A;  3MHS A;  4GNF A;  4I7C A;  3KQI A;  1RMD A;  1MM3 A;  4QF2 A;  3LQH A;  5FEY A;  4S3O C;  3O35 A;  4V3L C;  2YW8 A;  2YUC A;  2YT5 A;  4AUQ B;  4IC3 A;  4AP4 A;  2F42 A;  2KRE A;  1IYM A;  4S3O B;  4A0C D;  4ZUX U;  2M6M A;  2VNF A;  3N9P A;  2L75 A;  3NG2 A;  1JM7 A;  1VD4 A;  3M62 A;  4B86 C;  2QIZ A;  4ZDT A;  4WZ0 A;  2VP7 A;  4PPE A;  4X3G A;  2FUI A;  3ASL A;  3U5O A;  2RSD A;  2MA6 A;  4AVX A;  1JOC A;  1Z60 A;  1WEV A;  4N4F A;  2MNZ A;  2ECJ A;  3EB6 A;  3KV5 A;  2LN0 A;  1Z6U A;  3L11 A;  4AYC A;  2JMD A;  4YAT A;  2IDA A;  3C6W A;  2NAA A;  2KYU A;  1WEU A;  1K2F A;  2Y1M A;  2H0D B;  4IC2 A;  2ECV A;  2YHN A;  3GV4 A;  2CSZ A;  2FSA A;  5TDW A;  5H1T A;  1FBV A;  4A4C A;  3N9O A;  4GNE A;  4UP0 A;  4WA6 A;  3O33 A;  4FIP A;  3DQV R;  2I50 A;  2KFT A;  4L58 A;  4W4U A;  3HCU A;  5D1M B;  5KH3 A;  5TDR A;  3HCT A;  4YC9 A;  2CKL A;  4C9Z A;  2D8S A;  1X4U A;  2KR4 A;  3SOU A;  2XB1 A;  3L1X A;  2M1R A;  5B78 A;  1F62 A;  2M3H A;  4B7Y C;  1MM2 A;  1WE9 A;  2G45 A;  1U6G B;  1WIM A;  3LQJ A;  4I7B A;  3SOX A;  3MHH A;  2LGV A;  2EA6 A;  1DVP A;  1HYJ A;  4LAD B;  4YBS A;  3RPG C;  2LV9 A;  2EGP A;  3LRQ A;  3HCS A;  2LGK A;  2YHO A;  3N9L A;  4PTB A;  4LJN A;  3RPG B;  2YYR A;  2KWJ A;  2VPD A;  5DIN A;  1T1H A;  3O36 A;  2C2V S;  4MVT A;  1WEE A;  2E6S A;  2ECW A;  3V43 A;  2KIZ A;  2K16 A;  5JG6 A;  1ZBD B;  2VJF B;  2KU3 A;  2KGI A;  5AIT A;  4TKP B;  2MD8 C;  4R2Y A;  4V3K C;  3O7A A;  2AN6 A;  3T6R A;  5LKT A;  2OXQ C;  3PHD A;  3KNV A;  1BOR A;  5B79 A;  1LDK C;  3ZVY A;  2YUR A;  3IHP A;  4BBQ A;  2MT5 A;  2JMI A;  3KV6 A;  3DPL R;  4WZ3 B;  1G25 A;  2CT2 A;  2VPE A;  5G04 B;  2ECT A;  4LKA A;  3C5K A;  5C13 A;  2JMJ A;  4O64 A;  2L43 A;  5DKA A;  4GB0 A;  2KWK A;  2VJE B;  3N9N A;  2KWO A;  3ZNI A;  2LXP C;  4A4B A;  1WES A;  3PUQ A;  4MSX A;  3SHB A;  2G43 A;  4UP5 A;  3I2D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...