2VPEA

Decoding of methylated histone h3 tail by the pygo-bcl9 wnt signaling complex
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
61
structure length
61
Chain Sequence
MAVYPCGICTNEVNDDQDAILCEASCQKWFHRICTGMTETAYGLLTAEASAVWGCDTCMAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Decoding of Methylated Histone H3 Tail by the Pygo- Bcl9 Wnt Signaling Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
molecule keywords PYGOPUS HOMOLOG 1
total genus 15
structure length 61
sequence length 61
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2vpeA00
1F62A 2F6NA 1WEMA 1VYXA 2JMIA 3LQIA 4TKPB 3PURA 2FSAA 2H0DA 3C6WA 2ECIA 4GNFA 1WILA 2YUCA 1Z60A 3N9LA 2H0DB 4I7CA 3ZTGA 4YAXA 1WEWA 2M85A 5FERA 4R8PK 4YC9A 2VP7A 2EODA 1X4IA 2BAYA 3VK6A 2CKLA 5EYAF 3MHHA 2L75A 2RSDA 2UZGA 4I7DA 4X3GA 1WEVA 2KREA 2NAAA 1BORA 4ZUXU 5TBNA 2LGGA 2MT5A 2ECWA 2G45A 5C13A 2YW8A 4B86C 1FBVA 3ZPVE 2ECVA 1WEQA 2K16A 2M1RA 4PPEA 5KH9A 3FL2A 2FUUA 2MIQA 4GNEA 2MA6A 5B76A 4P5OB 4QF2A 5TDRA 2XEUA 5B8DA 3EB6A 4NN2A 3DPLR 2KE1A 5J3XA 4YABA 5LKXA 2PNXA 3RTRB 4YATA 2VPEA 2F6JA 1DVPA 2LN0A 2JMDA 3I2DA 4PTBA 3M99A 2KR4A 2VJEB 3ZVZB 3LRQA 1WFKA 1WEEA 2ECTA 3EB5A 1WEOA 2YREA 3C5KA 4A0CD 2KIZA 1JM7B 3ZNIA 2FUIA 2JRJA 5FB0A 2MNZA 4LLBA 1VFYA 2KFTA 4F52B 2YT5A 4CCGX 4CA1A 5DINA 2HDPA 4AVXA 5I3LA 1FP0A 1WIMA 2LGKA 3V43A 4S3OB 2KU3A 2AN6A 4UP5A 2KYUA 4W4UA 1JOCA 2LQ6A 1RMDA 1CHCA 3O37A 4BBQA 3NG2A 5AITA 2CT2A 3KNVA 4V3KC 2MA5A 5G05B 2KWJA 1U6GB 4YBSA 3PUQA 4LJNA 2L0BA 4LK9A 5JG6A 4L7XA 3KQIA 2G6QA 3RPGC 3N9QA 2C2VS 5LKTA 2KWOA 3T7LA 4ZQLA 1LDJB 4WA6A 4ZDTA 2MD8C 3T6RA 2RI7A 3HCSA 1VD4A 4L58A 5B77A 2ZETC 1HYJA 5FEYA 2LRIC 3ZPV1 1WENA 4AUQB 2EGPA 1E4UA 3M62A 2YHOA 3O7AA 2LXPC 4UI9B 3HCUA 1Z2QA 5H1UA 4UP0A 4YBMA 2I50A 4LKAA 4LADB 4AP4A 5KH7A 4N4FA 3SOWA 2HYED 5H1TA 1V87A 3SHBA 2YHNA 2M6MA 5B79A 2M3HA 3SOUA 2LGLA 2PUYA 2OXQC 4MSXA 4XI1A 2K17A 3SOXA 1WGMA 4R2YA 1LDKC 5G04B 1HYIA 2VNFA 2CSYA 1WEUA 2L5UA 3L1XA 1IYMA 2YSMA 2YQMA 2E6SA 4WZ2A 4GB0A 2KWKA 5DKAA 2DX8A 2E6RA 3GV4A 3RPGB 3LQHA 2JMJA 4O64A 2L43A 4WZ3B 5H9MA 5B78A 3PHDA 1ZBDB 2MD7B 2ECGA 2QJ0A 2EA6A 2VPBA 4A4BA 4AYCB 4C9ZA 2L80A 4FIPA 3MHSA 4GNDA 3N9PA 3ASLA 4GNGA 3U5NA 3KV5A 3ZVYA 3U5MA 2KWNA 2Y1NA 2LGVA 5D1LB 5TRBA 4Q6FA 2CKLB 3U5OA 5FB1A 4I7BA 2XB1A 5D1KB 4A49A 2YURA 1T1HA 1WE9A 2LDRA 3GL6A 5D1MB 4FK5A 2D8SA 3N9NA 4S3OC 4A4CA 2Y1MA 3HTKC 4AYCA 2YYRA 1MM3A 1X4JA 2YSJA 4IC3A 2KGGA 4IC2A 3LQJA 1WEPA 2VJFA 2CSZA 5KH3A 1JM7A 2ECNA 4V3LC 5C11A 5LKZA 1N87A 2F42A 5LCWB 4R7EA 5H1VA 2Y43A 5TDWA 2QIZA 3O33A 3L11A 2MUMA 2IDAA 2VJEA 4FO9A 3O35A 3N9MA 5LKUA 1WESA 4N3WA 2G43A 2MNYA 2VPGA 1G25A 5TABA 5AIUA 3QZVA 2YQLA 3L1ZB 4QF3A 2VJFB 2ECJA 1XWHA 3N9OA 4BHWA 4FJCA 3HCTA 2C2LA 4YBTA 2VPDA 3KV6A 4MVTA 3DQVR 2QICA 5B75A 1X4UA 4WZ0A 3IHPA 2KGIA 1K2FA 3M63A 2K4DA 3U5PA 2YU4A 1MM2A 3O36A 3O70A 2LXHC 3ZYQA 4YADA 3O34A 5G0FA 4B7YC 2LV9A 1Z6UA 2K1JA
chains in the Genus database with same CATH superfamily
1F62A 2F6NA 1WEMA 1VYXA 3LDYA 5K3QA 2JMIA 3LQIA 4TKPB 2CRWA 3PURA 2FSAA 2H0DA 3C6WA 2ECIA 4GNFA 1WILA 2YUCA 1Z60A 3N9LA 2H0DB 4I7CA 3ZTGA 4YAXA 1WEWA 2M85A 5FERA 4R8PK 3FEHA 4YC9A 2VP7A 2EODA 1X4IA 2BAYA 3VK6A 2CKLA 5EYAF 3MHHA 2L75A 2RSDA 2UZGA 4I7DA 4X3GA 1WEVA 2KREA 2NAAA 1BORA 4ZUXU 5TBNA 2LGGA 2MT5A 2ECWA 2G45A 5C13A 2YW8A 4B86C 1FBVA 3ZPVE 2ECVA 3MDBC 1WEQA 2K16A 2M1RA 4PPEA 5KH9A 3FL2A 2FUUA 2MIQA 4GNEA 2L7PA 3PLWA 2MA6A 5B76A 4P5OB 4QF2A 5TDRA 2P57A 2XEUA 5B8DA 3EB6A 4H9DA 4NN2A 3DPLR 2KE1A 5J3XA 4YABA 5LKXA 4OGCA 2PNXA 3RTRB 4Z0OA 4YATA 2VPEA 2F6JA 1DVPA 2LN0A 2JMDA 3I2DA 3LVRE 3Q1DA 4PTBA 3M99A 2KR4A 2VJEB 3ZVZB 3LRQA 1WFKA 1WEEA 2ECTA 3EB5A 1WEOA 2YREA 3C5KA 4A0CD 2KIZA 3M7KA 1JM7B 3ZNIA 2FUIA 2JRJA 5FB0A 2MNZA 4LLBA 3DDTA 1VFYA 2B0OE 2EGMA 3H7HA 2KFTA 4F52B 2EXUA 3DWDA 2YT5A 4CCGX 4CA1A 5DINA 2HDPA 4AVXA 5I3LA 2JUNA 1FP0A 1WIMA 2LGKA 3V43A 3JUEA 4S3OB 2KU3A 2AN6A 2RR4A 4UP5A 2KYUA 4W4UA 1JOCA 2CRRA 2LQ6A 1RMDA 1CHCA 2CONA 3O47A 3O37A 3LJUX 4BBQA 3NG2A 5AITA 2CT2A 3KNVA 4V3KC 2MA5A 5G05B 2KWJA 1U6GB 4YBSA 3PUQA 4LJNA 2L0BA 4LK9A 5JG6A 4L7XA 3KQIA 2G6QA 3RPGC 3SUBA 2M13A 3N9QA 2C2VS 5LKTA 2KWOA 3FAOA 3T7LA 4ZQLA 1LDJB 4WA6A 4ZDTA 5SVIA 2MD8C 3T6RA 2FD4A 2YVRA 2RI7A 3HCSA 1VD4A 4L58A 5B77A 2XP0A 2ZETC 1HYJA 5FEYA 2LRIC 3ZPV1 1WENA 4AUQB 2EGPA 1E4UA 3M62A 2YHOA 3O7AA 2LXPC 4UI9B 3HCUA 1Z2QA 5H1UA 4UP0A 4YBMA 2I50A 4LKAA 4LADB 4AP4A 1DCQA 5KH7A 4N4FA 3SOWA 2HYED 5H1TA 1V87A 3SHBA 2YHNA 2M6MA 5B79A 2M3HA 3SOUA 2DSMA 2LGLA 2PUYA 2OXQC 4MSXA 4XI1A 2K17A 3SOXA 1WGMA 4R2YA 1LDKC 5G04B 2FFWA 1HYIA 2VNFA 2IQJA 2CSYA 1WEUA 2L5UA 3L1XA 3T9KA 1IYMA 2YSMA 2LAUA 2YQMA 2E6SA 4WZ2A 4GB0A 2KWKA 5DKAA 4F1PA 2DX8A 2E6RA 3GV4A 3RPGB 3LQHA 2JMJA 4O64A 2L43A 4WZ3B 5H9MA 5B78A 3PHDA 1ZBDB 2MD7B 4QQ4A 2ECGA 2QJ0A 2EA6A 2VPBA 4A4BA 4AYCB 3KDEC 4C9ZA 2L80A 4FIPA 3MHSA 4GNDA 3N9PA 3ASLA 4GNGA 3U5NA 3KV5A 3ZVYA 3U5MA 2KWNA 2XOZA 2Y1NA 2JM3A 2LGVA 5D1LB 5TRBA 4Q6FA 3E2DA 2CKLB 3U5OA 5FB1A 4I7BA 2MKEA 2XB1A 4O62A 5D1KB 4A49A 2OWAA 2XOCA 2YURA 1T1HA 1WE9A 2LDRA 3GL6A 5D1MB 4FK5A 2D8SA 3N9NA 4S3OC 3FM8C 4A4CA 5SVIB 2CSVA 2Y1MA 3HTKC 4AYCA 2YYRA 1MM3A 2KKYA 1X4JA 2YSJA 4IC3A 2KGGA 4IC2A 3LQJA 1WEPA 2VJFA 2CSZA 4OGEA 3FANA 5KH3A 1JM7A 2ECNA 4V3LC 5C11A 5LKZA 1N87A 2F42A 5LCWB 4R7EA 5H1VA 2Y43A 5TDWA 2QIZA 3O33A 3L11A 2XOYA 2MUMA 2IDAA 2VJEA 4FO9A 3O35A 3N9MA 5LKUA 1WESA 4N3WA 2G43A 2MNYA 5SVXA 5SVYA 2VPGA 1G25A 5TABA 5AIUA 3QZVA 2YQLA 3L1ZB 4QF3A 2VJFB 2ECJA 1XWHA 2E61A 3N9OA 2D8UA 4FJCA 4BHWA 3HCTA 2C2LA 4YBTA 2VPDA 3KV6A 4MVTA 3DQVR 3FJUB 3LVQE 2QICA 5B75A 1X4UA 4WZ0A 3IHPA 2KGIA 1K2FA 3M63A 2K4DA 3U5PA 2YU4A 1MM2A 3O36A 3O70A 2LXHC 3ZYQA 4YADA 4Z0RA 3O34A 2DJAA 5G0FA 4B7YC 2LV9A 1Z6UA 2KKXA 1MBMA 2K1JA
chains in the Genus database with same CATH topology
1F62A 2F6NA 1WEMA 1VYXA 2JMIA 3LQIA 4TKPB 3PURA 2FSAA 2H0DA 3C6WA 2ECIA 4GNFA 1WILA 2YUCA 1Z60A 3N9LA 2H0DB 4I7CA 3ZTGA 4YAXA 1WEWA 2M85A 5FERA 4R8PK 4YC9A 2VP7A 2EODA 1X4IA 2BAYA 3VK6A 2CKLA 5EYAF 3MHHA 2L75A 2RSDA 2UZGA 4I7DA 4X3GA 1WEVA 2KREA 2NAAA 1BORA 4ZUXU 5TBNA 2LGGA 2MT5A 2ECWA 2G45A 5C13A 2YW8A 4B86C 1FBVA 3ZPVE 2ECVA 1WEQA 2K16A 2M1RA 4PPEA 5KH9A 3FL2A 2FUUA 2MIQA 4GNEA 2MA6A 5B76A 4P5OB 4QF2A 5TDRA 2XEUA 5B8DA 3EB6A 4NN2A 3DPLR 2KE1A 5J3XA 4YABA 5LKXA 2PNXA 3RTRB 4YATA 2VPEA 2F6JA 1DVPA 2LN0A 2JMDA 3I2DA 4PTBA 3M99A 2KR4A 2VJEB 3ZVZB 3LRQA 1WFKA 1WEEA 2ECTA 3EB5A 1WEOA 2YREA 3C5KA 4A0CD 2KIZA 1JM7B 3ZNIA 2FUIA 2JRJA 5FB0A 2MNZA 4LLBA 1VFYA 2KFTA 4F52B 2YT5A 4CCGX 4CA1A 5DINA 2HDPA 4AVXA 5I3LA 1FP0A 1WIMA 2LGKA 3V43A 4S3OB 2KU3A 2AN6A 4UP5A 2KYUA 4W4UA 1JOCA 2LQ6A 1RMDA 1CHCA 3O37A 4BBQA 3NG2A 5AITA 2CT2A 3KNVA 4V3KC 2MA5A 5G05B 2KWJA 1U6GB 4YBSA 3PUQA 4LJNA 2L0BA 4LK9A 5JG6A 4L7XA 3KQIA 2G6QA 3RPGC 3N9QA 2C2VS 5LKTA 2KWOA 3T7LA 4ZQLA 1LDJB 4WA6A 4ZDTA 2MD8C 3T6RA 2RI7A 3HCSA 1VD4A 4L58A 5B77A 2ZETC 1HYJA 5FEYA 2LRIC 3ZPV1 1WENA 4AUQB 2EGPA 1E4UA 3M62A 2YHOA 3O7AA 2LXPC 4UI9B 3HCUA 1Z2QA 5H1UA 4UP0A 4YBMA 2I50A 4LKAA 4LADB 4AP4A 5KH7A 4N4FA 3SOWA 2HYED 5H1TA 1V87A 3SHBA 2YHNA 2M6MA 5B79A 2M3HA 3SOUA 2LGLA 2PUYA 2OXQC 4MSXA 4XI1A 2K17A 3SOXA 1WGMA 4R2YA 1LDKC 5G04B 1HYIA 2VNFA 2CSYA 1WEUA 2L5UA 3L1XA 1IYMA 2YSMA 2YQMA 2E6SA 4WZ2A 4GB0A 2KWKA 5DKAA 2DX8A 2E6RA 3GV4A 3RPGB 3LQHA 2JMJA 4O64A 2L43A 4WZ3B 5H9MA 5B78A 3PHDA 1ZBDB 2MD7B 2ECGA 2QJ0A 2EA6A 2VPBA 4A4BA 4AYCB 4C9ZA 2L80A 4FIPA 3MHSA 4GNDA 3N9PA 3ASLA 4GNGA 3U5NA 3KV5A 3ZVYA 3U5MA 2KWNA 2Y1NA 2LGVA 5D1LB 5TRBA 4Q6FA 2CKLB 3U5OA 5FB1A 4I7BA 2XB1A 5D1KB 4A49A 2YURA 1T1HA 1WE9A 2LDRA 3GL6A 5D1MB 4FK5A 2D8SA 3N9NA 4S3OC 4A4CA 2Y1MA 3HTKC 4AYCA 2YYRA 1MM3A 1X4JA 2YSJA 4IC3A 2KGGA 4IC2A 3LQJA 1WEPA 2VJFA 2CSZA 5KH3A 1JM7A 2ECNA 4V3LC 5C11A 5LKZA 1N87A 2F42A 5LCWB 4R7EA 5H1VA 2Y43A 5TDWA 2QIZA 3O33A 3L11A 2MUMA 2IDAA 2VJEA 4FO9A 3O35A 3N9MA 5LKUA 1WESA 4N3WA 2G43A 2MNYA 2VPGA 1G25A 5TABA 5AIUA 3QZVA 2YQLA 3L1ZB 4QF3A 2VJFB 2ECJA 1XWHA 3N9OA 4BHWA 4FJCA 3HCTA 2C2LA 4YBTA 2VPDA 3KV6A 4MVTA 3DQVR 2QICA 5B75A 1X4UA 4WZ0A 3IHPA 2KGIA 1K2FA 3M63A 2K4DA 3U5PA 2YU4A 1MM2A 3O36A 3O70A 2LXHC 3ZYQA 4YADA 3O34A 5G0FA 4B7YC 2LV9A 1Z6UA 2K1JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F62 A;  2F6N A;  1WEM A;  1VYX A;  2JMI A;  3LQI A;  4TKP B;  3PUR A;  2FSA A;  2H0D A;  3C6W A;  2ECI A;  4GNF A;  1WIL A;  2YUC A;  1Z60 A;  3N9L A;  2H0D B;  4I7C A;  3ZTG A;  4YAX A;  1WEW A;  2M85 A;  5FER A;  4R8P K;  4YC9 A;  2VP7 A;  2EOD A;  1X4I A;  2BAY A;  3VK6 A;  2CKL A;  5EYA F;  3MHH A;  2L75 A;  2RSD A;  2UZG A;  4I7D A;  4X3G A;  1WEV A;  2KRE A;  2NAA A;  1BOR A;  4ZUX U;  5TBN A;  2LGG A;  2MT5 A;  2ECW A;  2G45 A;  5C13 A;  2YW8 A;  4B86 C;  1FBV A;  3ZPV E;  2ECV A;  1WEQ A;  2K16 A;  2M1R A;  4PPE A;  5KH9 A;  3FL2 A;  2FUU A;  2MIQ A;  4GNE A;  2MA6 A;  5B76 A;  4P5O B;  4QF2 A;  5TDR A;  2XEU A;  5B8D A;  3EB6 A;  4NN2 A;  3DPL R;  2KE1 A;  5J3X A;  4YAB A;  5LKX A;  2PNX A;  3RTR B;  4YAT A;  2VPE A;  2F6J A;  1DVP A;  2LN0 A;  2JMD A;  3I2D A;  4PTB A;  3M99 A;  2KR4 A;  2VJE B;  3ZVZ B;  3LRQ A;  1WFK A;  1WEE A;  2ECT A;  3EB5 A;  1WEO A;  2YRE A;  3C5K A;  4A0C D;  2KIZ A;  1JM7 B;  3ZNI A;  2FUI A;  2JRJ A;  5FB0 A;  2MNZ A;  4LLB A;  1VFY A;  2KFT A;  4F52 B;  2YT5 A;  4CCG X;  4CA1 A;  5DIN A;  2HDP A;  4AVX A;  5I3L A;  1FP0 A;  1WIM A;  2LGK A;  3V43 A;  4S3O B;  2KU3 A;  2AN6 A;  4UP5 A;  2KYU A;  4W4U A;  1JOC A;  2LQ6 A;  1RMD A;  1CHC A;  3O37 A;  4BBQ A;  3NG2 A;  5AIT A;  2CT2 A;  3KNV A;  4V3K C;  2MA5 A;  5G05 B;  2KWJ A;  1U6G B;  4YBS A;  3PUQ A;  4LJN A;  2L0B A;  4LK9 A;  5JG6 A;  4L7X A;  3KQI A;  2G6Q A;  3RPG C;  3N9Q A;  2C2V S;  5LKT A;  2KWO A;  3T7L A;  4ZQL A;  1LDJ B;  4WA6 A;  4ZDT A;  2MD8 C;  3T6R A;  2RI7 A;  3HCS A;  1VD4 A;  4L58 A;  5B77 A;  2ZET C;  1HYJ A;  5FEY A;  2LRI C;  3ZPV 1;  1WEN A;  4AUQ B;  2EGP A;  1E4U A;  3M62 A;  2YHO A;  3O7A A;  2LXP C;  4UI9 B;  3HCU A;  1Z2Q A;  5H1U A;  4UP0 A;  4YBM A;  2I50 A;  4LKA A;  4LAD B;  4AP4 A;  5KH7 A;  4N4F A;  3SOW A;  2HYE D;  5H1T A;  1V87 A;  3SHB A;  2YHN A;  2M6M A;  5B79 A;  2M3H A;  3SOU A;  2LGL A;  2PUY A;  2OXQ C;  4MSX A;  4XI1 A;  2K17 A;  3SOX A;  1WGM A;  4R2Y A;  1LDK C;  5G04 B;  1HYI A;  2VNF A;  2CSY A;  1WEU A;  2L5U A;  3L1X A;  1IYM A;  2YSM A;  2YQM A;  2E6S A;  4WZ2 A;  4GB0 A;  2KWK A;  5DKA A;  2DX8 A;  2E6R A;  3GV4 A;  3RPG B;  3LQH A;  2JMJ A;  4O64 A;  2L43 A;  4WZ3 B;  5H9M A;  5B78 A;  3PHD A;  1ZBD B;  2MD7 B;  2ECG A;  2QJ0 A;  2EA6 A;  2VPB A;  4A4B A;  4AYC B;  4C9Z A;  2L80 A;  4FIP A;  3MHS A;  4GND A;  3N9P A;  3ASL A;  4GNG A;  3U5N A;  3KV5 A;  3ZVY A;  3U5M A;  2KWN A;  2Y1N A;  2LGV A;  5D1L B;  5TRB A;  4Q6F A;  2CKL B;  3U5O A;  5FB1 A;  4I7B A;  2XB1 A;  5D1K B;  4A49 A;  2YUR A;  1T1H A;  1WE9 A;  2LDR A;  3GL6 A;  5D1M B;  4FK5 A;  2D8S A;  3N9N A;  4S3O C;  4A4C A;  2Y1M A;  3HTK C;  4AYC A;  2YYR A;  1MM3 A;  1X4J A;  2YSJ A;  4IC3 A;  2KGG A;  4IC2 A;  3LQJ A;  1WEP A;  2VJF A;  2CSZ A;  5KH3 A;  1JM7 A;  2ECN A;  4V3L C;  5C11 A;  5LKZ A;  1N87 A;  2F42 A;  5LCW B;  4R7E A;  5H1V A;  2Y43 A;  5TDW A;  2QIZ A;  3O33 A;  3L11 A;  2MUM A;  2IDA A;  2VJE A;  4FO9 A;  3O35 A;  3N9M A;  5LKU A;  1WES A;  4N3W A;  2G43 A;  2MNY A;  2VPG A;  1G25 A;  5TAB A;  5AIU A;  3QZV A;  2YQL A;  3L1Z B;  4QF3 A;  2VJF B;  2ECJ A;  1XWH A;  3N9O A;  4BHW A;  4FJC A;  3HCT A;  2C2L A;  4YBT A;  2VPD A;  3KV6 A;  4MVT A;  3DQV R;  2QIC A;  5B75 A;  1X4U A;  4WZ0 A;  3IHP A;  2KGI A;  1K2F A;  3M63 A;  2K4D A;  3U5P A;  2YU4 A;  1MM2 A;  3O36 A;  3O70 A;  2LXH C;  3ZYQ A;  4YAD A;  3O34 A;  5G0F A;  4B7Y C;  2LV9 A;  1Z6U A;  2K1J A; 
#chains in the Genus database with same CATH topology
 1F62 A;  2F6N A;  1WEM A;  1VYX A;  3LDY A;  5K3Q A;  2JMI A;  3LQI A;  4TKP B;  2CRW A;  3PUR A;  2FSA A;  2H0D A;  3C6W A;  2ECI A;  4GNF A;  1WIL A;  2YUC A;  1Z60 A;  3N9L A;  2H0D B;  4I7C A;  3ZTG A;  4YAX A;  1WEW A;  2M85 A;  5FER A;  4R8P K;  3FEH A;  4YC9 A;  2VP7 A;  2EOD A;  1X4I A;  2BAY A;  3VK6 A;  2CKL A;  5EYA F;  3MHH A;  2L75 A;  2RSD A;  2UZG A;  4I7D A;  4X3G A;  1WEV A;  2KRE A;  2NAA A;  1BOR A;  4ZUX U;  5TBN A;  2LGG A;  2MT5 A;  2ECW A;  2G45 A;  5C13 A;  2YW8 A;  4B86 C;  1FBV A;  3ZPV E;  2ECV A;  3MDB C;  1WEQ A;  2K16 A;  2M1R A;  4PPE A;  5KH9 A;  3FL2 A;  2FUU A;  2MIQ A;  4GNE A;  2L7P A;  3PLW A;  2MA6 A;  5B76 A;  4P5O B;  4QF2 A;  5TDR A;  2P57 A;  2XEU A;  5B8D A;  3EB6 A;  4H9D A;  4NN2 A;  3DPL R;  2KE1 A;  5J3X A;  4YAB A;  5LKX A;  4OGC A;  2PNX A;  3RTR B;  4Z0O A;  4YAT A;  2VPE A;  2F6J A;  1DVP A;  2LN0 A;  2JMD A;  3I2D A;  3LVR E;  3Q1D A;  4PTB A;  3M99 A;  2KR4 A;  2VJE B;  3ZVZ B;  3LRQ A;  1WFK A;  1WEE A;  2ECT A;  3EB5 A;  1WEO A;  2YRE A;  3C5K A;  4A0C D;  2KIZ A;  3M7K A;  1JM7 B;  3ZNI A;  2FUI A;  2JRJ A;  5FB0 A;  2MNZ A;  4LLB A;  3DDT A;  1VFY A;  2B0O E;  2EGM A;  3H7H A;  2KFT A;  4F52 B;  2EXU A;  3DWD A;  2YT5 A;  4CCG X;  4CA1 A;  5DIN A;  2HDP A;  4AVX A;  5I3L A;  2JUN A;  1FP0 A;  1WIM A;  2LGK A;  3V43 A;  3JUE A;  4S3O B;  2KU3 A;  2AN6 A;  2RR4 A;  4UP5 A;  2KYU A;  4W4U A;  1JOC A;  2CRR A;  2LQ6 A;  1RMD A;  1CHC A;  2CON A;  3O47 A;  3O37 A;  3LJU X;  4BBQ A;  3NG2 A;  5AIT A;  2CT2 A;  3KNV A;  4V3K C;  2MA5 A;  5G05 B;  2KWJ A;  1U6G B;  4YBS A;  3PUQ A;  4LJN A;  2L0B A;  4LK9 A;  5JG6 A;  4L7X A;  3KQI A;  2G6Q A;  3RPG C;  3SUB A;  2M13 A;  3N9Q A;  2C2V S;  5LKT A;  2KWO A;  3FAO A;  3T7L A;  4ZQL A;  1LDJ B;  4WA6 A;  4ZDT A;  5SVI A;  2MD8 C;  3T6R A;  2FD4 A;  2YVR A;  2RI7 A;  3HCS A;  1VD4 A;  4L58 A;  5B77 A;  2XP0 A;  2ZET C;  1HYJ A;  5FEY A;  2LRI C;  3ZPV 1;  1WEN A;  4AUQ B;  2EGP A;  1E4U A;  3M62 A;  2YHO A;  3O7A A;  2LXP C;  4UI9 B;  3HCU A;  1Z2Q A;  5H1U A;  4UP0 A;  4YBM A;  2I50 A;  4LKA A;  4LAD B;  4AP4 A;  1DCQ A;  5KH7 A;  4N4F A;  3SOW A;  2HYE D;  5H1T A;  1V87 A;  3SHB A;  2YHN A;  2M6M A;  5B79 A;  2M3H A;  3SOU A;  2DSM A;  2LGL A;  2PUY A;  2OXQ C;  4MSX A;  4XI1 A;  2K17 A;  3SOX A;  1WGM A;  4R2Y A;  1LDK C;  5G04 B;  2FFW A;  1HYI A;  2VNF A;  2IQJ A;  2CSY A;  1WEU A;  2L5U A;  3L1X A;  3T9K A;  1IYM A;  2YSM A;  2LAU A;  2YQM A;  2E6S A;  4WZ2 A;  4GB0 A;  2KWK A;  5DKA A;  4F1P A;  2DX8 A;  2E6R A;  3GV4 A;  3RPG B;  3LQH A;  2JMJ A;  4O64 A;  2L43 A;  4WZ3 B;  5H9M A;  5B78 A;  3PHD A;  1ZBD B;  2MD7 B;  4QQ4 A;  2ECG A;  2QJ0 A;  2EA6 A;  2VPB A;  4A4B A;  4AYC B;  3KDE C;  4C9Z A;  2L80 A;  4FIP A;  3MHS A;  4GND A;  3N9P A;  3ASL A;  4GNG A;  3U5N A;  3KV5 A;  3ZVY A;  3U5M A;  2KWN A;  2XOZ A;  2Y1N A;  2JM3 A;  2LGV A;  5D1L B;  5TRB A;  4Q6F A;  3E2D A;  2CKL B;  3U5O A;  5FB1 A;  4I7B A;  2MKE A;  2XB1 A;  4O62 A;  5D1K B;  4A49 A;  2OWA A;  2XOC A;  2YUR A;  1T1H A;  1WE9 A;  2LDR A;  3GL6 A;  5D1M B;  4FK5 A;  2D8S A;  3N9N A;  4S3O C;  3FM8 C;  4A4C A;  5SVI B;  2CSV A;  2Y1M A;  3HTK C;  4AYC A;  2YYR A;  1MM3 A;  2KKY A;  1X4J A;  2YSJ A;  4IC3 A;  2KGG A;  4IC2 A;  3LQJ A;  1WEP A;  2VJF A;  2CSZ A;  4OGE A;  3FAN A;  5KH3 A;  1JM7 A;  2ECN A;  4V3L C;  5C11 A;  5LKZ A;  1N87 A;  2F42 A;  5LCW B;  4R7E A;  5H1V A;  2Y43 A;  5TDW A;  2QIZ A;  3O33 A;  3L11 A;  2XOY A;  2MUM A;  2IDA A;  2VJE A;  4FO9 A;  3O35 A;  3N9M A;  5LKU A;  1WES A;  4N3W A;  2G43 A;  2MNY A;  5SVX A;  5SVY A;  2VPG A;  1G25 A;  5TAB A;  5AIU A;  3QZV A;  2YQL A;  3L1Z B;  4QF3 A;  2VJF B;  2ECJ A;  1XWH A;  2E61 A;  3N9O A;  2D8U A;  4FJC A;  4BHW A;  3HCT A;  2C2L A;  4YBT A;  2VPD A;  3KV6 A;  4MVT A;  3DQV R;  3FJU B;  3LVQ E;  2QIC A;  5B75 A;  1X4U A;  4WZ0 A;  3IHP A;  2KGI A;  1K2F A;  3M63 A;  2K4D A;  3U5P A;  2YU4 A;  1MM2 A;  3O36 A;  3O70 A;  2LXH C;  3ZYQ A;  4YAD A;  4Z0R A;  3O34 A;  2DJA A;  5G0F A;  4B7Y C;  2LV9 A;  1Z6U A;  2KKX A;  1MBM A;  2K1J A; 
#chains in the Genus database with same CATH homology
 1F62 A;  2F6N A;  1WEM A;  1VYX A;  2JMI A;  3LQI A;  4TKP B;  3PUR A;  2FSA A;  2H0D A;  3C6W A;  2ECI A;  4GNF A;  1WIL A;  2YUC A;  1Z60 A;  3N9L A;  2H0D B;  4I7C A;  3ZTG A;  4YAX A;  1WEW A;  2M85 A;  5FER A;  4R8P K;  4YC9 A;  2VP7 A;  2EOD A;  1X4I A;  2BAY A;  3VK6 A;  2CKL A;  5EYA F;  3MHH A;  2L75 A;  2RSD A;  2UZG A;  4I7D A;  4X3G A;  1WEV A;  2KRE A;  2NAA A;  1BOR A;  4ZUX U;  5TBN A;  2LGG A;  2MT5 A;  2ECW A;  2G45 A;  5C13 A;  2YW8 A;  4B86 C;  1FBV A;  3ZPV E;  2ECV A;  1WEQ A;  2K16 A;  2M1R A;  4PPE A;  5KH9 A;  3FL2 A;  2FUU A;  2MIQ A;  4GNE A;  2MA6 A;  5B76 A;  4P5O B;  4QF2 A;  5TDR A;  2XEU A;  5B8D A;  3EB6 A;  4NN2 A;  3DPL R;  2KE1 A;  5J3X A;  4YAB A;  5LKX A;  2PNX A;  3RTR B;  4YAT A;  2VPE A;  2F6J A;  1DVP A;  2LN0 A;  2JMD A;  3I2D A;  4PTB A;  3M99 A;  2KR4 A;  2VJE B;  3ZVZ B;  3LRQ A;  1WFK A;  1WEE A;  2ECT A;  3EB5 A;  1WEO A;  2YRE A;  3C5K A;  4A0C D;  2KIZ A;  1JM7 B;  3ZNI A;  2FUI A;  2JRJ A;  5FB0 A;  2MNZ A;  4LLB A;  1VFY A;  2KFT A;  4F52 B;  2YT5 A;  4CCG X;  4CA1 A;  5DIN A;  2HDP A;  4AVX A;  5I3L A;  1FP0 A;  1WIM A;  2LGK A;  3V43 A;  4S3O B;  2KU3 A;  2AN6 A;  4UP5 A;  2KYU A;  4W4U A;  1JOC A;  2LQ6 A;  1RMD A;  1CHC A;  3O37 A;  4BBQ A;  3NG2 A;  5AIT A;  2CT2 A;  3KNV A;  4V3K C;  2MA5 A;  5G05 B;  2KWJ A;  1U6G B;  4YBS A;  3PUQ A;  4LJN A;  2L0B A;  4LK9 A;  5JG6 A;  4L7X A;  3KQI A;  2G6Q A;  3RPG C;  3N9Q A;  2C2V S;  5LKT A;  2KWO A;  3T7L A;  4ZQL A;  1LDJ B;  4WA6 A;  4ZDT A;  2MD8 C;  3T6R A;  2RI7 A;  3HCS A;  1VD4 A;  4L58 A;  5B77 A;  2ZET C;  1HYJ A;  5FEY A;  2LRI C;  3ZPV 1;  1WEN A;  4AUQ B;  2EGP A;  1E4U A;  3M62 A;  2YHO A;  3O7A A;  2LXP C;  4UI9 B;  3HCU A;  1Z2Q A;  5H1U A;  4UP0 A;  4YBM A;  2I50 A;  4LKA A;  4LAD B;  4AP4 A;  5KH7 A;  4N4F A;  3SOW A;  2HYE D;  5H1T A;  1V87 A;  3SHB A;  2YHN A;  2M6M A;  5B79 A;  2M3H A;  3SOU A;  2LGL A;  2PUY A;  2OXQ C;  4MSX A;  4XI1 A;  2K17 A;  3SOX A;  1WGM A;  4R2Y A;  1LDK C;  5G04 B;  1HYI A;  2VNF A;  2CSY A;  1WEU A;  2L5U A;  3L1X A;  1IYM A;  2YSM A;  2YQM A;  2E6S A;  4WZ2 A;  4GB0 A;  2KWK A;  5DKA A;  2DX8 A;  2E6R A;  3GV4 A;  3RPG B;  3LQH A;  2JMJ A;  4O64 A;  2L43 A;  4WZ3 B;  5H9M A;  5B78 A;  3PHD A;  1ZBD B;  2MD7 B;  2ECG A;  2QJ0 A;  2EA6 A;  2VPB A;  4A4B A;  4AYC B;  4C9Z A;  2L80 A;  4FIP A;  3MHS A;  4GND A;  3N9P A;  3ASL A;  4GNG A;  3U5N A;  3KV5 A;  3ZVY A;  3U5M A;  2KWN A;  2Y1N A;  2LGV A;  5D1L B;  5TRB A;  4Q6F A;  2CKL B;  3U5O A;  5FB1 A;  4I7B A;  2XB1 A;  5D1K B;  4A49 A;  2YUR A;  1T1H A;  1WE9 A;  2LDR A;  3GL6 A;  5D1M B;  4FK5 A;  2D8S A;  3N9N A;  4S3O C;  4A4C A;  2Y1M A;  3HTK C;  4AYC A;  2YYR A;  1MM3 A;  1X4J A;  2YSJ A;  4IC3 A;  2KGG A;  4IC2 A;  3LQJ A;  1WEP A;  2VJF A;  2CSZ A;  5KH3 A;  1JM7 A;  2ECN A;  4V3L C;  5C11 A;  5LKZ A;  1N87 A;  2F42 A;  5LCW B;  4R7E A;  5H1V A;  2Y43 A;  5TDW A;  2QIZ A;  3O33 A;  3L11 A;  2MUM A;  2IDA A;  2VJE A;  4FO9 A;  3O35 A;  3N9M A;  5LKU A;  1WES A;  4N3W A;  2G43 A;  2MNY A;  2VPG A;  1G25 A;  5TAB A;  5AIU A;  3QZV A;  2YQL A;  3L1Z B;  4QF3 A;  2VJF B;  2ECJ A;  1XWH A;  3N9O A;  4BHW A;  4FJC A;  3HCT A;  2C2L A;  4YBT A;  2VPD A;  3KV6 A;  4MVT A;  3DQV R;  2QIC A;  5B75 A;  1X4U A;  4WZ0 A;  3IHP A;  2KGI A;  1K2F A;  3M63 A;  2K4D A;  3U5P A;  2YU4 A;  1MM2 A;  3O36 A;  3O70 A;  2LXH C;  3ZYQ A;  4YAD A;  3O34 A;  5G0F A;  4B7Y C;  2LV9 A;  1Z6U A;  2K1J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...