2VPEA

Decoding of methylated histone h3 tail by the pygo-bcl9 wnt signaling complex
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
61
structure length
61
Chain Sequence
MAVYPCGICTNEVNDDQDAILCEASCQKWFHRICTGMTETAYGLLTAEASAVWGCDTCMAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Gene regulation
molecule keywords PYGOPUS HOMOLOG 1
publication title Decoding of Methylated Histone H3 Tail by the Pygo- Bcl9 Wnt Signaling Complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 61
sequence length 61
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2vpeA00
2XEUA 5TBNA 3N9LA 1LDJB 2QIZA 3LRQA 2MA6A 2PNXA 2M6MA 5TRBA 3DPLR 5H1UA 3N9QA 2AN6A 3N9OA 1VFYA 4BBQA 2RSDA 2JMDA 4R7EA 2LGKA 5TABA 4N3WA 2F42A 4B7YC 4R8PK 3PHDA 2C2LA 2L43A 4AYCB 1WEEA 4LJNA 1WESA 4A0CD 4N4FA 2ECTA 2MA5A 1JM7A 2EODA 2VPEA 3O34A 4PPEA 3RPGB 4B86C 3KV5A 1MM2A 4P5OB 2ECJA 3SHBA 5KH7A 3EB6A 2MUMA 4YAXA 5TDWA 2CSYA 2M85A 3N9MA 4I7DA 3V43A 2VPBA 2FSAA 4GNGA 2CKLB 3RTRB 2VJFB 3LQHA 5LKXA 2KE1A 1JM7B 1FBVA 2K17A 2YW8A 4GNEA 2LXPC 4A4CA 2Y1NA 3LQJA 5KH9A 5C13A 3GL6A 1K2FA 2MNZA 2BAYA 3N9NA 5FERA 1JOCA 4WA6A 3KNVA 3HCUA 2H0DA 4IC3A 4QF3A 5KH3A 2L75A 4UP0A 2E6SA 5H1VA 1WEMA 1RMDA 2OXQC 3PURA 3GV4A 4FJCA 4O64A 3U5NA 2D8SA 1Z60A 5B77A 2MIQA 5DINA 4Q6FA 2YSJA 2M3HA 3T7LA 3ZNIA 4PTBA 1G25A 4UP5A 2KWNA 5D1MB 2QICA 1WEOA 5B78A 1WGMA 5EYAF 2ECWA 4A49A 1VYXA 3EB5A 2CSZA 2KWJA 2KWOA 5LKTA 2VNFA 4FK5A 5B76A 2EA6A 2KR4A 2L0BA 4ZQLA 1WFKA 1WILA 4YBTA 4IC2A 3O7AA 2L5UA 2E6RA 1LDKC 4YADA 2G45A 3NG2A 5D1KB 5G04B 5JG6A 4AP4A 2XB1A 3M63A 4X3GA 1U6GB 4YATA 5FEYA 1ZBDB 2G43A 1HYJA 1X4IA 2VJEA 2IDAA 3LQIA 2Y1MA 3IHPA 2MD8C 2LGGA 2L80A 4FIPA 2HDPA 4GNDA 4NN2A 4R2YA 4WZ0A 3RPGC 4TKPB 2CT2A 2ECVA 2PUYA 2NAAA 2LQ6A 2YHNA 2LXHC 3O35A 4YBMA 5B79A 2LRIC 3U5PA 1N87A 4YBSA 1F62A 3ASLA 2C2VS 5TDRA 2I50A 1WEUA 1DVPA 3SOUA 1WIMA 3L1ZB 4S3OB 2DX8A 1MM3A 4AVXA 1WEQA 1BORA 5D1LB 5B75A 1CHCA 4CCGX 2UZGA 3HTKC 4A4BA 3VK6A 1FP0A 3KQIA 2EGPA 4MSXA 2K1JA 4F52B 2KFTA 5H1TA 5FB1A 1WE9A 2H0DB 4YABA 3ZVYA 5J3XA 2VP7A 4FO9A 4BHWA 2VPGA 3O70A 4QF2A 4ZDTA 4LKAA 2RI7A 2M1RA 1X4UA 4V3LC 4XI1A 1VD4A 1WEPA 2KIZA 4LK9A 4AYCA 2F6NA 3M99A 3L1XA 3O36A 2KYUA 2YREA 3DQVR 3SOXA 4W4UA 3N9PA 2ECNA 5C11A 5DKAA 2MNYA 2ECGA 1WENA 4LADB 3ZVZB 5LCWB 2F6JA 2LV9A 2YQMA 1WEWA 1V87A 2MD7B 2K4DA 2CKLA 3HCTA 4AUQB 2VJFA 2LN0A 1HYIA 3QZVA 3L11A 1WEVA 2FUIA 2YHOA 2KGGA 3U5OA 5LKUA 4C9ZA 2ZETC 5H9MA 3C5KA 2KGIA 2G6QA 4YC9A 4MVTA 1Z2QA 3O37A 4ZUXU 3M62A 1T1HA 2MT5A 2YSMA 4WZ3B 2JMJA 2Y43A 4CA1A 4UI9B 2KWKA 1X4JA 4WZ2A 3C6WA 2VPDA 3I2DA 3O33A 4V3KC 3ZTGA 2KU3A 2YQLA 3ZPV1 4LLBA 2VJEB 3U5MA 3ZYQA 3FL2A 5LKZA 2QJ0A 2ECIA 2YUCA 3KV6A 5I3LA 2LGVA 5AIUA 1IYMA 3HCSA 4GNFA 4L58A 4L7XA 4GB0A 2LGLA 4I7BA 1E4UA 2HYED 4I7CA 2YU4A 1Z6UA 2LDRA 3T6RA 4S3OC 2JMIA 2JRJA 3SOWA 2FUUA 3MHHA 2YURA 5B8DA 2K16A 3ZPVE 2KREA 1XWHA 2YT5A 5FB0A 3PUQA 5G0FA 5AITA 3MHSA 5G05B 2YYRA
chains in the Genus database with same CATH superfamily
2XEUA 5TBNA 3N9LA 1LDJB 2QIZA 3LRQA 2MA6A 2PNXA 3H7HA 2M6MA 5TRBA 3DPLR 5H1UA 3N9QA 3O47A 2AN6A 3N9OA 1VFYA 4BBQA 2LAUA 2RSDA 2JMDA 4R7EA 2LGKA 5TABA 4N3WA 2F42A 4B7YC 2XP0A 3FM8C 4R8PK 3PHDA 2C2LA 2L43A 4AYCB 1WEEA 4LJNA 1WESA 5SVXA 4A0CD 4N4FA 2ECTA 2MA5A 2DSMA 1JM7A 2EODA 2VPEA 3O34A 4PPEA 3RPGB 2P57A 2YVRA 4B86C 3KV5A 1MM2A 4P5OB 3FEHA 2ECJA 3SHBA 5KH7A 3EB6A 2MUMA 4YAXA 5TDWA 2CSYA 2M85A 3N9MA 4I7DA 3V43A 2VPBA 2FSAA 4OGCA 4GNGA 2CKLB 5SVYA 3RTRB 2VJFB 3LQHA 4H9DA 5LKXA 3KDEC 2KE1A 1JM7B 1FBVA 2K17A 2YW8A 4GNEA 2LXPC 4A4CA 2Y1NA 3LQJA 5KH9A 5C13A 3GL6A 1K2FA 2MNZA 2CSVA 2BAYA 3N9NA 5FERA 1JOCA 1MBMA 4WA6A 2CONA 3KNVA 3HCUA 2H0DA 4IC3A 4QF3A 2IQJA 5KH3A 2L75A 4UP0A 2E6SA 5H1VA 1WEMA 4OGEA 1RMDA 2OXQC 3PURA 3GV4A 3LVQE 4FJCA 4O64A 3U5NA 2D8SA 1Z60A 5B77A 2MIQA 5DINA 4Q6FA 2YSJA 2M3HA 3T7LA 3ZNIA 3Q1DA 1DCQA 4PTBA 1G25A 4UP5A 2KWNA 5D1MB 2QICA 5SVIA 1WEOA 5B78A 3PLWA 1WGMA 5EYAF 2MKEA 2ECWA 4A49A 1VYXA 3EB5A 2CSZA 2KWJA 2KWOA 4Z0RA 5LKTA 2VNFA 4FK5A 3T9KA 5B76A 2EA6A 2KR4A 2L0BA 4ZQLA 1WFKA 1WILA 4YBTA 4IC2A 2OWAA 3O7AA 2L5UA 2E6RA 1LDKC 4YADA 2G45A 3MDBC 3NG2A 5D1KB 5G04B 5JG6A 4AP4A 2XB1A 3M63A 4X3GA 1U6GB 4YATA 5FEYA 1ZBDB 2G43A 1HYJA 1X4IA 2VJEA 2IDAA 3LQIA 2XOCA 2Y1MA 3IHPA 2MD8C 2LGGA 3JUEA 2L80A 4FIPA 2HDPA 4GNDA 4NN2A 4R2YA 4WZ0A 3RPGC 4TKPB 2CT2A 2ECVA 2PUYA 2NAAA 2LQ6A 3FAOA 2YHNA 2LXHC 2KKXA 3O35A 4YBMA 3FANA 2LRIC 5B79A 1N87A 4YBSA 3U5PA 1F62A 3ASLA 2C2VS 5TDRA 2I50A 1WEUA 1DVPA 3SOUA 1WIMA 3L1ZB 4S3OB 2DX8A 1MM3A 4AVXA 3M7KA 1WEQA 1BORA 5D1LB 5B75A 1CHCA 4CCGX 2RR4A 2UZGA 3HTKC 4A4BA 4QQ4A 2M13A 3VK6A 1FP0A 3KQIA 2EGPA 4MSXA 2K1JA 4F52B 2KFTA 5H1TA 2JM3A 4F1PA 5FB1A 1WE9A 2H0DB 4YABA 3ZVYA 5J3XA 2VP7A 3FJUB 4FO9A 4BHWA 2VPGA 3DWDA 5K3QA 3O70A 4QF2A 4ZDTA 4LKAA 2RI7A 2M1RA 1X4UA 4V3LC 4XI1A 1VD4A 1WEPA 2KIZA 4LK9A 4AYCA 2E61A 2F6NA 3M99A 3L1XA 3O36A 2KYUA 2YREA 3DQVR 3SOXA 4W4UA 3N9PA 2ECNA 5C11A 3LVRE 5SVIB 5DKAA 2MNYA 2ECGA 1WENA 4LADB 3ZVZB 5LCWB 2F6JA 2D8UA 2LV9A 2YQMA 1WEWA 1V87A 2MD7B 2K4DA 2EGMA 2CKLA 2FFWA 3HCTA 4AUQB 2VJFA 2LN0A 1HYIA 2FD4A 3QZVA 3L11A 1WEVA 2FUIA 3SUBA 2YHOA 2KGGA 3U5OA 2DJAA 5LKUA 2B0OE 4C9ZA 2L7PA 2ZETC 5H9MA 3C5KA 2KGIA 2G6QA 4YC9A 4MVTA 1Z2QA 3O37A 4ZUXU 2CRRA 3M62A 1T1HA 2MT5A 2YSMA 4WZ3B 2JMJA 2Y43A 4CA1A 4UI9B 2KWKA 1X4JA 4WZ2A 3C6WA 2VPDA 3LDYA 3I2DA 4O62A 3O33A 4V3KC 3ZTGA 3DDTA 2KU3A 2YQLA 3ZPV1 4LLBA 2VJEB 3U5MA 2CRWA 3ZYQA 3FL2A 5LKZA 2QJ0A 2ECIA 2YUCA 3KV6A 5I3LA 2JUNA 2LGVA 5AIUA 1IYMA 3HCSA 4GNFA 4L58A 4L7XA 4GB0A 2EXUA 2LGLA 4I7BA 1E4UA 2HYED 4I7CA 3LJUX 2YU4A 1Z6UA 4Z0OA 2KKYA 2LDRA 3T6RA 4S3OC 2JMIA 2JRJA 3SOWA 2FUUA 3MHHA 2XOZA 2YURA 5B8DA 2K16A 3E2DA 3ZPVE 2KREA 1XWHA 2YT5A 2XOYA 5FB0A 3PUQA 5G0FA 5AITA 3MHSA 5G05B 2YYRA
chains in the Genus database with same CATH topology
2XEUA 5TBNA 3N9LA 1LDJB 2QIZA 3LRQA 2MA6A 2PNXA 2M6MA 5TRBA 3DPLR 5H1UA 3N9QA 2AN6A 3N9OA 1VFYA 4BBQA 2RSDA 2JMDA 4R7EA 2LGKA 5TABA 4N3WA 2F42A 4B7YC 4R8PK 3PHDA 2C2LA 2L43A 4AYCB 1WEEA 4LJNA 1WESA 4A0CD 4N4FA 2ECTA 2MA5A 1JM7A 2EODA 2VPEA 3O34A 4PPEA 3RPGB 4B86C 3KV5A 1MM2A 4P5OB 2ECJA 3SHBA 5KH7A 3EB6A 2MUMA 4YAXA 5TDWA 2CSYA 2M85A 3N9MA 4I7DA 3V43A 2VPBA 2FSAA 4GNGA 2CKLB 3RTRB 2VJFB 3LQHA 5LKXA 2KE1A 1JM7B 1FBVA 2K17A 2YW8A 4GNEA 2LXPC 4A4CA 2Y1NA 3LQJA 5KH9A 5C13A 3GL6A 1K2FA 2MNZA 2BAYA 3N9NA 5FERA 1JOCA 4WA6A 3KNVA 3HCUA 2H0DA 4IC3A 4QF3A 5KH3A 2L75A 4UP0A 2E6SA 5H1VA 1WEMA 1RMDA 2OXQC 3PURA 3GV4A 4FJCA 4O64A 3U5NA 2D8SA 1Z60A 5B77A 2MIQA 5DINA 4Q6FA 2YSJA 2M3HA 3T7LA 3ZNIA 4PTBA 1G25A 4UP5A 2KWNA 5D1MB 2QICA 1WEOA 5B78A 1WGMA 5EYAF 2ECWA 4A49A 1VYXA 3EB5A 2CSZA 2KWJA 2KWOA 5LKTA 2VNFA 4FK5A 5B76A 2EA6A 2KR4A 2L0BA 4ZQLA 1WFKA 1WILA 4YBTA 4IC2A 3O7AA 2L5UA 2E6RA 1LDKC 4YADA 2G45A 3NG2A 5D1KB 5G04B 5JG6A 4AP4A 2XB1A 3M63A 4X3GA 1U6GB 4YATA 5FEYA 1ZBDB 2G43A 1HYJA 1X4IA 2VJEA 2IDAA 3LQIA 2Y1MA 3IHPA 2MD8C 2LGGA 2L80A 4FIPA 2HDPA 4GNDA 4NN2A 4R2YA 4WZ0A 3RPGC 4TKPB 2CT2A 2ECVA 2PUYA 2NAAA 2LQ6A 2YHNA 2LXHC 3O35A 4YBMA 5B79A 2LRIC 3U5PA 1N87A 4YBSA 1F62A 3ASLA 2C2VS 5TDRA 2I50A 1WEUA 1DVPA 3SOUA 1WIMA 3L1ZB 4S3OB 2DX8A 1MM3A 4AVXA 1WEQA 1BORA 5D1LB 5B75A 1CHCA 4CCGX 2UZGA 3HTKC 4A4BA 3VK6A 1FP0A 3KQIA 2EGPA 4MSXA 2K1JA 4F52B 2KFTA 5H1TA 5FB1A 1WE9A 2H0DB 4YABA 3ZVYA 5J3XA 2VP7A 4FO9A 4BHWA 2VPGA 3O70A 4QF2A 4ZDTA 4LKAA 2RI7A 2M1RA 1X4UA 4V3LC 4XI1A 1VD4A 1WEPA 2KIZA 4LK9A 4AYCA 2F6NA 3M99A 3L1XA 3O36A 2KYUA 2YREA 3DQVR 3SOXA 4W4UA 3N9PA 2ECNA 5C11A 5DKAA 2MNYA 2ECGA 1WENA 4LADB 3ZVZB 5LCWB 2F6JA 2LV9A 2YQMA 1WEWA 1V87A 2MD7B 2K4DA 2CKLA 3HCTA 4AUQB 2VJFA 2LN0A 1HYIA 3QZVA 3L11A 1WEVA 2FUIA 2YHOA 2KGGA 3U5OA 5LKUA 4C9ZA 2ZETC 5H9MA 3C5KA 2KGIA 2G6QA 4YC9A 4MVTA 1Z2QA 3O37A 4ZUXU 3M62A 1T1HA 2MT5A 2YSMA 4WZ3B 2JMJA 2Y43A 4CA1A 4UI9B 2KWKA 1X4JA 4WZ2A 3C6WA 2VPDA 3I2DA 3O33A 4V3KC 3ZTGA 2KU3A 2YQLA 3ZPV1 4LLBA 2VJEB 3U5MA 3ZYQA 3FL2A 5LKZA 2QJ0A 2ECIA 2YUCA 3KV6A 5I3LA 2LGVA 5AIUA 1IYMA 3HCSA 4GNFA 4L58A 4L7XA 4GB0A 2LGLA 4I7BA 1E4UA 2HYED 4I7CA 2YU4A 1Z6UA 2LDRA 3T6RA 4S3OC 2JMIA 2JRJA 3SOWA 2FUUA 3MHHA 2YURA 5B8DA 2K16A 3ZPVE 2KREA 1XWHA 2YT5A 5FB0A 3PUQA 5G0FA 5AITA 3MHSA 5G05B 2YYRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XEU A;  5TBN A;  3N9L A;  1LDJ B;  2QIZ A;  3LRQ A;  2MA6 A;  2PNX A;  2M6M A;  5TRB A;  3DPL R;  5H1U A;  3N9Q A;  2AN6 A;  3N9O A;  1VFY A;  4BBQ A;  2RSD A;  2JMD A;  4R7E A;  2LGK A;  5TAB A;  4N3W A;  2F42 A;  4B7Y C;  4R8P K;  3PHD A;  2C2L A;  2L43 A;  4AYC B;  1WEE A;  4LJN A;  1WES A;  4A0C D;  4N4F A;  2ECT A;  2MA5 A;  1JM7 A;  2EOD A;  2VPE A;  3O34 A;  4PPE A;  3RPG B;  4B86 C;  3KV5 A;  1MM2 A;  4P5O B;  2ECJ A;  3SHB A;  5KH7 A;  3EB6 A;  2MUM A;  4YAX A;  5TDW A;  2CSY A;  2M85 A;  3N9M A;  4I7D A;  3V43 A;  2VPB A;  2FSA A;  4GNG A;  2CKL B;  3RTR B;  2VJF B;  3LQH A;  5LKX A;  2KE1 A;  1JM7 B;  1FBV A;  2K17 A;  2YW8 A;  4GNE A;  2LXP C;  4A4C A;  2Y1N A;  3LQJ A;  5KH9 A;  5C13 A;  3GL6 A;  1K2F A;  2MNZ A;  2BAY A;  3N9N A;  5FER A;  1JOC A;  4WA6 A;  3KNV A;  3HCU A;  2H0D A;  4IC3 A;  4QF3 A;  5KH3 A;  2L75 A;  4UP0 A;  2E6S A;  5H1V A;  1WEM A;  1RMD A;  2OXQ C;  3PUR A;  3GV4 A;  4FJC A;  4O64 A;  3U5N A;  2D8S A;  1Z60 A;  5B77 A;  2MIQ A;  5DIN A;  4Q6F A;  2YSJ A;  2M3H A;  3T7L A;  3ZNI A;  4PTB A;  1G25 A;  4UP5 A;  2KWN A;  5D1M B;  2QIC A;  1WEO A;  5B78 A;  1WGM A;  5EYA F;  2ECW A;  4A49 A;  1VYX A;  3EB5 A;  2CSZ A;  2KWJ A;  2KWO A;  5LKT A;  2VNF A;  4FK5 A;  5B76 A;  2EA6 A;  2KR4 A;  2L0B A;  4ZQL A;  1WFK A;  1WIL A;  4YBT A;  4IC2 A;  3O7A A;  2L5U A;  2E6R A;  1LDK C;  4YAD A;  2G45 A;  3NG2 A;  5D1K B;  5G04 B;  5JG6 A;  4AP4 A;  2XB1 A;  3M63 A;  4X3G A;  1U6G B;  4YAT A;  5FEY A;  1ZBD B;  2G43 A;  1HYJ A;  1X4I A;  2VJE A;  2IDA A;  3LQI A;  2Y1M A;  3IHP A;  2MD8 C;  2LGG A;  2L80 A;  4FIP A;  2HDP A;  4GND A;  4NN2 A;  4R2Y A;  4WZ0 A;  3RPG C;  4TKP B;  2CT2 A;  2ECV A;  2PUY A;  2NAA A;  2LQ6 A;  2YHN A;  2LXH C;  3O35 A;  4YBM A;  5B79 A;  2LRI C;  3U5P A;  1N87 A;  4YBS A;  1F62 A;  3ASL A;  2C2V S;  5TDR A;  2I50 A;  1WEU A;  1DVP A;  3SOU A;  1WIM A;  3L1Z B;  4S3O B;  2DX8 A;  1MM3 A;  4AVX A;  1WEQ A;  1BOR A;  5D1L B;  5B75 A;  1CHC A;  4CCG X;  2UZG A;  3HTK C;  4A4B A;  3VK6 A;  1FP0 A;  3KQI A;  2EGP A;  4MSX A;  2K1J A;  4F52 B;  2KFT A;  5H1T A;  5FB1 A;  1WE9 A;  2H0D B;  4YAB A;  3ZVY A;  5J3X A;  2VP7 A;  4FO9 A;  4BHW A;  2VPG A;  3O70 A;  4QF2 A;  4ZDT A;  4LKA A;  2RI7 A;  2M1R A;  1X4U A;  4V3L C;  4XI1 A;  1VD4 A;  1WEP A;  2KIZ A;  4LK9 A;  4AYC A;  2F6N A;  3M99 A;  3L1X A;  3O36 A;  2KYU A;  2YRE A;  3DQV R;  3SOX A;  4W4U A;  3N9P A;  2ECN A;  5C11 A;  5DKA A;  2MNY A;  2ECG A;  1WEN A;  4LAD B;  3ZVZ B;  5LCW B;  2F6J A;  2LV9 A;  2YQM A;  1WEW A;  1V87 A;  2MD7 B;  2K4D A;  2CKL A;  3HCT A;  4AUQ B;  2VJF A;  2LN0 A;  1HYI A;  3QZV A;  3L11 A;  1WEV A;  2FUI A;  2YHO A;  2KGG A;  3U5O A;  5LKU A;  4C9Z A;  2ZET C;  5H9M A;  3C5K A;  2KGI A;  2G6Q A;  4YC9 A;  4MVT A;  1Z2Q A;  3O37 A;  4ZUX U;  3M62 A;  1T1H A;  2MT5 A;  2YSM A;  4WZ3 B;  2JMJ A;  2Y43 A;  4CA1 A;  4UI9 B;  2KWK A;  1X4J A;  4WZ2 A;  3C6W A;  2VPD A;  3I2D A;  3O33 A;  4V3K C;  3ZTG A;  2KU3 A;  2YQL A;  3ZPV 1;  4LLB A;  2VJE B;  3U5M A;  3ZYQ A;  3FL2 A;  5LKZ A;  2QJ0 A;  2ECI A;  2YUC A;  3KV6 A;  5I3L A;  2LGV A;  5AIU A;  1IYM A;  3HCS A;  4GNF A;  4L58 A;  4L7X A;  4GB0 A;  2LGL A;  4I7B A;  1E4U A;  2HYE D;  4I7C A;  2YU4 A;  1Z6U A;  2LDR A;  3T6R A;  4S3O C;  2JMI A;  2JRJ A;  3SOW A;  2FUU A;  3MHH A;  2YUR A;  5B8D A;  2K16 A;  3ZPV E;  2KRE A;  1XWH A;  2YT5 A;  5FB0 A;  3PUQ A;  5G0F A;  5AIT A;  3MHS A;  5G05 B;  2YYR A; 
#chains in the Genus database with same CATH topology
 2XEU A;  5TBN A;  3N9L A;  1LDJ B;  2QIZ A;  3LRQ A;  2MA6 A;  2PNX A;  3H7H A;  2M6M A;  5TRB A;  3DPL R;  5H1U A;  3N9Q A;  3O47 A;  2AN6 A;  3N9O A;  1VFY A;  4BBQ A;  2LAU A;  2RSD A;  2JMD A;  4R7E A;  2LGK A;  5TAB A;  4N3W A;  2F42 A;  4B7Y C;  2XP0 A;  3FM8 C;  4R8P K;  3PHD A;  2C2L A;  2L43 A;  4AYC B;  1WEE A;  4LJN A;  1WES A;  5SVX A;  4A0C D;  4N4F A;  2ECT A;  2MA5 A;  2DSM A;  1JM7 A;  2EOD A;  2VPE A;  3O34 A;  4PPE A;  3RPG B;  2P57 A;  2YVR A;  4B86 C;  3KV5 A;  1MM2 A;  4P5O B;  3FEH A;  2ECJ A;  3SHB A;  5KH7 A;  3EB6 A;  2MUM A;  4YAX A;  5TDW A;  2CSY A;  2M85 A;  3N9M A;  4I7D A;  3V43 A;  2VPB A;  2FSA A;  4OGC A;  4GNG A;  2CKL B;  5SVY A;  3RTR B;  2VJF B;  3LQH A;  4H9D A;  5LKX A;  3KDE C;  2KE1 A;  1JM7 B;  1FBV A;  2K17 A;  2YW8 A;  4GNE A;  2LXP C;  4A4C A;  2Y1N A;  3LQJ A;  5KH9 A;  5C13 A;  3GL6 A;  1K2F A;  2MNZ A;  2CSV A;  2BAY A;  3N9N A;  5FER A;  1JOC A;  1MBM A;  4WA6 A;  2CON A;  3KNV A;  3HCU A;  2H0D A;  4IC3 A;  4QF3 A;  2IQJ A;  5KH3 A;  2L75 A;  4UP0 A;  2E6S A;  5H1V A;  1WEM A;  4OGE A;  1RMD A;  2OXQ C;  3PUR A;  3GV4 A;  3LVQ E;  4FJC A;  4O64 A;  3U5N A;  2D8S A;  1Z60 A;  5B77 A;  2MIQ A;  5DIN A;  4Q6F A;  2YSJ A;  2M3H A;  3T7L A;  3ZNI A;  3Q1D A;  1DCQ A;  4PTB A;  1G25 A;  4UP5 A;  2KWN A;  5D1M B;  2QIC A;  5SVI A;  1WEO A;  5B78 A;  3PLW A;  1WGM A;  5EYA F;  2MKE A;  2ECW A;  4A49 A;  1VYX A;  3EB5 A;  2CSZ A;  2KWJ A;  2KWO A;  4Z0R A;  5LKT A;  2VNF A;  4FK5 A;  3T9K A;  5B76 A;  2EA6 A;  2KR4 A;  2L0B A;  4ZQL A;  1WFK A;  1WIL A;  4YBT A;  4IC2 A;  2OWA A;  3O7A A;  2L5U A;  2E6R A;  1LDK C;  4YAD A;  2G45 A;  3MDB C;  3NG2 A;  5D1K B;  5G04 B;  5JG6 A;  4AP4 A;  2XB1 A;  3M63 A;  4X3G A;  1U6G B;  4YAT A;  5FEY A;  1ZBD B;  2G43 A;  1HYJ A;  1X4I A;  2VJE A;  2IDA A;  3LQI A;  2XOC A;  2Y1M A;  3IHP A;  2MD8 C;  2LGG A;  3JUE A;  2L80 A;  4FIP A;  2HDP A;  4GND A;  4NN2 A;  4R2Y A;  4WZ0 A;  3RPG C;  4TKP B;  2CT2 A;  2ECV A;  2PUY A;  2NAA A;  2LQ6 A;  3FAO A;  2YHN A;  2LXH C;  2KKX A;  3O35 A;  4YBM A;  3FAN A;  2LRI C;  5B79 A;  1N87 A;  4YBS A;  3U5P A;  1F62 A;  3ASL A;  2C2V S;  5TDR A;  2I50 A;  1WEU A;  1DVP A;  3SOU A;  1WIM A;  3L1Z B;  4S3O B;  2DX8 A;  1MM3 A;  4AVX A;  3M7K A;  1WEQ A;  1BOR A;  5D1L B;  5B75 A;  1CHC A;  4CCG X;  2RR4 A;  2UZG A;  3HTK C;  4A4B A;  4QQ4 A;  2M13 A;  3VK6 A;  1FP0 A;  3KQI A;  2EGP A;  4MSX A;  2K1J A;  4F52 B;  2KFT A;  5H1T A;  2JM3 A;  4F1P A;  5FB1 A;  1WE9 A;  2H0D B;  4YAB A;  3ZVY A;  5J3X A;  2VP7 A;  3FJU B;  4FO9 A;  4BHW A;  2VPG A;  3DWD A;  5K3Q A;  3O70 A;  4QF2 A;  4ZDT A;  4LKA A;  2RI7 A;  2M1R A;  1X4U A;  4V3L C;  4XI1 A;  1VD4 A;  1WEP A;  2KIZ A;  4LK9 A;  4AYC A;  2E61 A;  2F6N A;  3M99 A;  3L1X A;  3O36 A;  2KYU A;  2YRE A;  3DQV R;  3SOX A;  4W4U A;  3N9P A;  2ECN A;  5C11 A;  3LVR E;  5SVI B;  5DKA A;  2MNY A;  2ECG A;  1WEN A;  4LAD B;  3ZVZ B;  5LCW B;  2F6J A;  2D8U A;  2LV9 A;  2YQM A;  1WEW A;  1V87 A;  2MD7 B;  2K4D A;  2EGM A;  2CKL A;  2FFW A;  3HCT A;  4AUQ B;  2VJF A;  2LN0 A;  1HYI A;  2FD4 A;  3QZV A;  3L11 A;  1WEV A;  2FUI A;  3SUB A;  2YHO A;  2KGG A;  3U5O A;  2DJA A;  5LKU A;  2B0O E;  4C9Z A;  2L7P A;  2ZET C;  5H9M A;  3C5K A;  2KGI A;  2G6Q A;  4YC9 A;  4MVT A;  1Z2Q A;  3O37 A;  4ZUX U;  2CRR A;  3M62 A;  1T1H A;  2MT5 A;  2YSM A;  4WZ3 B;  2JMJ A;  2Y43 A;  4CA1 A;  4UI9 B;  2KWK A;  1X4J A;  4WZ2 A;  3C6W A;  2VPD A;  3LDY A;  3I2D A;  4O62 A;  3O33 A;  4V3K C;  3ZTG A;  3DDT A;  2KU3 A;  2YQL A;  3ZPV 1;  4LLB A;  2VJE B;  3U5M A;  2CRW A;  3ZYQ A;  3FL2 A;  5LKZ A;  2QJ0 A;  2ECI A;  2YUC A;  3KV6 A;  5I3L A;  2JUN A;  2LGV A;  5AIU A;  1IYM A;  3HCS A;  4GNF A;  4L58 A;  4L7X A;  4GB0 A;  2EXU A;  2LGL A;  4I7B A;  1E4U A;  2HYE D;  4I7C A;  3LJU X;  2YU4 A;  1Z6U A;  4Z0O A;  2KKY A;  2LDR A;  3T6R A;  4S3O C;  2JMI A;  2JRJ A;  3SOW A;  2FUU A;  3MHH A;  2XOZ A;  2YUR A;  5B8D A;  2K16 A;  3E2D A;  3ZPV E;  2KRE A;  1XWH A;  2YT5 A;  2XOY A;  5FB0 A;  3PUQ A;  5G0F A;  5AIT A;  3MHS A;  5G05 B;  2YYR A; 
#chains in the Genus database with same CATH homology
 2XEU A;  5TBN A;  3N9L A;  1LDJ B;  2QIZ A;  3LRQ A;  2MA6 A;  2PNX A;  2M6M A;  5TRB A;  3DPL R;  5H1U A;  3N9Q A;  2AN6 A;  3N9O A;  1VFY A;  4BBQ A;  2RSD A;  2JMD A;  4R7E A;  2LGK A;  5TAB A;  4N3W A;  2F42 A;  4B7Y C;  4R8P K;  3PHD A;  2C2L A;  2L43 A;  4AYC B;  1WEE A;  4LJN A;  1WES A;  4A0C D;  4N4F A;  2ECT A;  2MA5 A;  1JM7 A;  2EOD A;  2VPE A;  3O34 A;  4PPE A;  3RPG B;  4B86 C;  3KV5 A;  1MM2 A;  4P5O B;  2ECJ A;  3SHB A;  5KH7 A;  3EB6 A;  2MUM A;  4YAX A;  5TDW A;  2CSY A;  2M85 A;  3N9M A;  4I7D A;  3V43 A;  2VPB A;  2FSA A;  4GNG A;  2CKL B;  3RTR B;  2VJF B;  3LQH A;  5LKX A;  2KE1 A;  1JM7 B;  1FBV A;  2K17 A;  2YW8 A;  4GNE A;  2LXP C;  4A4C A;  2Y1N A;  3LQJ A;  5KH9 A;  5C13 A;  3GL6 A;  1K2F A;  2MNZ A;  2BAY A;  3N9N A;  5FER A;  1JOC A;  4WA6 A;  3KNV A;  3HCU A;  2H0D A;  4IC3 A;  4QF3 A;  5KH3 A;  2L75 A;  4UP0 A;  2E6S A;  5H1V A;  1WEM A;  1RMD A;  2OXQ C;  3PUR A;  3GV4 A;  4FJC A;  4O64 A;  3U5N A;  2D8S A;  1Z60 A;  5B77 A;  2MIQ A;  5DIN A;  4Q6F A;  2YSJ A;  2M3H A;  3T7L A;  3ZNI A;  4PTB A;  1G25 A;  4UP5 A;  2KWN A;  5D1M B;  2QIC A;  1WEO A;  5B78 A;  1WGM A;  5EYA F;  2ECW A;  4A49 A;  1VYX A;  3EB5 A;  2CSZ A;  2KWJ A;  2KWO A;  5LKT A;  2VNF A;  4FK5 A;  5B76 A;  2EA6 A;  2KR4 A;  2L0B A;  4ZQL A;  1WFK A;  1WIL A;  4YBT A;  4IC2 A;  3O7A A;  2L5U A;  2E6R A;  1LDK C;  4YAD A;  2G45 A;  3NG2 A;  5D1K B;  5G04 B;  5JG6 A;  4AP4 A;  2XB1 A;  3M63 A;  4X3G A;  1U6G B;  4YAT A;  5FEY A;  1ZBD B;  2G43 A;  1HYJ A;  1X4I A;  2VJE A;  2IDA A;  3LQI A;  2Y1M A;  3IHP A;  2MD8 C;  2LGG A;  2L80 A;  4FIP A;  2HDP A;  4GND A;  4NN2 A;  4R2Y A;  4WZ0 A;  3RPG C;  4TKP B;  2CT2 A;  2ECV A;  2PUY A;  2NAA A;  2LQ6 A;  2YHN A;  2LXH C;  3O35 A;  4YBM A;  5B79 A;  2LRI C;  3U5P A;  1N87 A;  4YBS A;  1F62 A;  3ASL A;  2C2V S;  5TDR A;  2I50 A;  1WEU A;  1DVP A;  3SOU A;  1WIM A;  3L1Z B;  4S3O B;  2DX8 A;  1MM3 A;  4AVX A;  1WEQ A;  1BOR A;  5D1L B;  5B75 A;  1CHC A;  4CCG X;  2UZG A;  3HTK C;  4A4B A;  3VK6 A;  1FP0 A;  3KQI A;  2EGP A;  4MSX A;  2K1J A;  4F52 B;  2KFT A;  5H1T A;  5FB1 A;  1WE9 A;  2H0D B;  4YAB A;  3ZVY A;  5J3X A;  2VP7 A;  4FO9 A;  4BHW A;  2VPG A;  3O70 A;  4QF2 A;  4ZDT A;  4LKA A;  2RI7 A;  2M1R A;  1X4U A;  4V3L C;  4XI1 A;  1VD4 A;  1WEP A;  2KIZ A;  4LK9 A;  4AYC A;  2F6N A;  3M99 A;  3L1X A;  3O36 A;  2KYU A;  2YRE A;  3DQV R;  3SOX A;  4W4U A;  3N9P A;  2ECN A;  5C11 A;  5DKA A;  2MNY A;  2ECG A;  1WEN A;  4LAD B;  3ZVZ B;  5LCW B;  2F6J A;  2LV9 A;  2YQM A;  1WEW A;  1V87 A;  2MD7 B;  2K4D A;  2CKL A;  3HCT A;  4AUQ B;  2VJF A;  2LN0 A;  1HYI A;  3QZV A;  3L11 A;  1WEV A;  2FUI A;  2YHO A;  2KGG A;  3U5O A;  5LKU A;  4C9Z A;  2ZET C;  5H9M A;  3C5K A;  2KGI A;  2G6Q A;  4YC9 A;  4MVT A;  1Z2Q A;  3O37 A;  4ZUX U;  3M62 A;  1T1H A;  2MT5 A;  2YSM A;  4WZ3 B;  2JMJ A;  2Y43 A;  4CA1 A;  4UI9 B;  2KWK A;  1X4J A;  4WZ2 A;  3C6W A;  2VPD A;  3I2D A;  3O33 A;  4V3K C;  3ZTG A;  2KU3 A;  2YQL A;  3ZPV 1;  4LLB A;  2VJE B;  3U5M A;  3ZYQ A;  3FL2 A;  5LKZ A;  2QJ0 A;  2ECI A;  2YUC A;  3KV6 A;  5I3L A;  2LGV A;  5AIU A;  1IYM A;  3HCS A;  4GNF A;  4L58 A;  4L7X A;  4GB0 A;  2LGL A;  4I7B A;  1E4U A;  2HYE D;  4I7C A;  2YU4 A;  1Z6U A;  2LDR A;  3T6R A;  4S3O C;  2JMI A;  2JRJ A;  3SOW A;  2FUU A;  3MHH A;  2YUR A;  5B8D A;  2K16 A;  3ZPV E;  2KRE A;  1XWH A;  2YT5 A;  5FB0 A;  3PUQ A;  5G0F A;  5AIT A;  3MHS A;  5G05 B;  2YYR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...