4S3OC

Pcgf5-ring1b-ubch5c complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
96
structure length
95
Chain Sequence
KHLVKDFNPYITCYICKGYLIKPTTVTECLHTFCKTCIVQHFEDSNDCPRCGNQVETNPLEMLRLDNTLEEIIFKLVPGLREQELERESEFWKKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-conjugating enzyme E2 D3
publication title BMI1-RING1B is an autoinhibited RING E3 ubiquitin ligase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/transcription
total genus 25
structure length 95
sequence length 96
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4s3oC00
2M3HA 1JOCA 2FUIA 2L5UA 2PNXA 2YQLA 2YREA 5LCWB 1N87A 4BHWA 1K2FA 3ZPV1 3GL6A 2M85A 1WEMA 4I7BA 4YADA 2G45A 2E6RA 3U5PA 5KH3A 2L43A 3L11A 2K1JA 4MSXA 4N3WA 1JM7A 5G05B 3IHPA 5TBNA 3LQIA 2L80A 4C9ZA 3EB5A 2KYUA 2QICA 2YU4A 1JM7B 2KR4A 1Z60A 1DVPA 4AYCA 4L7XA 3M62A 2YSJA 1HYIA 3N9QA 4I7CA 4FJCA 3HCSA 2YYRA 4GNGA 1V87A 4AYCB 3I2DA 4A4BA 1XWHA 3N9LA 2M1RA 3QZVA 5J3XA 4YATA 3ZVZB 2LGKA 2JRJA 1WEUA 3RPGB 5H1TA 2VPEA 2VPGA 2MD7B 5TRBA 4PTBA 2HYED 3MHHA 3LRQA 2HDPA 4FK5A 2VPDA 4LK9A 2VJFA 4YBSA 2XEUA 3M99A 5G04B 4R7EA 2VJFB 4QF3A 4IC2A 4AVXA 5KH9A 3O70A 2PUYA 4LADB 2M6MA 2KGGA 2K16A 2KIZA 3KV5A 2JMDA 1BORA 2KWNA 5FERA 1WEWA 2MIQA 3HCTA 2VPBA 2MA5A 5D1KB 5B75A 3GV4A 3MHSA 2AN6A 2BAYA 1MM2A 1CHCA 2Y1MA 3O36A 5LKTA 1FBVA 4A49A 5H1VA 3O35A 3KNVA 2CSYA 5C13A 4GB0A 4ZQLA 4S3OC 5B77A 3N9NA 3O34A 4WZ0A 4R8PK 2LV9A 4Q6FA 4I7DA 2NAAA 2ECWA 2EA6A 3FL2A 4YBMA 5D1LB 2VP7A 1G25A 2YURA 3ZNIA 2KWOA 2E6SA 3N9OA 3ZPVE 3L1XA 4ZDTA 1WGMA 1HYJA 2MUMA 4O64A 4S3OB 1LDJB 2JMJA 3C6WA 2OXQC 5TDWA 4CA1A 3DPLR 5TABA 5FEYA 1WESA 2Y1NA 3M63A 2KGIA 2CKLA 2YHOA 5EYAF 3U5OA 2IDAA 2ECVA 1FP0A 3ZTGA 1Z2QA 1MM3A 5FB0A 2XB1A 1RMDA 5LKZA 4L58A 4V3LC 4WZ2A 2L0BA 4FIPA 3HCUA 4FO9A 4CCGX 2MT5A 2VJEA 4BBQA 4QF2A 2H0DA 1WFKA 2CSZA 2KU3A 5AIUA 4B86C 4B7YC 4UI9B 3ZYQA 2KWJA 5FB1A 5DKAA 1WEOA 1X4IA 5LKXA 2H0DB 2RI7A 5B78A 3U5MA 3L1ZB 4YABA 2MA6A 1Z6UA 2D8SA 4YBTA 3ASLA 2MD8C 3KQIA 2YSMA 4UP0A 3U5NA 2ECNA 4XI1A 1E4UA 2Y43A 4UP5A 3LQHA 2ZETC 3PUQA 5AITA 2VNFA 1IYMA 2FSAA 4AUQB 3V43A 2LDRA 4NN2A 2ECTA 1LDKC 2LGLA 1F62A 2QIZA 1WEEA 4YAXA 3SHBA 4YC9A 1WENA 4N4FA 2ECJA 3EB6A 2MNZA 3T6RA 4MVTA 2KWKA 3C5KA 2LRIC 5B76A 4R2YA 3SOXA 1WILA 3SOUA 2G6QA 5I3LA 3N9MA 3O7AA 1WE9A 1VYXA 1X4UA 2YUCA 1WEQA 2MNYA 3PURA 3SOWA 2YQMA 2YHNA 2L75A 2FUUA 5H9MA 5TDRA 4IC3A 2KFTA 3RPGC 4LJNA 1ZBDB 3VK6A 4V3KC 3RTRB 3N9PA 2F6JA 2C2VS 4GNEA 2UZGA 3O33A 4F52B 4GNFA 4P5OB 2CKLB 3DQVR 4A4CA 5LKUA 2G43A 4AP4A 5JG6A 2F42A 2ECIA 2KREA 5C11A 2JMIA 2LGVA 5B79A 1VD4A 1X4JA 4LKAA 2DX8A 3ZVYA 4ZUXU 2ECGA 5D1MB 2LGGA 1VFYA 1T1HA 3KV6A 5H1UA 2KE1A 2EODA 4W4UA 2VJEB 3NG2A 5KH7A 5B8DA 2LXPC 5G0FA 2K17A 3PHDA 4X3GA 3O37A 2C2LA 5DINA 2YW8A 2QJ0A 4GNDA 3T7LA 2K4DA 4PPEA 2LN0A 2LQ6A 4A0CD 2LXHC 4TKPB 2CT2A 2I50A 3LQJA 4WA6A 2RSDA 4WZ3B 4LLBA 1WIMA 2YT5A 2F6NA 1WEPA 2EGPA 1U6GB 3HTKC 1WEVA
chains in the Genus database with same CATH superfamily
2M3HA 1JOCA 3H7HA 2FUIA 2L5UA 2PNXA 2YQLA 2YREA 5LCWB 1N87A 4BHWA 1K2FA 3ZPV1 3GL6A 2M85A 1WEMA 4I7BA 4YADA 2G45A 2E6RA 3U5PA 2P57A 5KH3A 2L43A 3L11A 2DJAA 2K1JA 4MSXA 4N3WA 2XP0A 1JM7A 5G05B 3IHPA 3FJUB 5TBNA 3LQIA 2L80A 4C9ZA 3EB5A 2KYUA 2QICA 2YU4A 1JM7B 2KR4A 1Z60A 1DVPA 4AYCA 4L7XA 3M62A 2YSJA 1HYIA 3N9QA 4I7CA 4FJCA 3M7KA 3HCSA 2YYRA 4GNGA 1V87A 5SVYA 4AYCB 3I2DA 4A4BA 1XWHA 3O47A 3N9LA 2M1RA 3QZVA 5J3XA 4YATA 3FM8C 3ZVZB 2LGKA 2JRJA 1WEUA 3JUEA 3RPGB 5H1TA 2VPEA 2VPGA 2MD7B 2XOCA 5TRBA 4PTBA 2HYED 3MHHA 3LRQA 2HDPA 4FK5A 3FAOA 2VPDA 4LK9A 2VJFA 4YBSA 2XEUA 3M99A 2B0OE 5G04B 4Z0RA 4R7EA 2VJFB 4QF3A 4IC2A 4AVXA 5KH9A 3O70A 2PUYA 4LADB 2M6MA 1DCQA 2KGGA 2K16A 2KIZA 3KV5A 2JMDA 1BORA 2KWNA 5FERA 1WEWA 2MIQA 3HCTA 2VPBA 3KDEC 2MA5A 5D1KB 5B75A 2KKXA 3GV4A 3MHSA 2AN6A 2BAYA 1MM2A 1CHCA 2Y1MA 3O36A 2DSMA 5LKTA 1FBVA 3LVRE 4A49A 5H1VA 3O35A 3KNVA 4OGEA 2CSYA 5C13A 5K3QA 4GB0A 4ZQLA 4S3OC 5B77A 5SVXA 3N9NA 3O34A 4WZ0A 4R8PK 2LV9A 4Q6FA 4I7DA 2NAAA 2ECWA 2EA6A 3FL2A 4YBMA 3LJUX 5D1LB 2VP7A 1G25A 2YURA 3ZNIA 2KWOA 2E6SA 3N9OA 3ZPVE 3L1XA 4ZDTA 2L7PA 1WGMA 1HYJA 4OGCA 2MUMA 4O64A 4S3OB 1LDJB 2JMJA 4H9DA 3C6WA 2OXQC 5TDWA 4CA1A 3DPLR 5TABA 4Z0OA 5FEYA 1WESA 2Y1NA 3M63A 2KGIA 2CKLA 2YHOA 3LVQE 5EYAF 3U5OA 2IDAA 2ECVA 1MBMA 1FP0A 3ZTGA 1Z2QA 2IQJA 1MM3A 5FB0A 2XB1A 1RMDA 5LKZA 4L58A 4V3LC 4WZ2A 2L0BA 4FIPA 3HCUA 4FO9A 4CCGX 2MT5A 3DDTA 2VJEA 4BBQA 2KKYA 4QF2A 2H0DA 1WFKA 2CSZA 2KU3A 5AIUA 4B86C 4QQ4A 4B7YC 4UI9B 3PLWA 2CRRA 3ZYQA 2KWJA 5FB1A 5DKAA 1WEOA 1X4IA 5LKXA 2H0DB 2RI7A 5B78A 3U5MA 3L1ZB 4YABA 2MA6A 1Z6UA 2D8SA 4YBTA 3ASLA 2MD8C 3KQIA 3MDBC 2MKEA 2YSMA 4UP0A 3U5NA 2ECNA 4XI1A 1E4UA 3FEHA 4O62A 2Y43A 4UP5A 3LQHA 2ZETC 3PUQA 5AITA 2VNFA 1IYMA 3T9KA 2CRWA 2FSAA 4AUQB 3V43A 2LDRA 4NN2A 2ECTA 1LDKC 2LGLA 1F62A 2QIZA 1WEEA 4YAXA 2XOZA 3SHBA 3E2DA 4YC9A 1WENA 4N4FA 2ECJA 3EB6A 2MNZA 3T6RA 4MVTA 2KWKA 3C5KA 2LRIC 5B76A 4R2YA 3SOXA 2YVRA 1WILA 3SOUA 2G6QA 5I3LA 3N9MA 3FANA 3O7AA 3SUBA 3Q1DA 1WE9A 1VYXA 1X4UA 2OWAA 2D8UA 2YUCA 1WEQA 2MNYA 3PURA 3SOWA 2YQMA 2YHNA 2L75A 2FUUA 5H9MA 5TDRA 4IC3A 2KFTA 3RPGC 4LJNA 1ZBDB 3VK6A 4V3KC 3RTRB 3N9PA 2F6JA 2C2VS 4GNEA 2UZGA 3O33A 4F52B 4GNFA 4P5OB 2CKLB 3DQVR 4F1PA 4A4CA 5LKUA 2G43A 4AP4A 5JG6A 2F42A 2ECIA 2KREA 5C11A 2JMIA 2LGVA 5B79A 2JUNA 5SVIA 1VD4A 1X4JA 2FD4A 2RR4A 4LKAA 2DX8A 3ZVYA 4ZUXU 2ECGA 5D1MB 2LGGA 2EGMA 5SVIB 1VFYA 2M13A 1T1HA 3KV6A 5H1UA 2KE1A 2EODA 4W4UA 2VJEB 3NG2A 5KH7A 5B8DA 2LXPC 2CONA 5G0FA 2XOYA 2K17A 2JM3A 3PHDA 4X3GA 3O37A 2C2LA 5DINA 2YW8A 3DWDA 2QJ0A 4GNDA 3T7LA 2FFWA 2EXUA 2K4DA 4PPEA 2LN0A 2LQ6A 4A0CD 2CSVA 2LXHC 4TKPB 2CT2A 2I50A 3LQJA 4WA6A 2E61A 2RSDA 4WZ3B 2LAUA 4LLBA 1WIMA 2YT5A 2F6NA 1WEPA 2EGPA 1U6GB 3HTKC 3LDYA 1WEVA
chains in the Genus database with same CATH topology
2M3HA 1JOCA 2FUIA 2L5UA 2PNXA 2YQLA 2YREA 5LCWB 1N87A 4BHWA 1K2FA 3ZPV1 3GL6A 2M85A 1WEMA 4I7BA 4YADA 2G45A 2E6RA 3U5PA 5KH3A 2L43A 3L11A 2K1JA 4MSXA 4N3WA 1JM7A 5G05B 3IHPA 5TBNA 3LQIA 2L80A 4C9ZA 3EB5A 2KYUA 2QICA 2YU4A 1JM7B 2KR4A 1Z60A 1DVPA 4AYCA 4L7XA 3M62A 2YSJA 1HYIA 3N9QA 4I7CA 4FJCA 3HCSA 2YYRA 4GNGA 1V87A 4AYCB 3I2DA 4A4BA 1XWHA 3N9LA 2M1RA 3QZVA 5J3XA 4YATA 3ZVZB 2LGKA 2JRJA 1WEUA 3RPGB 5H1TA 2VPEA 2VPGA 2MD7B 5TRBA 4PTBA 2HYED 3MHHA 3LRQA 2HDPA 4FK5A 2VPDA 4LK9A 2VJFA 4YBSA 2XEUA 3M99A 5G04B 4R7EA 2VJFB 4QF3A 4IC2A 4AVXA 5KH9A 3O70A 2PUYA 4LADB 2M6MA 2KGGA 2K16A 2KIZA 3KV5A 2JMDA 1BORA 2KWNA 5FERA 1WEWA 2MIQA 3HCTA 2VPBA 2MA5A 5D1KB 5B75A 3GV4A 3MHSA 2AN6A 2BAYA 1MM2A 1CHCA 2Y1MA 3O36A 5LKTA 1FBVA 4A49A 5H1VA 3O35A 3KNVA 2CSYA 5C13A 4GB0A 4ZQLA 4S3OC 5B77A 3N9NA 3O34A 4WZ0A 4R8PK 2LV9A 4Q6FA 4I7DA 2NAAA 2ECWA 2EA6A 3FL2A 4YBMA 5D1LB 2VP7A 1G25A 2YURA 3ZNIA 2KWOA 2E6SA 3N9OA 3ZPVE 3L1XA 4ZDTA 1WGMA 1HYJA 2MUMA 4O64A 4S3OB 1LDJB 2JMJA 3C6WA 2OXQC 5TDWA 4CA1A 3DPLR 5TABA 5FEYA 1WESA 2Y1NA 3M63A 2KGIA 2CKLA 2YHOA 5EYAF 3U5OA 2IDAA 2ECVA 1FP0A 3ZTGA 1Z2QA 1MM3A 5FB0A 2XB1A 1RMDA 5LKZA 4L58A 4V3LC 4WZ2A 2L0BA 4FIPA 3HCUA 4FO9A 4CCGX 2MT5A 2VJEA 4BBQA 4QF2A 2H0DA 1WFKA 2CSZA 2KU3A 5AIUA 4B86C 4B7YC 4UI9B 3ZYQA 2KWJA 5FB1A 5DKAA 1WEOA 1X4IA 5LKXA 2H0DB 2RI7A 5B78A 3U5MA 3L1ZB 4YABA 2MA6A 1Z6UA 2D8SA 4YBTA 3ASLA 2MD8C 3KQIA 2YSMA 4UP0A 3U5NA 2ECNA 4XI1A 1E4UA 2Y43A 4UP5A 3LQHA 2ZETC 3PUQA 5AITA 2VNFA 1IYMA 2FSAA 4AUQB 3V43A 2LDRA 4NN2A 2ECTA 1LDKC 2LGLA 1F62A 2QIZA 1WEEA 4YAXA 3SHBA 4YC9A 1WENA 4N4FA 2ECJA 3EB6A 2MNZA 3T6RA 4MVTA 2KWKA 3C5KA 2LRIC 5B76A 4R2YA 3SOXA 1WILA 3SOUA 2G6QA 5I3LA 3N9MA 3O7AA 1WE9A 1VYXA 1X4UA 2YUCA 1WEQA 2MNYA 3PURA 3SOWA 2YQMA 2YHNA 2L75A 2FUUA 5H9MA 5TDRA 4IC3A 2KFTA 3RPGC 4LJNA 1ZBDB 3VK6A 4V3KC 3RTRB 3N9PA 2F6JA 2C2VS 4GNEA 2UZGA 3O33A 4F52B 4GNFA 4P5OB 2CKLB 3DQVR 4A4CA 5LKUA 2G43A 4AP4A 5JG6A 2F42A 2ECIA 2KREA 5C11A 2JMIA 2LGVA 5B79A 1VD4A 1X4JA 4LKAA 2DX8A 3ZVYA 4ZUXU 2ECGA 5D1MB 2LGGA 1VFYA 1T1HA 3KV6A 5H1UA 2KE1A 2EODA 4W4UA 2VJEB 3NG2A 5KH7A 5B8DA 2LXPC 5G0FA 2K17A 3PHDA 4X3GA 3O37A 2C2LA 5DINA 2YW8A 2QJ0A 4GNDA 3T7LA 2K4DA 4PPEA 2LN0A 2LQ6A 4A0CD 2LXHC 4TKPB 2CT2A 2I50A 3LQJA 4WA6A 2RSDA 4WZ3B 4LLBA 1WIMA 2YT5A 2F6NA 1WEPA 2EGPA 1U6GB 3HTKC 1WEVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M3H A;  1JOC A;  2FUI A;  2L5U A;  2PNX A;  2YQL A;  2YRE A;  5LCW B;  1N87 A;  4BHW A;  1K2F A;  3ZPV 1;  3GL6 A;  2M85 A;  1WEM A;  4I7B A;  4YAD A;  2G45 A;  2E6R A;  3U5P A;  5KH3 A;  2L43 A;  3L11 A;  2K1J A;  4MSX A;  4N3W A;  1JM7 A;  5G05 B;  3IHP A;  5TBN A;  3LQI A;  2L80 A;  4C9Z A;  3EB5 A;  2KYU A;  2QIC A;  2YU4 A;  1JM7 B;  2KR4 A;  1Z60 A;  1DVP A;  4AYC A;  4L7X A;  3M62 A;  2YSJ A;  1HYI A;  3N9Q A;  4I7C A;  4FJC A;  3HCS A;  2YYR A;  4GNG A;  1V87 A;  4AYC B;  3I2D A;  4A4B A;  1XWH A;  3N9L A;  2M1R A;  3QZV A;  5J3X A;  4YAT A;  3ZVZ B;  2LGK A;  2JRJ A;  1WEU A;  3RPG B;  5H1T A;  2VPE A;  2VPG A;  2MD7 B;  5TRB A;  4PTB A;  2HYE D;  3MHH A;  3LRQ A;  2HDP A;  4FK5 A;  2VPD A;  4LK9 A;  2VJF A;  4YBS A;  2XEU A;  3M99 A;  5G04 B;  4R7E A;  2VJF B;  4QF3 A;  4IC2 A;  4AVX A;  5KH9 A;  3O70 A;  2PUY A;  4LAD B;  2M6M A;  2KGG A;  2K16 A;  2KIZ A;  3KV5 A;  2JMD A;  1BOR A;  2KWN A;  5FER A;  1WEW A;  2MIQ A;  3HCT A;  2VPB A;  2MA5 A;  5D1K B;  5B75 A;  3GV4 A;  3MHS A;  2AN6 A;  2BAY A;  1MM2 A;  1CHC A;  2Y1M A;  3O36 A;  5LKT A;  1FBV A;  4A49 A;  5H1V A;  3O35 A;  3KNV A;  2CSY A;  5C13 A;  4GB0 A;  4ZQL A;  4S3O C;  5B77 A;  3N9N A;  3O34 A;  4WZ0 A;  4R8P K;  2LV9 A;  4Q6F A;  4I7D A;  2NAA A;  2ECW A;  2EA6 A;  3FL2 A;  4YBM A;  5D1L B;  2VP7 A;  1G25 A;  2YUR A;  3ZNI A;  2KWO A;  2E6S A;  3N9O A;  3ZPV E;  3L1X A;  4ZDT A;  1WGM A;  1HYJ A;  2MUM A;  4O64 A;  4S3O B;  1LDJ B;  2JMJ A;  3C6W A;  2OXQ C;  5TDW A;  4CA1 A;  3DPL R;  5TAB A;  5FEY A;  1WES A;  2Y1N A;  3M63 A;  2KGI A;  2CKL A;  2YHO A;  5EYA F;  3U5O A;  2IDA A;  2ECV A;  1FP0 A;  3ZTG A;  1Z2Q A;  1MM3 A;  5FB0 A;  2XB1 A;  1RMD A;  5LKZ A;  4L58 A;  4V3L C;  4WZ2 A;  2L0B A;  4FIP A;  3HCU A;  4FO9 A;  4CCG X;  2MT5 A;  2VJE A;  4BBQ A;  4QF2 A;  2H0D A;  1WFK A;  2CSZ A;  2KU3 A;  5AIU A;  4B86 C;  4B7Y C;  4UI9 B;  3ZYQ A;  2KWJ A;  5FB1 A;  5DKA A;  1WEO A;  1X4I A;  5LKX A;  2H0D B;  2RI7 A;  5B78 A;  3U5M A;  3L1Z B;  4YAB A;  2MA6 A;  1Z6U A;  2D8S A;  4YBT A;  3ASL A;  2MD8 C;  3KQI A;  2YSM A;  4UP0 A;  3U5N A;  2ECN A;  4XI1 A;  1E4U A;  2Y43 A;  4UP5 A;  3LQH A;  2ZET C;  3PUQ A;  5AIT A;  2VNF A;  1IYM A;  2FSA A;  4AUQ B;  3V43 A;  2LDR A;  4NN2 A;  2ECT A;  1LDK C;  2LGL A;  1F62 A;  2QIZ A;  1WEE A;  4YAX A;  3SHB A;  4YC9 A;  1WEN A;  4N4F A;  2ECJ A;  3EB6 A;  2MNZ A;  3T6R A;  4MVT A;  2KWK A;  3C5K A;  2LRI C;  5B76 A;  4R2Y A;  3SOX A;  1WIL A;  3SOU A;  2G6Q A;  5I3L A;  3N9M A;  3O7A A;  1WE9 A;  1VYX A;  1X4U A;  2YUC A;  1WEQ A;  2MNY A;  3PUR A;  3SOW A;  2YQM A;  2YHN A;  2L75 A;  2FUU A;  5H9M A;  5TDR A;  4IC3 A;  2KFT A;  3RPG C;  4LJN A;  1ZBD B;  3VK6 A;  4V3K C;  3RTR B;  3N9P A;  2F6J A;  2C2V S;  4GNE A;  2UZG A;  3O33 A;  4F52 B;  4GNF A;  4P5O B;  2CKL B;  3DQV R;  4A4C A;  5LKU A;  2G43 A;  4AP4 A;  5JG6 A;  2F42 A;  2ECI A;  2KRE A;  5C11 A;  2JMI A;  2LGV A;  5B79 A;  1VD4 A;  1X4J A;  4LKA A;  2DX8 A;  3ZVY A;  4ZUX U;  2ECG A;  5D1M B;  2LGG A;  1VFY A;  1T1H A;  3KV6 A;  5H1U A;  2KE1 A;  2EOD A;  4W4U A;  2VJE B;  3NG2 A;  5KH7 A;  5B8D A;  2LXP C;  5G0F A;  2K17 A;  3PHD A;  4X3G A;  3O37 A;  2C2L A;  5DIN A;  2YW8 A;  2QJ0 A;  4GND A;  3T7L A;  2K4D A;  4PPE A;  2LN0 A;  2LQ6 A;  4A0C D;  2LXH C;  4TKP B;  2CT2 A;  2I50 A;  3LQJ A;  4WA6 A;  2RSD A;  4WZ3 B;  4LLB A;  1WIM A;  2YT5 A;  2F6N A;  1WEP A;  2EGP A;  1U6G B;  3HTK C;  1WEV A; 
#chains in the Genus database with same CATH topology
 2M3H A;  1JOC A;  3H7H A;  2FUI A;  2L5U A;  2PNX A;  2YQL A;  2YRE A;  5LCW B;  1N87 A;  4BHW A;  1K2F A;  3ZPV 1;  3GL6 A;  2M85 A;  1WEM A;  4I7B A;  4YAD A;  2G45 A;  2E6R A;  3U5P A;  2P57 A;  5KH3 A;  2L43 A;  3L11 A;  2DJA A;  2K1J A;  4MSX A;  4N3W A;  2XP0 A;  1JM7 A;  5G05 B;  3IHP A;  3FJU B;  5TBN A;  3LQI A;  2L80 A;  4C9Z A;  3EB5 A;  2KYU A;  2QIC A;  2YU4 A;  1JM7 B;  2KR4 A;  1Z60 A;  1DVP A;  4AYC A;  4L7X A;  3M62 A;  2YSJ A;  1HYI A;  3N9Q A;  4I7C A;  4FJC A;  3M7K A;  3HCS A;  2YYR A;  4GNG A;  1V87 A;  5SVY A;  4AYC B;  3I2D A;  4A4B A;  1XWH A;  3O47 A;  3N9L A;  2M1R A;  3QZV A;  5J3X A;  4YAT A;  3FM8 C;  3ZVZ B;  2LGK A;  2JRJ A;  1WEU A;  3JUE A;  3RPG B;  5H1T A;  2VPE A;  2VPG A;  2MD7 B;  2XOC A;  5TRB A;  4PTB A;  2HYE D;  3MHH A;  3LRQ A;  2HDP A;  4FK5 A;  3FAO A;  2VPD A;  4LK9 A;  2VJF A;  4YBS A;  2XEU A;  3M99 A;  2B0O E;  5G04 B;  4Z0R A;  4R7E A;  2VJF B;  4QF3 A;  4IC2 A;  4AVX A;  5KH9 A;  3O70 A;  2PUY A;  4LAD B;  2M6M A;  1DCQ A;  2KGG A;  2K16 A;  2KIZ A;  3KV5 A;  2JMD A;  1BOR A;  2KWN A;  5FER A;  1WEW A;  2MIQ A;  3HCT A;  2VPB A;  3KDE C;  2MA5 A;  5D1K B;  5B75 A;  2KKX A;  3GV4 A;  3MHS A;  2AN6 A;  2BAY A;  1MM2 A;  1CHC A;  2Y1M A;  3O36 A;  2DSM A;  5LKT A;  1FBV A;  3LVR E;  4A49 A;  5H1V A;  3O35 A;  3KNV A;  4OGE A;  2CSY A;  5C13 A;  5K3Q A;  4GB0 A;  4ZQL A;  4S3O C;  5B77 A;  5SVX A;  3N9N A;  3O34 A;  4WZ0 A;  4R8P K;  2LV9 A;  4Q6F A;  4I7D A;  2NAA A;  2ECW A;  2EA6 A;  3FL2 A;  4YBM A;  3LJU X;  5D1L B;  2VP7 A;  1G25 A;  2YUR A;  3ZNI A;  2KWO A;  2E6S A;  3N9O A;  3ZPV E;  3L1X A;  4ZDT A;  2L7P A;  1WGM A;  1HYJ A;  4OGC A;  2MUM A;  4O64 A;  4S3O B;  1LDJ B;  2JMJ A;  4H9D A;  3C6W A;  2OXQ C;  5TDW A;  4CA1 A;  3DPL R;  5TAB A;  4Z0O A;  5FEY A;  1WES A;  2Y1N A;  3M63 A;  2KGI A;  2CKL A;  2YHO A;  3LVQ E;  5EYA F;  3U5O A;  2IDA A;  2ECV A;  1MBM A;  1FP0 A;  3ZTG A;  1Z2Q A;  2IQJ A;  1MM3 A;  5FB0 A;  2XB1 A;  1RMD A;  5LKZ A;  4L58 A;  4V3L C;  4WZ2 A;  2L0B A;  4FIP A;  3HCU A;  4FO9 A;  4CCG X;  2MT5 A;  3DDT A;  2VJE A;  4BBQ A;  2KKY A;  4QF2 A;  2H0D A;  1WFK A;  2CSZ A;  2KU3 A;  5AIU A;  4B86 C;  4QQ4 A;  4B7Y C;  4UI9 B;  3PLW A;  2CRR A;  3ZYQ A;  2KWJ A;  5FB1 A;  5DKA A;  1WEO A;  1X4I A;  5LKX A;  2H0D B;  2RI7 A;  5B78 A;  3U5M A;  3L1Z B;  4YAB A;  2MA6 A;  1Z6U A;  2D8S A;  4YBT A;  3ASL A;  2MD8 C;  3KQI A;  3MDB C;  2MKE A;  2YSM A;  4UP0 A;  3U5N A;  2ECN A;  4XI1 A;  1E4U A;  3FEH A;  4O62 A;  2Y43 A;  4UP5 A;  3LQH A;  2ZET C;  3PUQ A;  5AIT A;  2VNF A;  1IYM A;  3T9K A;  2CRW A;  2FSA A;  4AUQ B;  3V43 A;  2LDR A;  4NN2 A;  2ECT A;  1LDK C;  2LGL A;  1F62 A;  2QIZ A;  1WEE A;  4YAX A;  2XOZ A;  3SHB A;  3E2D A;  4YC9 A;  1WEN A;  4N4F A;  2ECJ A;  3EB6 A;  2MNZ A;  3T6R A;  4MVT A;  2KWK A;  3C5K A;  2LRI C;  5B76 A;  4R2Y A;  3SOX A;  2YVR A;  1WIL A;  3SOU A;  2G6Q A;  5I3L A;  3N9M A;  3FAN A;  3O7A A;  3SUB A;  3Q1D A;  1WE9 A;  1VYX A;  1X4U A;  2OWA A;  2D8U A;  2YUC A;  1WEQ A;  2MNY A;  3PUR A;  3SOW A;  2YQM A;  2YHN A;  2L75 A;  2FUU A;  5H9M A;  5TDR A;  4IC3 A;  2KFT A;  3RPG C;  4LJN A;  1ZBD B;  3VK6 A;  4V3K C;  3RTR B;  3N9P A;  2F6J A;  2C2V S;  4GNE A;  2UZG A;  3O33 A;  4F52 B;  4GNF A;  4P5O B;  2CKL B;  3DQV R;  4F1P A;  4A4C A;  5LKU A;  2G43 A;  4AP4 A;  5JG6 A;  2F42 A;  2ECI A;  2KRE A;  5C11 A;  2JMI A;  2LGV A;  5B79 A;  2JUN A;  5SVI A;  1VD4 A;  1X4J A;  2FD4 A;  2RR4 A;  4LKA A;  2DX8 A;  3ZVY A;  4ZUX U;  2ECG A;  5D1M B;  2LGG A;  2EGM A;  5SVI B;  1VFY A;  2M13 A;  1T1H A;  3KV6 A;  5H1U A;  2KE1 A;  2EOD A;  4W4U A;  2VJE B;  3NG2 A;  5KH7 A;  5B8D A;  2LXP C;  2CON A;  5G0F A;  2XOY A;  2K17 A;  2JM3 A;  3PHD A;  4X3G A;  3O37 A;  2C2L A;  5DIN A;  2YW8 A;  3DWD A;  2QJ0 A;  4GND A;  3T7L A;  2FFW A;  2EXU A;  2K4D A;  4PPE A;  2LN0 A;  2LQ6 A;  4A0C D;  2CSV A;  2LXH C;  4TKP B;  2CT2 A;  2I50 A;  3LQJ A;  4WA6 A;  2E61 A;  2RSD A;  4WZ3 B;  2LAU A;  4LLB A;  1WIM A;  2YT5 A;  2F6N A;  1WEP A;  2EGP A;  1U6G B;  3HTK C;  3LDY A;  1WEV A; 
#chains in the Genus database with same CATH homology
 2M3H A;  1JOC A;  2FUI A;  2L5U A;  2PNX A;  2YQL A;  2YRE A;  5LCW B;  1N87 A;  4BHW A;  1K2F A;  3ZPV 1;  3GL6 A;  2M85 A;  1WEM A;  4I7B A;  4YAD A;  2G45 A;  2E6R A;  3U5P A;  5KH3 A;  2L43 A;  3L11 A;  2K1J A;  4MSX A;  4N3W A;  1JM7 A;  5G05 B;  3IHP A;  5TBN A;  3LQI A;  2L80 A;  4C9Z A;  3EB5 A;  2KYU A;  2QIC A;  2YU4 A;  1JM7 B;  2KR4 A;  1Z60 A;  1DVP A;  4AYC A;  4L7X A;  3M62 A;  2YSJ A;  1HYI A;  3N9Q A;  4I7C A;  4FJC A;  3HCS A;  2YYR A;  4GNG A;  1V87 A;  4AYC B;  3I2D A;  4A4B A;  1XWH A;  3N9L A;  2M1R A;  3QZV A;  5J3X A;  4YAT A;  3ZVZ B;  2LGK A;  2JRJ A;  1WEU A;  3RPG B;  5H1T A;  2VPE A;  2VPG A;  2MD7 B;  5TRB A;  4PTB A;  2HYE D;  3MHH A;  3LRQ A;  2HDP A;  4FK5 A;  2VPD A;  4LK9 A;  2VJF A;  4YBS A;  2XEU A;  3M99 A;  5G04 B;  4R7E A;  2VJF B;  4QF3 A;  4IC2 A;  4AVX A;  5KH9 A;  3O70 A;  2PUY A;  4LAD B;  2M6M A;  2KGG A;  2K16 A;  2KIZ A;  3KV5 A;  2JMD A;  1BOR A;  2KWN A;  5FER A;  1WEW A;  2MIQ A;  3HCT A;  2VPB A;  2MA5 A;  5D1K B;  5B75 A;  3GV4 A;  3MHS A;  2AN6 A;  2BAY A;  1MM2 A;  1CHC A;  2Y1M A;  3O36 A;  5LKT A;  1FBV A;  4A49 A;  5H1V A;  3O35 A;  3KNV A;  2CSY A;  5C13 A;  4GB0 A;  4ZQL A;  4S3O C;  5B77 A;  3N9N A;  3O34 A;  4WZ0 A;  4R8P K;  2LV9 A;  4Q6F A;  4I7D A;  2NAA A;  2ECW A;  2EA6 A;  3FL2 A;  4YBM A;  5D1L B;  2VP7 A;  1G25 A;  2YUR A;  3ZNI A;  2KWO A;  2E6S A;  3N9O A;  3ZPV E;  3L1X A;  4ZDT A;  1WGM A;  1HYJ A;  2MUM A;  4O64 A;  4S3O B;  1LDJ B;  2JMJ A;  3C6W A;  2OXQ C;  5TDW A;  4CA1 A;  3DPL R;  5TAB A;  5FEY A;  1WES A;  2Y1N A;  3M63 A;  2KGI A;  2CKL A;  2YHO A;  5EYA F;  3U5O A;  2IDA A;  2ECV A;  1FP0 A;  3ZTG A;  1Z2Q A;  1MM3 A;  5FB0 A;  2XB1 A;  1RMD A;  5LKZ A;  4L58 A;  4V3L C;  4WZ2 A;  2L0B A;  4FIP A;  3HCU A;  4FO9 A;  4CCG X;  2MT5 A;  2VJE A;  4BBQ A;  4QF2 A;  2H0D A;  1WFK A;  2CSZ A;  2KU3 A;  5AIU A;  4B86 C;  4B7Y C;  4UI9 B;  3ZYQ A;  2KWJ A;  5FB1 A;  5DKA A;  1WEO A;  1X4I A;  5LKX A;  2H0D B;  2RI7 A;  5B78 A;  3U5M A;  3L1Z B;  4YAB A;  2MA6 A;  1Z6U A;  2D8S A;  4YBT A;  3ASL A;  2MD8 C;  3KQI A;  2YSM A;  4UP0 A;  3U5N A;  2ECN A;  4XI1 A;  1E4U A;  2Y43 A;  4UP5 A;  3LQH A;  2ZET C;  3PUQ A;  5AIT A;  2VNF A;  1IYM A;  2FSA A;  4AUQ B;  3V43 A;  2LDR A;  4NN2 A;  2ECT A;  1LDK C;  2LGL A;  1F62 A;  2QIZ A;  1WEE A;  4YAX A;  3SHB A;  4YC9 A;  1WEN A;  4N4F A;  2ECJ A;  3EB6 A;  2MNZ A;  3T6R A;  4MVT A;  2KWK A;  3C5K A;  2LRI C;  5B76 A;  4R2Y A;  3SOX A;  1WIL A;  3SOU A;  2G6Q A;  5I3L A;  3N9M A;  3O7A A;  1WE9 A;  1VYX A;  1X4U A;  2YUC A;  1WEQ A;  2MNY A;  3PUR A;  3SOW A;  2YQM A;  2YHN A;  2L75 A;  2FUU A;  5H9M A;  5TDR A;  4IC3 A;  2KFT A;  3RPG C;  4LJN A;  1ZBD B;  3VK6 A;  4V3K C;  3RTR B;  3N9P A;  2F6J A;  2C2V S;  4GNE A;  2UZG A;  3O33 A;  4F52 B;  4GNF A;  4P5O B;  2CKL B;  3DQV R;  4A4C A;  5LKU A;  2G43 A;  4AP4 A;  5JG6 A;  2F42 A;  2ECI A;  2KRE A;  5C11 A;  2JMI A;  2LGV A;  5B79 A;  1VD4 A;  1X4J A;  4LKA A;  2DX8 A;  3ZVY A;  4ZUX U;  2ECG A;  5D1M B;  2LGG A;  1VFY A;  1T1H A;  3KV6 A;  5H1U A;  2KE1 A;  2EOD A;  4W4U A;  2VJE B;  3NG2 A;  5KH7 A;  5B8D A;  2LXP C;  5G0F A;  2K17 A;  3PHD A;  4X3G A;  3O37 A;  2C2L A;  5DIN A;  2YW8 A;  2QJ0 A;  4GND A;  3T7L A;  2K4D A;  4PPE A;  2LN0 A;  2LQ6 A;  4A0C D;  2LXH C;  4TKP B;  2CT2 A;  2I50 A;  3LQJ A;  4WA6 A;  2RSD A;  4WZ3 B;  4LLB A;  1WIM A;  2YT5 A;  2F6N A;  1WEP A;  2EGP A;  1U6G B;  3HTK C;  1WEV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...