1Z2QA

High-resolution solution structure of the lm5-1 fyve domain from leishmania major
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
84
structure length
84
Chain Sequence
GPLGSMGEKQSKGYWQEDEDAPACNGCGCVFTTTVRRHHCRNCGYVLCGDCSRHRAAIPMRGITEPERVCDACYLALRSSNMAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords LM5-1
publication title A high-resolution solution structure of a trypanosomatid FYVE domain.
pubmed doi rcsb
source organism Leishmania major
total genus 7
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2005-03-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1z2qA00
4FK5A 5LKUA 5KH3A 5TDRA 4IC2A 2L43A 3M62A 5G04B 4S3OB 4AYCA 2MT5A 4GB0A 4FO9A 1WEVA 4A0CD 3L1ZB 4C9ZA 2HDPA 2IDAA 3NG2A 2VPBA 5C11A 4FJCA 1WENA 4ZQLA 3U5PA 2KWNA 3HCUA 5D1LB 3T7LA 2F42A 3N9QA 2LGVA 4YBTA 3N9NA 4IC3A 2L75A 1HYIA 2KU3A 2MA6A 2QJ0A 2KIZA 2E6RA 4UP0A 5B78A 1K2FA 2C2LA 1WEWA 2QIZA 2KE1A 2KYUA 3KNVA 1JM7B 4O64A 2AN6A 2M1RA 5DKAA 4TKPB 2L80A 1JM7A 2ECIA 3ZVYA 2LXHC 3HCSA 2LGLA 5TRBA 2YYRA 5G05B 1WEMA 1IYMA 5DINA 2JMDA 5JG6A 1FBVA 4AVXA 1X4JA 4YADA 4B7YC 3IHPA 2MD7B 4GNDA 3M99A 1LDKC 4R2YA 4GNFA 4Q6FA 1WFKA 4A4BA 1WEPA 3SHBA 3I2DA 3N9PA 4LLBA 4MVTA 1WEOA 2MNZA 3DQVR 4GNEA 2LV9A 1ZBDB 5TBNA 2YT5A 1WEEA 2MIQA 3M63A 2LXPC 5G0FA 3HCTA 2KREA 2MNYA 4UP5A 4A4CA 1BORA 2PNXA 2Y1MA 1G25A 3O33A 2KFTA 5EYAF 4ZUXU 4WZ3B 2ECTA 5TABA 3N9LA 3HTKC 2ECVA 3O34A 2DX8A 3ZVZB 3ZNIA 3EB6A 4XI1A 5C13A 1JOCA 4LJNA 3SOWA 4YBSA 1WESA 4R8PK 2JMJA 4V3KC 3RPGC 4B86C 4NN2A 4X3GA 2L0BA 2JMIA 3GL6A 2Y43A 3O35A 3FL2A 2YSJA 2LGKA 5B79A 2HYED 4PPEA 2M85A 3N9OA 3SOXA 4V3LC 1RMDA 2MA5A 4LK9A 2KWKA 5LKTA 2CKLB 2FUIA 3PURA 2F6JA 2K17A 4CA1A 1F62A 2CKLA 2YW8A 1MM3A 4YATA 2YREA 1X4UA 4CCGX 3RPGB 4AP4A 2H0DB 2EODA 4FIPA 2VJFB 4I7CA 2H0DA 2M3HA 2VPEA 4BBQA 4BHWA 5D1MB 2YHOA 2FUUA 5H1VA 2G45A 4MSXA 5B76A 4ZDTA 4YC9A 3LQIA 2C2VS 2KWOA 2M6MA 2E6SA 2ECJA 2XEUA 4I7DA 4LADB 2CSZA 4AUQB 4I7BA 2YSMA 2KWJA 1VFYA 3VK6A 3MHSA 2VNFA 5AITA 5LCWB 3PUQA 2K4DA 3QZVA 3KV6A 3SOUA 2LN0A 2MD8C 3ZTGA 4P5OB 2KGGA 5KH9A 4LKAA 4N3WA 1HYJA 2ZETC 2VP7A 1U6GB 3V43A 3ZPV1 3U5OA 2EGPA 2LGGA 4F52B 2YU4A 4AYCB 2CT2A 5J3XA 3C5KA 3LQJA 2I50A 5FB1A 1Z60A 1WIMA 4QF2A 2CSYA 5TDWA 1N87A 3DPLR 2YUCA 3L1XA 3O36A 5LKXA 3O70A 1XWHA 5H1UA 2YQMA 1X4IA 2G43A 3C6WA 2ECGA 2PUYA 4L7XA 1WE9A 1VD4A 5FERA 2VPGA 2ECWA 2RSDA 1Z2QA 3L11A 5B77A 2YHNA 1VYXA 1WEQA 2G6QA 3KV5A 2KGIA 4QF3A 2QICA 1T1HA 2D8SA 3U5MA 3LQHA 5I3LA 4N4FA 4GNGA 4WA6A 4WZ2A 3KQIA 2K16A 3O7AA 2YQLA 5B75A 3N9MA 1V87A 4PTBA 3EB5A 4WZ0A 2BAYA 5H1TA 2KR4A 3U5NA 5B8DA 1MM2A 2XB1A 2VJFA 1WEUA 3T6RA 3ZYQA 2VJEB 3PHDA 5KH7A 4YAXA 1CHCA 5FEYA 2NAAA 5D1KB 2VJEA 2F6NA 1WGMA 1FP0A 4R7EA 2JRJA 2LRIC 2VPDA 4S3OC 2EA6A 4A49A 3MHHA 4YABA 1Z6UA 2K1JA 5FB0A 5LKZA 1WILA 1LDJB 2Y1NA 3GV4A 2UZGA 3ZPVE 3LRQA 2LDRA 4L58A 4YBMA 2ECNA 3O37A 1DVPA 2YURA 2OXQC 2MUMA 2L5UA 3RTRB 2RI7A 5AIUA 1E4UA 4UI9B 2FSAA 3ASLA 2LQ6A 5H9MA 4W4UA
chains in the Genus database with same CATH superfamily
3DWDA 4FK5A 5LKUA 5KH3A 5TDRA 4IC2A 2L43A 3M62A 5G04B 4S3OB 4AYCA 2XOCA 2MT5A 2D8UA 4GB0A 4FO9A 5SVIB 1WEVA 4A0CD 3L1ZB 4C9ZA 3T9KA 5SVIA 2HDPA 2IDAA 3NG2A 2RR4A 2VPBA 5C11A 4FJCA 1WENA 4ZQLA 3U5PA 1DCQA 2KWNA 3HCUA 5D1LB 3T7LA 2L7PA 4OGEA 2F42A 3N9QA 2LGVA 4YBTA 3N9NA 5K3QA 4IC3A 2L75A 1HYIA 2KU3A 2MA6A 2QJ0A 2KIZA 2E6RA 2YVRA 5SVYA 4UP0A 5B78A 2CONA 1K2FA 2C2LA 1WEWA 2QIZA 2KE1A 2KYUA 3KNVA 2CSVA 1JM7B 4O64A 2AN6A 2M1RA 5DKAA 4TKPB 3FM8C 2L80A 1JM7A 2ECIA 3ZVYA 2LXHC 3HCSA 2LGLA 5TRBA 2YYRA 5G05B 3LDYA 1WEMA 1IYMA 5DINA 2JMDA 5JG6A 1FBVA 4AVXA 1X4JA 4YADA 4B7YC 3IHPA 2MD7B 4GNDA 3M99A 1LDKC 4R2YA 4GNFA 4Q6FA 1WFKA 4A4BA 1WEPA 3SHBA 3I2DA 3N9PA 4LLBA 4MVTA 1WEOA 3LVQE 2MNZA 3DQVR 4GNEA 4QQ4A 2LV9A 1ZBDB 5TBNA 2YT5A 1WEEA 2MIQA 3M63A 2LXPC 5G0FA 3HCTA 2KREA 2MNYA 4UP5A 4A4CA 1BORA 2PNXA 2Y1MA 1G25A 3Q1DA 3O33A 2KFTA 2JUNA 2LAUA 5EYAF 3FEHA 2KKXA 4Z0RA 4ZUXU 4WZ3B 2ECTA 3N9LA 5TABA 3HTKC 2ECVA 3O34A 2DX8A 3ZVZB 3ZNIA 3EB6A 4XI1A 5C13A 1JOCA 4LJNA 3DDTA 3SOWA 4YBSA 1WESA 4R8PK 2JMJA 4V3KC 3RPGC 4B86C 4NN2A 4X3GA 2L0BA 2JMIA 3GL6A 2Y43A 3O35A 3FL2A 2YSJA 2LGKA 2B0OE 5B79A 2HYED 4PPEA 2M85A 3N9OA 3SOXA 4V3LC 4O62A 1RMDA 2MA5A 4LK9A 2KWKA 5LKTA 2CKLB 2FUIA 3PURA 2F6JA 2K17A 4CA1A 1F62A 2CKLA 2YW8A 1MM3A 4YATA 2FD4A 2YREA 1X4UA 4CCGX 3RPGB 4AP4A 2H0DB 2EODA 3MDBC 2MKEA 4FIPA 2VJFB 4I7CA 2H0DA 2M3HA 2OWAA 2VPEA 4BBQA 4BHWA 5D1MB 2YHOA 2CRWA 2FUUA 5H1VA 2G45A 4MSXA 5B76A 4OGCA 4ZDTA 4YC9A 2CRRA 3LQIA 2C2VS 4Z0OA 2KWOA 2M6MA 2E6SA 2ECJA 2P57A 2XEUA 4I7DA 4LADB 2CSZA 3FAOA 4I7BA 2YSMA 4AUQB 2KWJA 1VFYA 3VK6A 3MHSA 2VNFA 5AITA 3PUQA 5LCWB 2K4DA 3QZVA 3KV6A 3SOUA 2LN0A 2MD8C 3E2DA 3FANA 3PLWA 3ZTGA 4P5OB 4F1PA 5SVXA 2KGGA 5KH9A 4LKAA 3LJUX 4N3WA 1HYJA 2ZETC 2VP7A 1U6GB 3V43A 3ZPV1 3U5OA 2EGPA 2LGGA 4F52B 2YU4A 4AYCB 2CT2A 5J3XA 3SUBA 3C5KA 3LQJA 2I50A 5FB1A 1Z60A 3M7KA 1WIMA 2DJAA 4QF2A 2CSYA 1MBMA 5TDWA 1N87A 2FFWA 3DPLR 2YUCA 3L1XA 3O36A 5LKXA 3O70A 2E61A 1XWHA 5H1UA 2YQMA 1X4IA 2G43A 3H7HA 3C6WA 2ECGA 2PUYA 4L7XA 1WE9A 2EGMA 1VD4A 5FERA 2VPGA 2JM3A 2ECWA 2RSDA 1Z2QA 3L11A 5B77A 2YHNA 1VYXA 1WEQA 2IQJA 2G6QA 3KV5A 2KKYA 2XOYA 2KGIA 4QF3A 2QICA 2XOZA 1T1HA 3KDEC 2D8SA 3U5MA 3LQHA 5I3LA 4N4FA 4GNGA 4WA6A 4WZ2A 3KQIA 2K16A 2XP0A 2YQLA 3O7AA 5B75A 3N9MA 1V87A 4PTBA 3EB5A 4WZ0A 2BAYA 5H1TA 2KR4A 3U5NA 5B8DA 1MM2A 2M13A 2XB1A 2VJFA 1WEUA 3T6RA 3ZYQA 4H9DA 2VJEB 3PHDA 3JUEA 5KH7A 3O47A 4YAXA 1CHCA 5FEYA 2NAAA 5D1KB 2VJEA 2F6NA 1WGMA 1FP0A 4R7EA 2JRJA 2LRIC 2VPDA 4S3OC 2EA6A 4A49A 3MHHA 4YABA 1Z6UA 3FJUB 2K1JA 5FB0A 5LKZA 1WILA 1LDJB 2Y1NA 3GV4A 2DSMA 2UZGA 3ZPVE 3LRQA 2LDRA 4L58A 4YBMA 2ECNA 3O37A 1DVPA 2YURA 2OXQC 3LVRE 2MUMA 2L5UA 3RTRB 2RI7A 5AIUA 1E4UA 2EXUA 2FSAA 4UI9B 3ASLA 2LQ6A 5H9MA 4W4UA
chains in the Genus database with same CATH topology
4FK5A 5LKUA 5KH3A 5TDRA 4IC2A 2L43A 3M62A 5G04B 4S3OB 4AYCA 2MT5A 4GB0A 4FO9A 1WEVA 4A0CD 3L1ZB 4C9ZA 2HDPA 2IDAA 3NG2A 2VPBA 5C11A 4FJCA 1WENA 4ZQLA 3U5PA 2KWNA 3HCUA 5D1LB 3T7LA 2F42A 3N9QA 2LGVA 4YBTA 3N9NA 4IC3A 2L75A 1HYIA 2KU3A 2MA6A 2QJ0A 2KIZA 2E6RA 4UP0A 5B78A 1K2FA 2C2LA 1WEWA 2QIZA 2KE1A 2KYUA 3KNVA 1JM7B 4O64A 2AN6A 2M1RA 5DKAA 4TKPB 2L80A 1JM7A 2ECIA 3ZVYA 2LXHC 3HCSA 2LGLA 5TRBA 2YYRA 5G05B 1WEMA 1IYMA 5DINA 2JMDA 5JG6A 1FBVA 4AVXA 1X4JA 4YADA 4B7YC 3IHPA 2MD7B 4GNDA 3M99A 1LDKC 4R2YA 4GNFA 4Q6FA 1WFKA 4A4BA 1WEPA 3SHBA 3I2DA 3N9PA 4LLBA 4MVTA 1WEOA 2MNZA 3DQVR 4GNEA 2LV9A 1ZBDB 5TBNA 2YT5A 1WEEA 2MIQA 3M63A 2LXPC 5G0FA 3HCTA 2KREA 2MNYA 4UP5A 4A4CA 1BORA 2PNXA 2Y1MA 1G25A 3O33A 2KFTA 5EYAF 4ZUXU 4WZ3B 2ECTA 5TABA 3N9LA 3HTKC 2ECVA 3O34A 2DX8A 3ZVZB 3ZNIA 3EB6A 4XI1A 5C13A 1JOCA 4LJNA 3SOWA 4YBSA 1WESA 4R8PK 2JMJA 4V3KC 3RPGC 4B86C 4NN2A 4X3GA 2L0BA 2JMIA 3GL6A 2Y43A 3O35A 3FL2A 2YSJA 2LGKA 5B79A 2HYED 4PPEA 2M85A 3N9OA 3SOXA 4V3LC 1RMDA 2MA5A 4LK9A 2KWKA 5LKTA 2CKLB 2FUIA 3PURA 2F6JA 2K17A 4CA1A 1F62A 2CKLA 2YW8A 1MM3A 4YATA 2YREA 1X4UA 4CCGX 3RPGB 4AP4A 2H0DB 2EODA 4FIPA 2VJFB 4I7CA 2H0DA 2M3HA 2VPEA 4BBQA 4BHWA 5D1MB 2YHOA 2FUUA 5H1VA 2G45A 4MSXA 5B76A 4ZDTA 4YC9A 3LQIA 2C2VS 2KWOA 2M6MA 2E6SA 2ECJA 2XEUA 4I7DA 4LADB 2CSZA 4AUQB 4I7BA 2YSMA 2KWJA 1VFYA 3VK6A 3MHSA 2VNFA 5AITA 5LCWB 3PUQA 2K4DA 3QZVA 3KV6A 3SOUA 2LN0A 2MD8C 3ZTGA 4P5OB 2KGGA 5KH9A 4LKAA 4N3WA 1HYJA 2ZETC 2VP7A 1U6GB 3V43A 3ZPV1 3U5OA 2EGPA 2LGGA 4F52B 2YU4A 4AYCB 2CT2A 5J3XA 3C5KA 3LQJA 2I50A 5FB1A 1Z60A 1WIMA 4QF2A 2CSYA 5TDWA 1N87A 3DPLR 2YUCA 3L1XA 3O36A 5LKXA 3O70A 1XWHA 5H1UA 2YQMA 1X4IA 2G43A 3C6WA 2ECGA 2PUYA 4L7XA 1WE9A 1VD4A 5FERA 2VPGA 2ECWA 2RSDA 1Z2QA 3L11A 5B77A 2YHNA 1VYXA 1WEQA 2G6QA 3KV5A 2KGIA 4QF3A 2QICA 1T1HA 2D8SA 3U5MA 3LQHA 5I3LA 4N4FA 4GNGA 4WA6A 4WZ2A 3KQIA 2K16A 3O7AA 2YQLA 5B75A 3N9MA 1V87A 4PTBA 3EB5A 4WZ0A 2BAYA 5H1TA 2KR4A 3U5NA 5B8DA 1MM2A 2XB1A 2VJFA 1WEUA 3T6RA 3ZYQA 2VJEB 3PHDA 5KH7A 4YAXA 1CHCA 5FEYA 2NAAA 5D1KB 2VJEA 2F6NA 1WGMA 1FP0A 4R7EA 2JRJA 2LRIC 2VPDA 4S3OC 2EA6A 4A49A 3MHHA 4YABA 1Z6UA 2K1JA 5FB0A 5LKZA 1WILA 1LDJB 2Y1NA 3GV4A 2UZGA 3ZPVE 3LRQA 2LDRA 4L58A 4YBMA 2ECNA 3O37A 1DVPA 2YURA 2OXQC 2MUMA 2L5UA 3RTRB 2RI7A 5AIUA 1E4UA 4UI9B 2FSAA 3ASLA 2LQ6A 5H9MA 4W4UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FK5 A;  5LKU A;  5KH3 A;  5TDR A;  4IC2 A;  2L43 A;  3M62 A;  5G04 B;  4S3O B;  4AYC A;  2MT5 A;  4GB0 A;  4FO9 A;  1WEV A;  4A0C D;  3L1Z B;  4C9Z A;  2HDP A;  2IDA A;  3NG2 A;  2VPB A;  5C11 A;  4FJC A;  1WEN A;  4ZQL A;  3U5P A;  2KWN A;  3HCU A;  5D1L B;  3T7L A;  2F42 A;  3N9Q A;  2LGV A;  4YBT A;  3N9N A;  4IC3 A;  2L75 A;  1HYI A;  2KU3 A;  2MA6 A;  2QJ0 A;  2KIZ A;  2E6R A;  4UP0 A;  5B78 A;  1K2F A;  2C2L A;  1WEW A;  2QIZ A;  2KE1 A;  2KYU A;  3KNV A;  1JM7 B;  4O64 A;  2AN6 A;  2M1R A;  5DKA A;  4TKP B;  2L80 A;  1JM7 A;  2ECI A;  3ZVY A;  2LXH C;  3HCS A;  2LGL A;  5TRB A;  2YYR A;  5G05 B;  1WEM A;  1IYM A;  5DIN A;  2JMD A;  5JG6 A;  1FBV A;  4AVX A;  1X4J A;  4YAD A;  4B7Y C;  3IHP A;  2MD7 B;  4GND A;  3M99 A;  1LDK C;  4R2Y A;  4GNF A;  4Q6F A;  1WFK A;  4A4B A;  1WEP A;  3SHB A;  3I2D A;  3N9P A;  4LLB A;  4MVT A;  1WEO A;  2MNZ A;  3DQV R;  4GNE A;  2LV9 A;  1ZBD B;  5TBN A;  2YT5 A;  1WEE A;  2MIQ A;  3M63 A;  2LXP C;  5G0F A;  3HCT A;  2KRE A;  2MNY A;  4UP5 A;  4A4C A;  1BOR A;  2PNX A;  2Y1M A;  1G25 A;  3O33 A;  2KFT A;  5EYA F;  4ZUX U;  4WZ3 B;  2ECT A;  5TAB A;  3N9L A;  3HTK C;  2ECV A;  3O34 A;  2DX8 A;  3ZVZ B;  3ZNI A;  3EB6 A;  4XI1 A;  5C13 A;  1JOC A;  4LJN A;  3SOW A;  4YBS A;  1WES A;  4R8P K;  2JMJ A;  4V3K C;  3RPG C;  4B86 C;  4NN2 A;  4X3G A;  2L0B A;  2JMI A;  3GL6 A;  2Y43 A;  3O35 A;  3FL2 A;  2YSJ A;  2LGK A;  5B79 A;  2HYE D;  4PPE A;  2M85 A;  3N9O A;  3SOX A;  4V3L C;  1RMD A;  2MA5 A;  4LK9 A;  2KWK A;  5LKT A;  2CKL B;  2FUI A;  3PUR A;  2F6J A;  2K17 A;  4CA1 A;  1F62 A;  2CKL A;  2YW8 A;  1MM3 A;  4YAT A;  2YRE A;  1X4U A;  4CCG X;  3RPG B;  4AP4 A;  2H0D B;  2EOD A;  4FIP A;  2VJF B;  4I7C A;  2H0D A;  2M3H A;  2VPE A;  4BBQ A;  4BHW A;  5D1M B;  2YHO A;  2FUU A;  5H1V A;  2G45 A;  4MSX A;  5B76 A;  4ZDT A;  4YC9 A;  3LQI A;  2C2V S;  2KWO A;  2M6M A;  2E6S A;  2ECJ A;  2XEU A;  4I7D A;  4LAD B;  2CSZ A;  4AUQ B;  4I7B A;  2YSM A;  2KWJ A;  1VFY A;  3VK6 A;  3MHS A;  2VNF A;  5AIT A;  5LCW B;  3PUQ A;  2K4D A;  3QZV A;  3KV6 A;  3SOU A;  2LN0 A;  2MD8 C;  3ZTG A;  4P5O B;  2KGG A;  5KH9 A;  4LKA A;  4N3W A;  1HYJ A;  2ZET C;  2VP7 A;  1U6G B;  3V43 A;  3ZPV 1;  3U5O A;  2EGP A;  2LGG A;  4F52 B;  2YU4 A;  4AYC B;  2CT2 A;  5J3X A;  3C5K A;  3LQJ A;  2I50 A;  5FB1 A;  1Z60 A;  1WIM A;  4QF2 A;  2CSY A;  5TDW A;  1N87 A;  3DPL R;  2YUC A;  3L1X A;  3O36 A;  5LKX A;  3O70 A;  1XWH A;  5H1U A;  2YQM A;  1X4I A;  2G43 A;  3C6W A;  2ECG A;  2PUY A;  4L7X A;  1WE9 A;  1VD4 A;  5FER A;  2VPG A;  2ECW A;  2RSD A;  1Z2Q A;  3L11 A;  5B77 A;  2YHN A;  1VYX A;  1WEQ A;  2G6Q A;  3KV5 A;  2KGI A;  4QF3 A;  2QIC A;  1T1H A;  2D8S A;  3U5M A;  3LQH A;  5I3L A;  4N4F A;  4GNG A;  4WA6 A;  4WZ2 A;  3KQI A;  2K16 A;  3O7A A;  2YQL A;  5B75 A;  3N9M A;  1V87 A;  4PTB A;  3EB5 A;  4WZ0 A;  2BAY A;  5H1T A;  2KR4 A;  3U5N A;  5B8D A;  1MM2 A;  2XB1 A;  2VJF A;  1WEU A;  3T6R A;  3ZYQ A;  2VJE B;  3PHD A;  5KH7 A;  4YAX A;  1CHC A;  5FEY A;  2NAA A;  5D1K B;  2VJE A;  2F6N A;  1WGM A;  1FP0 A;  4R7E A;  2JRJ A;  2LRI C;  2VPD A;  4S3O C;  2EA6 A;  4A49 A;  3MHH A;  4YAB A;  1Z6U A;  2K1J A;  5FB0 A;  5LKZ A;  1WIL A;  1LDJ B;  2Y1N A;  3GV4 A;  2UZG A;  3ZPV E;  3LRQ A;  2LDR A;  4L58 A;  4YBM A;  2ECN A;  3O37 A;  1DVP A;  2YUR A;  2OXQ C;  2MUM A;  2L5U A;  3RTR B;  2RI7 A;  5AIU A;  1E4U A;  4UI9 B;  2FSA A;  3ASL A;  2LQ6 A;  5H9M A;  4W4U A; 
#chains in the Genus database with same CATH topology
 3DWD A;  4FK5 A;  5LKU A;  5KH3 A;  5TDR A;  4IC2 A;  2L43 A;  3M62 A;  5G04 B;  4S3O B;  4AYC A;  2XOC A;  2MT5 A;  2D8U A;  4GB0 A;  4FO9 A;  5SVI B;  1WEV A;  4A0C D;  3L1Z B;  4C9Z A;  3T9K A;  5SVI A;  2HDP A;  2IDA A;  3NG2 A;  2RR4 A;  2VPB A;  5C11 A;  4FJC A;  1WEN A;  4ZQL A;  3U5P A;  1DCQ A;  2KWN A;  3HCU A;  5D1L B;  3T7L A;  2L7P A;  4OGE A;  2F42 A;  3N9Q A;  2LGV A;  4YBT A;  3N9N A;  5K3Q A;  4IC3 A;  2L75 A;  1HYI A;  2KU3 A;  2MA6 A;  2QJ0 A;  2KIZ A;  2E6R A;  2YVR A;  5SVY A;  4UP0 A;  5B78 A;  2CON A;  1K2F A;  2C2L A;  1WEW A;  2QIZ A;  2KE1 A;  2KYU A;  3KNV A;  2CSV A;  1JM7 B;  4O64 A;  2AN6 A;  2M1R A;  5DKA A;  4TKP B;  3FM8 C;  2L80 A;  1JM7 A;  2ECI A;  3ZVY A;  2LXH C;  3HCS A;  2LGL A;  5TRB A;  2YYR A;  5G05 B;  3LDY A;  1WEM A;  1IYM A;  5DIN A;  2JMD A;  5JG6 A;  1FBV A;  4AVX A;  1X4J A;  4YAD A;  4B7Y C;  3IHP A;  2MD7 B;  4GND A;  3M99 A;  1LDK C;  4R2Y A;  4GNF A;  4Q6F A;  1WFK A;  4A4B A;  1WEP A;  3SHB A;  3I2D A;  3N9P A;  4LLB A;  4MVT A;  1WEO A;  3LVQ E;  2MNZ A;  3DQV R;  4GNE A;  4QQ4 A;  2LV9 A;  1ZBD B;  5TBN A;  2YT5 A;  1WEE A;  2MIQ A;  3M63 A;  2LXP C;  5G0F A;  3HCT A;  2KRE A;  2MNY A;  4UP5 A;  4A4C A;  1BOR A;  2PNX A;  2Y1M A;  1G25 A;  3Q1D A;  3O33 A;  2KFT A;  2JUN A;  2LAU A;  5EYA F;  3FEH A;  2KKX A;  4Z0R A;  4ZUX U;  4WZ3 B;  2ECT A;  3N9L A;  5TAB A;  3HTK C;  2ECV A;  3O34 A;  2DX8 A;  3ZVZ B;  3ZNI A;  3EB6 A;  4XI1 A;  5C13 A;  1JOC A;  4LJN A;  3DDT A;  3SOW A;  4YBS A;  1WES A;  4R8P K;  2JMJ A;  4V3K C;  3RPG C;  4B86 C;  4NN2 A;  4X3G A;  2L0B A;  2JMI A;  3GL6 A;  2Y43 A;  3O35 A;  3FL2 A;  2YSJ A;  2LGK A;  2B0O E;  5B79 A;  2HYE D;  4PPE A;  2M85 A;  3N9O A;  3SOX A;  4V3L C;  4O62 A;  1RMD A;  2MA5 A;  4LK9 A;  2KWK A;  5LKT A;  2CKL B;  2FUI A;  3PUR A;  2F6J A;  2K17 A;  4CA1 A;  1F62 A;  2CKL A;  2YW8 A;  1MM3 A;  4YAT A;  2FD4 A;  2YRE A;  1X4U A;  4CCG X;  3RPG B;  4AP4 A;  2H0D B;  2EOD A;  3MDB C;  2MKE A;  4FIP A;  2VJF B;  4I7C A;  2H0D A;  2M3H A;  2OWA A;  2VPE A;  4BBQ A;  4BHW A;  5D1M B;  2YHO A;  2CRW A;  2FUU A;  5H1V A;  2G45 A;  4MSX A;  5B76 A;  4OGC A;  4ZDT A;  4YC9 A;  2CRR A;  3LQI A;  2C2V S;  4Z0O A;  2KWO A;  2M6M A;  2E6S A;  2ECJ A;  2P57 A;  2XEU A;  4I7D A;  4LAD B;  2CSZ A;  3FAO A;  4I7B A;  2YSM A;  4AUQ B;  2KWJ A;  1VFY A;  3VK6 A;  3MHS A;  2VNF A;  5AIT A;  3PUQ A;  5LCW B;  2K4D A;  3QZV A;  3KV6 A;  3SOU A;  2LN0 A;  2MD8 C;  3E2D A;  3FAN A;  3PLW A;  3ZTG A;  4P5O B;  4F1P A;  5SVX A;  2KGG A;  5KH9 A;  4LKA A;  3LJU X;  4N3W A;  1HYJ A;  2ZET C;  2VP7 A;  1U6G B;  3V43 A;  3ZPV 1;  3U5O A;  2EGP A;  2LGG A;  4F52 B;  2YU4 A;  4AYC B;  2CT2 A;  5J3X A;  3SUB A;  3C5K A;  3LQJ A;  2I50 A;  5FB1 A;  1Z60 A;  3M7K A;  1WIM A;  2DJA A;  4QF2 A;  2CSY A;  1MBM A;  5TDW A;  1N87 A;  2FFW A;  3DPL R;  2YUC A;  3L1X A;  3O36 A;  5LKX A;  3O70 A;  2E61 A;  1XWH A;  5H1U A;  2YQM A;  1X4I A;  2G43 A;  3H7H A;  3C6W A;  2ECG A;  2PUY A;  4L7X A;  1WE9 A;  2EGM A;  1VD4 A;  5FER A;  2VPG A;  2JM3 A;  2ECW A;  2RSD A;  1Z2Q A;  3L11 A;  5B77 A;  2YHN A;  1VYX A;  1WEQ A;  2IQJ A;  2G6Q A;  3KV5 A;  2KKY A;  2XOY A;  2KGI A;  4QF3 A;  2QIC A;  2XOZ A;  1T1H A;  3KDE C;  2D8S A;  3U5M A;  3LQH A;  5I3L A;  4N4F A;  4GNG A;  4WA6 A;  4WZ2 A;  3KQI A;  2K16 A;  2XP0 A;  2YQL A;  3O7A A;  5B75 A;  3N9M A;  1V87 A;  4PTB A;  3EB5 A;  4WZ0 A;  2BAY A;  5H1T A;  2KR4 A;  3U5N A;  5B8D A;  1MM2 A;  2M13 A;  2XB1 A;  2VJF A;  1WEU A;  3T6R A;  3ZYQ A;  4H9D A;  2VJE B;  3PHD A;  3JUE A;  5KH7 A;  3O47 A;  4YAX A;  1CHC A;  5FEY A;  2NAA A;  5D1K B;  2VJE A;  2F6N A;  1WGM A;  1FP0 A;  4R7E A;  2JRJ A;  2LRI C;  2VPD A;  4S3O C;  2EA6 A;  4A49 A;  3MHH A;  4YAB A;  1Z6U A;  3FJU B;  2K1J A;  5FB0 A;  5LKZ A;  1WIL A;  1LDJ B;  2Y1N A;  3GV4 A;  2DSM A;  2UZG A;  3ZPV E;  3LRQ A;  2LDR A;  4L58 A;  4YBM A;  2ECN A;  3O37 A;  1DVP A;  2YUR A;  2OXQ C;  3LVR E;  2MUM A;  2L5U A;  3RTR B;  2RI7 A;  5AIU A;  1E4U A;  2EXU A;  2FSA A;  4UI9 B;  3ASL A;  2LQ6 A;  5H9M A;  4W4U A; 
#chains in the Genus database with same CATH homology
 4FK5 A;  5LKU A;  5KH3 A;  5TDR A;  4IC2 A;  2L43 A;  3M62 A;  5G04 B;  4S3O B;  4AYC A;  2MT5 A;  4GB0 A;  4FO9 A;  1WEV A;  4A0C D;  3L1Z B;  4C9Z A;  2HDP A;  2IDA A;  3NG2 A;  2VPB A;  5C11 A;  4FJC A;  1WEN A;  4ZQL A;  3U5P A;  2KWN A;  3HCU A;  5D1L B;  3T7L A;  2F42 A;  3N9Q A;  2LGV A;  4YBT A;  3N9N A;  4IC3 A;  2L75 A;  1HYI A;  2KU3 A;  2MA6 A;  2QJ0 A;  2KIZ A;  2E6R A;  4UP0 A;  5B78 A;  1K2F A;  2C2L A;  1WEW A;  2QIZ A;  2KE1 A;  2KYU A;  3KNV A;  1JM7 B;  4O64 A;  2AN6 A;  2M1R A;  5DKA A;  4TKP B;  2L80 A;  1JM7 A;  2ECI A;  3ZVY A;  2LXH C;  3HCS A;  2LGL A;  5TRB A;  2YYR A;  5G05 B;  1WEM A;  1IYM A;  5DIN A;  2JMD A;  5JG6 A;  1FBV A;  4AVX A;  1X4J A;  4YAD A;  4B7Y C;  3IHP A;  2MD7 B;  4GND A;  3M99 A;  1LDK C;  4R2Y A;  4GNF A;  4Q6F A;  1WFK A;  4A4B A;  1WEP A;  3SHB A;  3I2D A;  3N9P A;  4LLB A;  4MVT A;  1WEO A;  2MNZ A;  3DQV R;  4GNE A;  2LV9 A;  1ZBD B;  5TBN A;  2YT5 A;  1WEE A;  2MIQ A;  3M63 A;  2LXP C;  5G0F A;  3HCT A;  2KRE A;  2MNY A;  4UP5 A;  4A4C A;  1BOR A;  2PNX A;  2Y1M A;  1G25 A;  3O33 A;  2KFT A;  5EYA F;  4ZUX U;  4WZ3 B;  2ECT A;  5TAB A;  3N9L A;  3HTK C;  2ECV A;  3O34 A;  2DX8 A;  3ZVZ B;  3ZNI A;  3EB6 A;  4XI1 A;  5C13 A;  1JOC A;  4LJN A;  3SOW A;  4YBS A;  1WES A;  4R8P K;  2JMJ A;  4V3K C;  3RPG C;  4B86 C;  4NN2 A;  4X3G A;  2L0B A;  2JMI A;  3GL6 A;  2Y43 A;  3O35 A;  3FL2 A;  2YSJ A;  2LGK A;  5B79 A;  2HYE D;  4PPE A;  2M85 A;  3N9O A;  3SOX A;  4V3L C;  1RMD A;  2MA5 A;  4LK9 A;  2KWK A;  5LKT A;  2CKL B;  2FUI A;  3PUR A;  2F6J A;  2K17 A;  4CA1 A;  1F62 A;  2CKL A;  2YW8 A;  1MM3 A;  4YAT A;  2YRE A;  1X4U A;  4CCG X;  3RPG B;  4AP4 A;  2H0D B;  2EOD A;  4FIP A;  2VJF B;  4I7C A;  2H0D A;  2M3H A;  2VPE A;  4BBQ A;  4BHW A;  5D1M B;  2YHO A;  2FUU A;  5H1V A;  2G45 A;  4MSX A;  5B76 A;  4ZDT A;  4YC9 A;  3LQI A;  2C2V S;  2KWO A;  2M6M A;  2E6S A;  2ECJ A;  2XEU A;  4I7D A;  4LAD B;  2CSZ A;  4AUQ B;  4I7B A;  2YSM A;  2KWJ A;  1VFY A;  3VK6 A;  3MHS A;  2VNF A;  5AIT A;  5LCW B;  3PUQ A;  2K4D A;  3QZV A;  3KV6 A;  3SOU A;  2LN0 A;  2MD8 C;  3ZTG A;  4P5O B;  2KGG A;  5KH9 A;  4LKA A;  4N3W A;  1HYJ A;  2ZET C;  2VP7 A;  1U6G B;  3V43 A;  3ZPV 1;  3U5O A;  2EGP A;  2LGG A;  4F52 B;  2YU4 A;  4AYC B;  2CT2 A;  5J3X A;  3C5K A;  3LQJ A;  2I50 A;  5FB1 A;  1Z60 A;  1WIM A;  4QF2 A;  2CSY A;  5TDW A;  1N87 A;  3DPL R;  2YUC A;  3L1X A;  3O36 A;  5LKX A;  3O70 A;  1XWH A;  5H1U A;  2YQM A;  1X4I A;  2G43 A;  3C6W A;  2ECG A;  2PUY A;  4L7X A;  1WE9 A;  1VD4 A;  5FER A;  2VPG A;  2ECW A;  2RSD A;  1Z2Q A;  3L11 A;  5B77 A;  2YHN A;  1VYX A;  1WEQ A;  2G6Q A;  3KV5 A;  2KGI A;  4QF3 A;  2QIC A;  1T1H A;  2D8S A;  3U5M A;  3LQH A;  5I3L A;  4N4F A;  4GNG A;  4WA6 A;  4WZ2 A;  3KQI A;  2K16 A;  3O7A A;  2YQL A;  5B75 A;  3N9M A;  1V87 A;  4PTB A;  3EB5 A;  4WZ0 A;  2BAY A;  5H1T A;  2KR4 A;  3U5N A;  5B8D A;  1MM2 A;  2XB1 A;  2VJF A;  1WEU A;  3T6R A;  3ZYQ A;  2VJE B;  3PHD A;  5KH7 A;  4YAX A;  1CHC A;  5FEY A;  2NAA A;  5D1K B;  2VJE A;  2F6N A;  1WGM A;  1FP0 A;  4R7E A;  2JRJ A;  2LRI C;  2VPD A;  4S3O C;  2EA6 A;  4A49 A;  3MHH A;  4YAB A;  1Z6U A;  2K1J A;  5FB0 A;  5LKZ A;  1WIL A;  1LDJ B;  2Y1N A;  3GV4 A;  2UZG A;  3ZPV E;  3LRQ A;  2LDR A;  4L58 A;  4YBM A;  2ECN A;  3O37 A;  1DVP A;  2YUR A;  2OXQ C;  2MUM A;  2L5U A;  3RTR B;  2RI7 A;  5AIU A;  1E4U A;  4UI9 B;  2FSA A;  3ASL A;  2LQ6 A;  5H9M A;  4W4U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...