4S3OC

Pcgf5-ring1b-ubch5c complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
96
structure length
95
Chain Sequence
b'KHLVKDFNPYITCYICKGYLIKPTTVTECLHTFCKTCIVQHFEDSNDCPRCGNQVETNPLEMLRLDNTLEEIIFKLVPGLREQELERESEFWKKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title BMI1-RING1B is an autoinhibited RING E3 ubiquitin ligase.
pubmed doi rcsb
molecule keywords Ubiquitin-conjugating enzyme E2 D3
source organism Homo sapiens
molecule tags Ligase/transcription
total genus 25
structure length 95
sequence length 96
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4s3oC00
2ECNA 2C2LA 2LGKA 4LLBA 5G0FA 1VYXA 4LKAA 1ZBDB 3L11A 4FK5A 5FB1A 2VP7A 2H0DA 2M1RA 2I50A 1MM3A 3SOUA 3RPGC 2CKLB 1JM7B 3PURA 2M85A 2KR4A 3M62A 5G04B 5FERA 5TBNA 2XEUA 3KNVA 5TDWA 2VJFA 4V3KC 4AUQB 3O37A 2Y1MA 4A0CD 4LK9A 1WILA 5JG6A 5TABA 3MHSA 4UP5A 4YAXA 5LKUA 1X4JA 2YHOA 3HCTA 4A4BA 1LDJB 2HYED 2MIQA 1WEMA 1U6GB 4AVXA 2H0DB 1FP0A 1CHCA 4L58A 1N87A 2ECVA 2YUCA 2KGIA 3L1XA 3V43A 1VD4A 2QIZA 4R2YA 2M6MA 5B76A 3ZYQA 3ZTGA 2YW8A 2KU3A 2JMIA 2MD8C 2ZETC 2JMDA 2RSDA 4YABA 4GNGA 3HTKC 1V87A 2ECJA 2K17A 5J3XA 3N9QA 3N9MA 3ZVZB 1X4IA 2F42A 2EA6A 3ZNIA 1WEOA 5B79A 3MHHA 1G25A 2AN6A 5C13A 3N9NA 2PUYA 4O64A 2KWOA 4W4UA 3LQJA 4FJCA 2VPDA 3C5KA 4LADB 4PPEA 2NAAA 4NN2A 2VPEA 2G6QA 2YQMA 3LQIA 4X3GA 4AP4A 2CSZA 5LKXA 1WENA 2KGGA 2YSMA 4V3LC 4FO9A 2LV9A 2LGLA 2MUMA 2MNYA 2EGPA 4YBMA 5B75A 1DVPA 1WESA 5KH9A 2YU4A 1WIMA 3FL2A 5I3LA 2MA5A 1IYMA 4YATA 1WEPA 2E6SA 2KIZA 3PUQA 2LXPC 1WEUA 4GB0A 1T1HA 3T6RA 2VPGA 5H1UA 3M99A 4GNFA 1HYIA 5D1KB 4F52B 5B8DA 4BBQA 2LDRA 1Z60A 3I2DA 3M63A 3N9LA 3EB6A 5FB0A 4B7YC 5H1TA 5D1LB 2LQ6A 1LDKC 4I7BA 4A4CA 2MNZA 1Z6UA 2QJ0A 5TRBA 2G45A 2KWNA 2KE1A 4P5OB 4B86C 2ECIA 2JMJA 4GNEA 4QF3A 3SOXA 1E4UA 1WGMA 2CSYA 1RMDA 4N3WA 2PNXA 3C6WA 4S3OC 2Y1NA 4XI1A 5B77A 2LXHC 3GV4A 2MT5A 2HDPA 3O7AA 3ZPVE 2K16A 3U5PA 1WFKA 4FIPA 4CCGX 1MM2A 3SOWA 3U5NA 5DKAA 4MVTA 4S3OB 2YT5A 3O34A 2MD7B 3LRQA 2RI7A 2EODA 5LKZA 4CA1A 4ZUXU 3RTRB 4IC2A 2VNFA 1FBVA 2K4DA 2XB1A 3QZVA 3HCSA 1WE9A 2E6RA 2YREA 4L7XA 1XWHA 2CT2A 3ZPV1 4WZ3B 3KV5A 3SHBA 5KH3A 3GL6A 2DX8A 4LJNA 4I7CA 5DINA 5H9MA 3LQHA 3NG2A 2JRJA 2YSJA 4R8PK 2OXQC 3N9OA 2UZGA 2YYRA 2F6NA 2C2VS 2LGVA 3ZVYA 5B78A 1HYJA 4QF2A 4YC9A 3N9PA 3HCUA 3KQIA 5TDRA 3O36A 4BHWA 4A49A 2LGGA 4YBTA 4Q6FA 5KH7A 4GNDA 4WZ2A 2KWKA 2F6JA 3VK6A 2VJEA 3KV6A 5EYAF 1WEWA 2YHNA 4ZQLA 4N4FA 2BAYA 2YURA 4AYCA 2L0BA 2ECTA 4UP0A 3RPGB 2L5UA 1Z2QA 2KREA 4R7EA 5C11A 4YADA 4TKPB 2FUUA 2IDAA 2QICA 2MA6A 2YQLA 4PTBA 1BORA 1WEEA 2KFTA 2K1JA 2KWJA 3ASLA 1JOCA 3U5OA 2LN0A 1WEQA 4MSXA 1X4UA 2L43A 2D8SA 4WZ0A 2VJEB 4YBSA 3T7LA 2ECGA 4UI9B 2M3HA 5AIUA 2VJFB 5LCWB 3O70A 2Y43A 4AYCB 2LRIC 2ECWA 1K2FA 2FUIA 3DQVR 1F62A 5AITA 5D1MB 1VFYA 4I7DA 3DPLR 3L1ZB 2CKLA 2G43A 3O33A 1JM7A 5H1VA 4IC3A 4C9ZA 3IHPA 5G05B 3EB5A 4ZDTA 3PHDA 5LKTA 2VPBA 2L75A 1WEVA 3U5MA 4WA6A 2KYUA 2L80A 2FSAA 5FEYA 3O35A
chains in the Genus database with same CATH superfamily
2ECNA 2C2LA 2LGKA 4LLBA 2EGMA 5G0FA 1VYXA 4LKAA 1ZBDB 3L11A 2XP0A 5SVIA 4FK5A 5FB1A 2VP7A 4F1PA 2H0DA 2M1RA 3FJUB 2I50A 1MM3A 3SOUA 3RPGC 2CKLB 1JM7B 3PURA 2M85A 2CSVA 2KR4A 2KKYA 3M62A 5G04B 5FERA 2LAUA 5TBNA 2XEUA 3KNVA 5TDWA 3LDYA 2VJFA 2CRWA 3T9KA 4V3KC 4AUQB 3O37A 2Y1MA 2DSMA 4A0CD 4LK9A 2JM3A 1WILA 5JG6A 5TABA 2KKXA 3MHSA 4UP5A 4YAXA 5LKUA 1X4JA 2YHOA 3HCTA 4A4BA 1LDJB 5SVIB 2P57A 2HYED 2MIQA 1WEMA 1U6GB 4AVXA 2H0DB 1FP0A 1CHCA 4L58A 1N87A 2ECVA 2YUCA 2KGIA 2FFWA 3L1XA 3V43A 1VD4A 2QIZA 4R2YA 3DDTA 5K3QA 2M6MA 5B76A 3O35A 3ZYQA 3ZTGA 2YW8A 2KU3A 2JMIA 2MD8C 2ZETC 2JMDA 2RSDA 4YABA 4GNGA 3HTKC 1V87A 2ECJA 2K17A 5J3XA 3N9QA 3N9MA 3ZVZB 3FANA 1X4IA 2F42A 2EA6A 3ZNIA 3LJUX 1WEOA 5B79A 3MHHA 1G25A 2AN6A 5C13A 3N9NA 2PUYA 2MKEA 4O64A 2KWOA 4W4UA 2JUNA 3LQJA 2EXUA 4FJCA 2VPDA 3C5KA 4LADB 3MDBC 4PPEA 2NAAA 4NN2A 2VPEA 2G6QA 2YQMA 3LQIA 4X3GA 4AP4A 2CSZA 5LKXA 1WENA 2KGGA 2CONA 2YSMA 4V3LC 2YVRA 4FO9A 2LV9A 2LGLA 2MUMA 2MNYA 2FD4A 3FM8C 3FAOA 3JUEA 2EGPA 4YBMA 5B75A 1DVPA 1WESA 5KH9A 2XOYA 2YU4A 1WIMA 3FL2A 5I3LA 2MA5A 4O62A 1IYMA 3DWDA 4YATA 1WEPA 2E6SA 2KIZA 3PUQA 2LXPC 1WEUA 4GB0A 1T1HA 3T6RA 2VPGA 5H1UA 3M99A 4GNFA 1HYIA 1DCQA 5D1KB 4F52B 5B8DA 4BBQA 2LDRA 1Z60A 3I2DA 3M63A 3N9LA 3EB6A 5FB0A 4B7YC 5H1TA 5D1LB 2E61A 2LQ6A 1LDKC 4I7BA 4A4CA 2MNZA 1Z6UA 2QJ0A 5TRBA 2G45A 2KWNA 2KE1A 4P5OB 4B86C 2ECIA 2JMJA 4GNEA 2XOZA 4QF3A 2L7PA 3SOXA 1E4UA 1WGMA 2CSYA 4QQ4A 1RMDA 4Z0OA 3SUBA 4N3WA 2PNXA 3C6WA 4S3OC 2Y1NA 4XI1A 5B77A 2LXHC 3GV4A 2D8UA 2CRRA 2MT5A 2HDPA 3O7AA 3ZPVE 2K16A 3U5PA 1WFKA 4FIPA 4CCGX 1MM2A 3SOWA 3U5NA 5DKAA 4MVTA 3Q1DA 4S3OB 2YT5A 3O34A 2MD7B 3LRQA 2RI7A 2EODA 3FEHA 5LKZA 4CA1A 4ZUXU 4IC2A 3RTRB 2VNFA 1FBVA 2K4DA 2XB1A 3QZVA 3HCSA 1WE9A 2E6RA 2YREA 4L7XA 1XWHA 2CT2A 3ZPV1 4WZ3B 3KV5A 3SHBA 5KH3A 3GL6A 2DX8A 4LJNA 3E2DA 4I7CA 5DINA 4OGEA 5H9MA 3LQHA 3NG2A 2JRJA 3M7KA 2OWAA 2YSJA 4R8PK 2OXQC 3N9OA 1MBMA 5SVXA 2UZGA 2YYRA 3KDEC 2F6NA 2C2VS 2LGVA 3ZVYA 5B78A 1HYJA 4QF2A 4YC9A 3N9PA 2M13A 3HCUA 3KQIA 5TDRA 3O36A 4BHWA 4OGCA 4A49A 2LGGA 4Q6FA 4YBTA 5KH7A 4GNDA 4WZ2A 2KWKA 2F6JA 3VK6A 2VJEA 3KV6A 3PLWA 5EYAF 1WEWA 2YHNA 4Z0RA 4ZQLA 4N4FA 2BAYA 2IQJA 2YURA 4AYCA 2L0BA 2ECTA 4UP0A 3RPGB 2L5UA 1Z2QA 2KREA 5SVYA 4R7EA 5C11A 4YADA 4TKPB 2FUUA 2DJAA 2IDAA 2QICA 2MA6A 2YQLA 4PTBA 1BORA 1WEEA 2KFTA 2K1JA 2KWJA 3ASLA 1JOCA 3U5OA 2LN0A 1WEQA 3O47A 4MSXA 1X4UA 2L43A 2D8SA 4WZ0A 2VJEB 4YBSA 3T7LA 3LVRE 2ECGA 4UI9B 2M3HA 5AIUA 2VJFB 5LCWB 3O70A 2Y43A 4AYCB 2B0OE 2LRIC 2ECWA 1K2FA 2FUIA 3LVQE 3DQVR 1F62A 5AITA 5D1MB 2RR4A 1VFYA 4I7DA 3DPLR 3L1ZB 2CKLA 2G43A 3O33A 1JM7A 5H1VA 4IC3A 4C9ZA 3IHPA 5G05B 3EB5A 3PHDA 4ZDTA 5LKTA 2VPBA 2L75A 4H9DA 1WEVA 3U5MA 4WA6A 2KYUA 2L80A 2FSAA 5FEYA 2XOCA 3H7HA
chains in the Genus database with same CATH topology
2ECNA 2C2LA 2LGKA 4LLBA 5G0FA 1VYXA 4LKAA 1ZBDB 3L11A 4FK5A 5FB1A 2VP7A 2H0DA 2M1RA 2I50A 1MM3A 3SOUA 3RPGC 2CKLB 1JM7B 3PURA 2M85A 2KR4A 3M62A 5G04B 5FERA 5TBNA 2XEUA 3KNVA 5TDWA 2VJFA 4V3KC 4AUQB 3O37A 2Y1MA 4A0CD 4LK9A 1WILA 5JG6A 5TABA 3MHSA 4UP5A 4YAXA 5LKUA 1X4JA 2YHOA 3HCTA 4A4BA 1LDJB 2HYED 2MIQA 1WEMA 1U6GB 4AVXA 2H0DB 1FP0A 1CHCA 4L58A 1N87A 2ECVA 2YUCA 2KGIA 3L1XA 3V43A 1VD4A 2QIZA 4R2YA 2M6MA 5B76A 3ZYQA 3ZTGA 2YW8A 2KU3A 2JMIA 2MD8C 2ZETC 2JMDA 2RSDA 4YABA 4GNGA 3HTKC 1V87A 2ECJA 2K17A 5J3XA 3N9QA 3N9MA 3ZVZB 1X4IA 2F42A 2EA6A 3ZNIA 1WEOA 5B79A 3MHHA 1G25A 2AN6A 5C13A 3N9NA 2PUYA 4O64A 2KWOA 4W4UA 3LQJA 4FJCA 2VPDA 3C5KA 4LADB 4PPEA 2NAAA 4NN2A 2VPEA 2G6QA 2YQMA 3LQIA 4X3GA 4AP4A 2CSZA 5LKXA 1WENA 2KGGA 2YSMA 4V3LC 4FO9A 2LV9A 2LGLA 2MUMA 2MNYA 2EGPA 4YBMA 5B75A 1DVPA 1WESA 5KH9A 2YU4A 1WIMA 3FL2A 5I3LA 2MA5A 1IYMA 4YATA 1WEPA 2E6SA 2KIZA 3PUQA 2LXPC 1WEUA 4GB0A 1T1HA 3T6RA 2VPGA 5H1UA 3M99A 4GNFA 1HYIA 5D1KB 4F52B 5B8DA 4BBQA 2LDRA 1Z60A 3I2DA 3M63A 3N9LA 3EB6A 5FB0A 4B7YC 5H1TA 5D1LB 2LQ6A 1LDKC 4I7BA 4A4CA 2MNZA 1Z6UA 2QJ0A 5TRBA 2G45A 2KWNA 2KE1A 4P5OB 4B86C 2ECIA 2JMJA 4GNEA 4QF3A 3SOXA 1E4UA 1WGMA 2CSYA 1RMDA 4N3WA 2PNXA 3C6WA 4S3OC 2Y1NA 4XI1A 5B77A 2LXHC 3GV4A 2MT5A 2HDPA 3O7AA 3ZPVE 2K16A 3U5PA 1WFKA 4FIPA 4CCGX 1MM2A 3SOWA 3U5NA 5DKAA 4MVTA 4S3OB 2YT5A 3O34A 2MD7B 3LRQA 2RI7A 2EODA 5LKZA 4CA1A 4ZUXU 3RTRB 4IC2A 2VNFA 1FBVA 2K4DA 2XB1A 3QZVA 3HCSA 1WE9A 2E6RA 2YREA 4L7XA 1XWHA 2CT2A 3ZPV1 4WZ3B 3KV5A 3SHBA 5KH3A 3GL6A 2DX8A 4LJNA 4I7CA 5DINA 5H9MA 3LQHA 3NG2A 2JRJA 2YSJA 4R8PK 2OXQC 3N9OA 2UZGA 2YYRA 2F6NA 2C2VS 2LGVA 3ZVYA 5B78A 1HYJA 4QF2A 4YC9A 3N9PA 3HCUA 3KQIA 5TDRA 3O36A 4BHWA 4A49A 2LGGA 4YBTA 4Q6FA 5KH7A 4GNDA 4WZ2A 2KWKA 2F6JA 3VK6A 2VJEA 3KV6A 5EYAF 1WEWA 2YHNA 4ZQLA 4N4FA 2BAYA 2YURA 4AYCA 2L0BA 2ECTA 4UP0A 3RPGB 2L5UA 1Z2QA 2KREA 4R7EA 5C11A 4YADA 4TKPB 2FUUA 2IDAA 2QICA 2MA6A 2YQLA 4PTBA 1BORA 1WEEA 2KFTA 2K1JA 2KWJA 3ASLA 1JOCA 3U5OA 2LN0A 1WEQA 4MSXA 1X4UA 2L43A 2D8SA 4WZ0A 2VJEB 4YBSA 3T7LA 2ECGA 4UI9B 2M3HA 5AIUA 2VJFB 5LCWB 3O70A 2Y43A 4AYCB 2LRIC 2ECWA 1K2FA 2FUIA 3DQVR 1F62A 5AITA 5D1MB 1VFYA 4I7DA 3DPLR 3L1ZB 2CKLA 2G43A 3O33A 1JM7A 5H1VA 4IC3A 4C9ZA 3IHPA 5G05B 3EB5A 4ZDTA 3PHDA 5LKTA 2VPBA 2L75A 1WEVA 3U5MA 4WA6A 2KYUA 2L80A 2FSAA 5FEYA 3O35A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ECN A;  2C2L A;  2LGK A;  4LLB A;  5G0F A;  1VYX A;  4LKA A;  1ZBD B;  3L11 A;  4FK5 A;  5FB1 A;  2VP7 A;  2H0D A;  2M1R A;  2I50 A;  1MM3 A;  3SOU A;  3RPG C;  2CKL B;  1JM7 B;  3PUR A;  2M85 A;  2KR4 A;  3M62 A;  5G04 B;  5FER A;  5TBN A;  2XEU A;  3KNV A;  5TDW A;  2VJF A;  4V3K C;  4AUQ B;  3O37 A;  2Y1M A;  4A0C D;  4LK9 A;  1WIL A;  5JG6 A;  5TAB A;  3MHS A;  4UP5 A;  4YAX A;  5LKU A;  1X4J A;  2YHO A;  3HCT A;  4A4B A;  1LDJ B;  2HYE D;  2MIQ A;  1WEM A;  1U6G B;  4AVX A;  2H0D B;  1FP0 A;  1CHC A;  4L58 A;  1N87 A;  2ECV A;  2YUC A;  2KGI A;  3L1X A;  3V43 A;  1VD4 A;  2QIZ A;  4R2Y A;  2M6M A;  5B76 A;  3ZYQ A;  3ZTG A;  2YW8 A;  2KU3 A;  2JMI A;  2MD8 C;  2ZET C;  2JMD A;  2RSD A;  4YAB A;  4GNG A;  3HTK C;  1V87 A;  2ECJ A;  2K17 A;  5J3X A;  3N9Q A;  3N9M A;  3ZVZ B;  1X4I A;  2F42 A;  2EA6 A;  3ZNI A;  1WEO A;  5B79 A;  3MHH A;  1G25 A;  2AN6 A;  5C13 A;  3N9N A;  2PUY A;  4O64 A;  2KWO A;  4W4U A;  3LQJ A;  4FJC A;  2VPD A;  3C5K A;  4LAD B;  4PPE A;  2NAA A;  4NN2 A;  2VPE A;  2G6Q A;  2YQM A;  3LQI A;  4X3G A;  4AP4 A;  2CSZ A;  5LKX A;  1WEN A;  2KGG A;  2YSM A;  4V3L C;  4FO9 A;  2LV9 A;  2LGL A;  2MUM A;  2MNY A;  2EGP A;  4YBM A;  5B75 A;  1DVP A;  1WES A;  5KH9 A;  2YU4 A;  1WIM A;  3FL2 A;  5I3L A;  2MA5 A;  1IYM A;  4YAT A;  1WEP A;  2E6S A;  2KIZ A;  3PUQ A;  2LXP C;  1WEU A;  4GB0 A;  1T1H A;  3T6R A;  2VPG A;  5H1U A;  3M99 A;  4GNF A;  1HYI A;  5D1K B;  4F52 B;  5B8D A;  4BBQ A;  2LDR A;  1Z60 A;  3I2D A;  3M63 A;  3N9L A;  3EB6 A;  5FB0 A;  4B7Y C;  5H1T A;  5D1L B;  2LQ6 A;  1LDK C;  4I7B A;  4A4C A;  2MNZ A;  1Z6U A;  2QJ0 A;  5TRB A;  2G45 A;  2KWN A;  2KE1 A;  4P5O B;  4B86 C;  2ECI A;  2JMJ A;  4GNE A;  4QF3 A;  3SOX A;  1E4U A;  1WGM A;  2CSY A;  1RMD A;  4N3W A;  2PNX A;  3C6W A;  4S3O C;  2Y1N A;  4XI1 A;  5B77 A;  2LXH C;  3GV4 A;  2MT5 A;  2HDP A;  3O7A A;  3ZPV E;  2K16 A;  3U5P A;  1WFK A;  4FIP A;  4CCG X;  1MM2 A;  3SOW A;  3U5N A;  5DKA A;  4MVT A;  4S3O B;  2YT5 A;  3O34 A;  2MD7 B;  3LRQ A;  2RI7 A;  2EOD A;  5LKZ A;  4CA1 A;  4ZUX U;  3RTR B;  4IC2 A;  2VNF A;  1FBV A;  2K4D A;  2XB1 A;  3QZV A;  3HCS A;  1WE9 A;  2E6R A;  2YRE A;  4L7X A;  1XWH A;  2CT2 A;  3ZPV 1;  4WZ3 B;  3KV5 A;  3SHB A;  5KH3 A;  3GL6 A;  2DX8 A;  4LJN A;  4I7C A;  5DIN A;  5H9M A;  3LQH A;  3NG2 A;  2JRJ A;  2YSJ A;  4R8P K;  2OXQ C;  3N9O A;  2UZG A;  2YYR A;  2F6N A;  2C2V S;  2LGV A;  3ZVY A;  5B78 A;  1HYJ A;  4QF2 A;  4YC9 A;  3N9P A;  3HCU A;  3KQI A;  5TDR A;  3O36 A;  4BHW A;  4A49 A;  2LGG A;  4YBT A;  4Q6F A;  5KH7 A;  4GND A;  4WZ2 A;  2KWK A;  2F6J A;  3VK6 A;  2VJE A;  3KV6 A;  5EYA F;  1WEW A;  2YHN A;  4ZQL A;  4N4F A;  2BAY A;  2YUR A;  4AYC A;  2L0B A;  2ECT A;  4UP0 A;  3RPG B;  2L5U A;  1Z2Q A;  2KRE A;  4R7E A;  5C11 A;  4YAD A;  4TKP B;  2FUU A;  2IDA A;  2QIC A;  2MA6 A;  2YQL A;  4PTB A;  1BOR A;  1WEE A;  2KFT A;  2K1J A;  2KWJ A;  3ASL A;  1JOC A;  3U5O A;  2LN0 A;  1WEQ A;  4MSX A;  1X4U A;  2L43 A;  2D8S A;  4WZ0 A;  2VJE B;  4YBS A;  3T7L A;  2ECG A;  4UI9 B;  2M3H A;  5AIU A;  2VJF B;  5LCW B;  3O70 A;  2Y43 A;  4AYC B;  2LRI C;  2ECW A;  1K2F A;  2FUI A;  3DQV R;  1F62 A;  5AIT A;  5D1M B;  1VFY A;  4I7D A;  3DPL R;  3L1Z B;  2CKL A;  2G43 A;  3O33 A;  1JM7 A;  5H1V A;  4IC3 A;  4C9Z A;  3IHP A;  5G05 B;  3EB5 A;  4ZDT A;  3PHD A;  5LKT A;  2VPB A;  2L75 A;  1WEV A;  3U5M A;  4WA6 A;  2KYU A;  2L80 A;  2FSA A;  5FEY A;  3O35 A; 
#chains in the Genus database with same CATH topology
 2ECN A;  2C2L A;  2LGK A;  4LLB A;  2EGM A;  5G0F A;  1VYX A;  4LKA A;  1ZBD B;  3L11 A;  2XP0 A;  5SVI A;  4FK5 A;  5FB1 A;  2VP7 A;  4F1P A;  2H0D A;  2M1R A;  3FJU B;  2I50 A;  1MM3 A;  3SOU A;  3RPG C;  2CKL B;  1JM7 B;  3PUR A;  2M85 A;  2CSV A;  2KR4 A;  2KKY A;  3M62 A;  5G04 B;  5FER A;  2LAU A;  5TBN A;  2XEU A;  3KNV A;  5TDW A;  3LDY A;  2VJF A;  2CRW A;  3T9K A;  4V3K C;  4AUQ B;  3O37 A;  2Y1M A;  2DSM A;  4A0C D;  4LK9 A;  2JM3 A;  1WIL A;  5JG6 A;  5TAB A;  2KKX A;  3MHS A;  4UP5 A;  4YAX A;  5LKU A;  1X4J A;  2YHO A;  3HCT A;  4A4B A;  1LDJ B;  5SVI B;  2P57 A;  2HYE D;  2MIQ A;  1WEM A;  1U6G B;  4AVX A;  2H0D B;  1FP0 A;  1CHC A;  4L58 A;  1N87 A;  2ECV A;  2YUC A;  2KGI A;  2FFW A;  3L1X A;  3V43 A;  1VD4 A;  2QIZ A;  4R2Y A;  3DDT A;  5K3Q A;  2M6M A;  5B76 A;  3O35 A;  3ZYQ A;  3ZTG A;  2YW8 A;  2KU3 A;  2JMI A;  2MD8 C;  2ZET C;  2JMD A;  2RSD A;  4YAB A;  4GNG A;  3HTK C;  1V87 A;  2ECJ A;  2K17 A;  5J3X A;  3N9Q A;  3N9M A;  3ZVZ B;  3FAN A;  1X4I A;  2F42 A;  2EA6 A;  3ZNI A;  3LJU X;  1WEO A;  5B79 A;  3MHH A;  1G25 A;  2AN6 A;  5C13 A;  3N9N A;  2PUY A;  2MKE A;  4O64 A;  2KWO A;  4W4U A;  2JUN A;  3LQJ A;  2EXU A;  4FJC A;  2VPD A;  3C5K A;  4LAD B;  3MDB C;  4PPE A;  2NAA A;  4NN2 A;  2VPE A;  2G6Q A;  2YQM A;  3LQI A;  4X3G A;  4AP4 A;  2CSZ A;  5LKX A;  1WEN A;  2KGG A;  2CON A;  2YSM A;  4V3L C;  2YVR A;  4FO9 A;  2LV9 A;  2LGL A;  2MUM A;  2MNY A;  2FD4 A;  3FM8 C;  3FAO A;  3JUE A;  2EGP A;  4YBM A;  5B75 A;  1DVP A;  1WES A;  5KH9 A;  2XOY A;  2YU4 A;  1WIM A;  3FL2 A;  5I3L A;  2MA5 A;  4O62 A;  1IYM A;  3DWD A;  4YAT A;  1WEP A;  2E6S A;  2KIZ A;  3PUQ A;  2LXP C;  1WEU A;  4GB0 A;  1T1H A;  3T6R A;  2VPG A;  5H1U A;  3M99 A;  4GNF A;  1HYI A;  1DCQ A;  5D1K B;  4F52 B;  5B8D A;  4BBQ A;  2LDR A;  1Z60 A;  3I2D A;  3M63 A;  3N9L A;  3EB6 A;  5FB0 A;  4B7Y C;  5H1T A;  5D1L B;  2E61 A;  2LQ6 A;  1LDK C;  4I7B A;  4A4C A;  2MNZ A;  1Z6U A;  2QJ0 A;  5TRB A;  2G45 A;  2KWN A;  2KE1 A;  4P5O B;  4B86 C;  2ECI A;  2JMJ A;  4GNE A;  2XOZ A;  4QF3 A;  2L7P A;  3SOX A;  1E4U A;  1WGM A;  2CSY A;  4QQ4 A;  1RMD A;  4Z0O A;  3SUB A;  4N3W A;  2PNX A;  3C6W A;  4S3O C;  2Y1N A;  4XI1 A;  5B77 A;  2LXH C;  3GV4 A;  2D8U A;  2CRR A;  2MT5 A;  2HDP A;  3O7A A;  3ZPV E;  2K16 A;  3U5P A;  1WFK A;  4FIP A;  4CCG X;  1MM2 A;  3SOW A;  3U5N A;  5DKA A;  4MVT A;  3Q1D A;  4S3O B;  2YT5 A;  3O34 A;  2MD7 B;  3LRQ A;  2RI7 A;  2EOD A;  3FEH A;  5LKZ A;  4CA1 A;  4ZUX U;  4IC2 A;  3RTR B;  2VNF A;  1FBV A;  2K4D A;  2XB1 A;  3QZV A;  3HCS A;  1WE9 A;  2E6R A;  2YRE A;  4L7X A;  1XWH A;  2CT2 A;  3ZPV 1;  4WZ3 B;  3KV5 A;  3SHB A;  5KH3 A;  3GL6 A;  2DX8 A;  4LJN A;  3E2D A;  4I7C A;  5DIN A;  4OGE A;  5H9M A;  3LQH A;  3NG2 A;  2JRJ A;  3M7K A;  2OWA A;  2YSJ A;  4R8P K;  2OXQ C;  3N9O A;  1MBM A;  5SVX A;  2UZG A;  2YYR A;  3KDE C;  2F6N A;  2C2V S;  2LGV A;  3ZVY A;  5B78 A;  1HYJ A;  4QF2 A;  4YC9 A;  3N9P A;  2M13 A;  3HCU A;  3KQI A;  5TDR A;  3O36 A;  4BHW A;  4OGC A;  4A49 A;  2LGG A;  4Q6F A;  4YBT A;  5KH7 A;  4GND A;  4WZ2 A;  2KWK A;  2F6J A;  3VK6 A;  2VJE A;  3KV6 A;  3PLW A;  5EYA F;  1WEW A;  2YHN A;  4Z0R A;  4ZQL A;  4N4F A;  2BAY A;  2IQJ A;  2YUR A;  4AYC A;  2L0B A;  2ECT A;  4UP0 A;  3RPG B;  2L5U A;  1Z2Q A;  2KRE A;  5SVY A;  4R7E A;  5C11 A;  4YAD A;  4TKP B;  2FUU A;  2DJA A;  2IDA A;  2QIC A;  2MA6 A;  2YQL A;  4PTB A;  1BOR A;  1WEE A;  2KFT A;  2K1J A;  2KWJ A;  3ASL A;  1JOC A;  3U5O A;  2LN0 A;  1WEQ A;  3O47 A;  4MSX A;  1X4U A;  2L43 A;  2D8S A;  4WZ0 A;  2VJE B;  4YBS A;  3T7L A;  3LVR E;  2ECG A;  4UI9 B;  2M3H A;  5AIU A;  2VJF B;  5LCW B;  3O70 A;  2Y43 A;  4AYC B;  2B0O E;  2LRI C;  2ECW A;  1K2F A;  2FUI A;  3LVQ E;  3DQV R;  1F62 A;  5AIT A;  5D1M B;  2RR4 A;  1VFY A;  4I7D A;  3DPL R;  3L1Z B;  2CKL A;  2G43 A;  3O33 A;  1JM7 A;  5H1V A;  4IC3 A;  4C9Z A;  3IHP A;  5G05 B;  3EB5 A;  3PHD A;  4ZDT A;  5LKT A;  2VPB A;  2L75 A;  4H9D A;  1WEV A;  3U5M A;  4WA6 A;  2KYU A;  2L80 A;  2FSA A;  5FEY A;  2XOC A;  3H7H A; 
#chains in the Genus database with same CATH homology
 2ECN A;  2C2L A;  2LGK A;  4LLB A;  5G0F A;  1VYX A;  4LKA A;  1ZBD B;  3L11 A;  4FK5 A;  5FB1 A;  2VP7 A;  2H0D A;  2M1R A;  2I50 A;  1MM3 A;  3SOU A;  3RPG C;  2CKL B;  1JM7 B;  3PUR A;  2M85 A;  2KR4 A;  3M62 A;  5G04 B;  5FER A;  5TBN A;  2XEU A;  3KNV A;  5TDW A;  2VJF A;  4V3K C;  4AUQ B;  3O37 A;  2Y1M A;  4A0C D;  4LK9 A;  1WIL A;  5JG6 A;  5TAB A;  3MHS A;  4UP5 A;  4YAX A;  5LKU A;  1X4J A;  2YHO A;  3HCT A;  4A4B A;  1LDJ B;  2HYE D;  2MIQ A;  1WEM A;  1U6G B;  4AVX A;  2H0D B;  1FP0 A;  1CHC A;  4L58 A;  1N87 A;  2ECV A;  2YUC A;  2KGI A;  3L1X A;  3V43 A;  1VD4 A;  2QIZ A;  4R2Y A;  2M6M A;  5B76 A;  3ZYQ A;  3ZTG A;  2YW8 A;  2KU3 A;  2JMI A;  2MD8 C;  2ZET C;  2JMD A;  2RSD A;  4YAB A;  4GNG A;  3HTK C;  1V87 A;  2ECJ A;  2K17 A;  5J3X A;  3N9Q A;  3N9M A;  3ZVZ B;  1X4I A;  2F42 A;  2EA6 A;  3ZNI A;  1WEO A;  5B79 A;  3MHH A;  1G25 A;  2AN6 A;  5C13 A;  3N9N A;  2PUY A;  4O64 A;  2KWO A;  4W4U A;  3LQJ A;  4FJC A;  2VPD A;  3C5K A;  4LAD B;  4PPE A;  2NAA A;  4NN2 A;  2VPE A;  2G6Q A;  2YQM A;  3LQI A;  4X3G A;  4AP4 A;  2CSZ A;  5LKX A;  1WEN A;  2KGG A;  2YSM A;  4V3L C;  4FO9 A;  2LV9 A;  2LGL A;  2MUM A;  2MNY A;  2EGP A;  4YBM A;  5B75 A;  1DVP A;  1WES A;  5KH9 A;  2YU4 A;  1WIM A;  3FL2 A;  5I3L A;  2MA5 A;  1IYM A;  4YAT A;  1WEP A;  2E6S A;  2KIZ A;  3PUQ A;  2LXP C;  1WEU A;  4GB0 A;  1T1H A;  3T6R A;  2VPG A;  5H1U A;  3M99 A;  4GNF A;  1HYI A;  5D1K B;  4F52 B;  5B8D A;  4BBQ A;  2LDR A;  1Z60 A;  3I2D A;  3M63 A;  3N9L A;  3EB6 A;  5FB0 A;  4B7Y C;  5H1T A;  5D1L B;  2LQ6 A;  1LDK C;  4I7B A;  4A4C A;  2MNZ A;  1Z6U A;  2QJ0 A;  5TRB A;  2G45 A;  2KWN A;  2KE1 A;  4P5O B;  4B86 C;  2ECI A;  2JMJ A;  4GNE A;  4QF3 A;  3SOX A;  1E4U A;  1WGM A;  2CSY A;  1RMD A;  4N3W A;  2PNX A;  3C6W A;  4S3O C;  2Y1N A;  4XI1 A;  5B77 A;  2LXH C;  3GV4 A;  2MT5 A;  2HDP A;  3O7A A;  3ZPV E;  2K16 A;  3U5P A;  1WFK A;  4FIP A;  4CCG X;  1MM2 A;  3SOW A;  3U5N A;  5DKA A;  4MVT A;  4S3O B;  2YT5 A;  3O34 A;  2MD7 B;  3LRQ A;  2RI7 A;  2EOD A;  5LKZ A;  4CA1 A;  4ZUX U;  3RTR B;  4IC2 A;  2VNF A;  1FBV A;  2K4D A;  2XB1 A;  3QZV A;  3HCS A;  1WE9 A;  2E6R A;  2YRE A;  4L7X A;  1XWH A;  2CT2 A;  3ZPV 1;  4WZ3 B;  3KV5 A;  3SHB A;  5KH3 A;  3GL6 A;  2DX8 A;  4LJN A;  4I7C A;  5DIN A;  5H9M A;  3LQH A;  3NG2 A;  2JRJ A;  2YSJ A;  4R8P K;  2OXQ C;  3N9O A;  2UZG A;  2YYR A;  2F6N A;  2C2V S;  2LGV A;  3ZVY A;  5B78 A;  1HYJ A;  4QF2 A;  4YC9 A;  3N9P A;  3HCU A;  3KQI A;  5TDR A;  3O36 A;  4BHW A;  4A49 A;  2LGG A;  4YBT A;  4Q6F A;  5KH7 A;  4GND A;  4WZ2 A;  2KWK A;  2F6J A;  3VK6 A;  2VJE A;  3KV6 A;  5EYA F;  1WEW A;  2YHN A;  4ZQL A;  4N4F A;  2BAY A;  2YUR A;  4AYC A;  2L0B A;  2ECT A;  4UP0 A;  3RPG B;  2L5U A;  1Z2Q A;  2KRE A;  4R7E A;  5C11 A;  4YAD A;  4TKP B;  2FUU A;  2IDA A;  2QIC A;  2MA6 A;  2YQL A;  4PTB A;  1BOR A;  1WEE A;  2KFT A;  2K1J A;  2KWJ A;  3ASL A;  1JOC A;  3U5O A;  2LN0 A;  1WEQ A;  4MSX A;  1X4U A;  2L43 A;  2D8S A;  4WZ0 A;  2VJE B;  4YBS A;  3T7L A;  2ECG A;  4UI9 B;  2M3H A;  5AIU A;  2VJF B;  5LCW B;  3O70 A;  2Y43 A;  4AYC B;  2LRI C;  2ECW A;  1K2F A;  2FUI A;  3DQV R;  1F62 A;  5AIT A;  5D1M B;  1VFY A;  4I7D A;  3DPL R;  3L1Z B;  2CKL A;  2G43 A;  3O33 A;  1JM7 A;  5H1V A;  4IC3 A;  4C9Z A;  3IHP A;  5G05 B;  3EB5 A;  4ZDT A;  3PHD A;  5LKT A;  2VPB A;  2L75 A;  1WEV A;  3U5M A;  4WA6 A;  2KYU A;  2L80 A;  2FSA A;  5FEY A;  3O35 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...