4GNFA

Crystal structure of nsd3 tandem phd5-c5hch domains complexed with h3 peptide 1-15
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
96
structure length
96
Chain Sequence
QMHEDYCFQCGDGGELVMCDKKDCPKAYHLLCLNLTQPPYGKWECPWHQCDECSSAAVSFCEFCPHSFCKDHEKGALVPSALEGRLCCSEHDPMAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone-lysine N-methyltransferase NSD3
publication title The methyltransferase NSD3 has chromatin-binding motifs, PHD5-C5HCH, that are distinct from other NSD (nuclear receptor SET domain) family members in their histone H3 recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/nuclear protein
total genus 20
structure length 96
sequence length 96
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2012-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17982 C5HCH NSD Cys-His rich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4gnfA00
3ZTGA 2VJFA 4A49A 2XEUA 4FJCA 2KGGA 4LK9A 2KIZA 1MM2A 2LN0A 4ZQLA 2YT5A 2KWOA 4P5OB 4GB0A 1LDKC 1WESA 3RPGB 1WEWA 2M6MA 3ZNIA 2MT5A 2MD8C 2F6JA 3O35A 5B76A 1BORA 4N3WA 2QJ0A 5C13A 2YHOA 4AUQB 3DQVR 5J3XA 2L0BA 4UP5A 2YW8A 5D1KB 5TDWA 2EA6A 5H1TA 2FSAA 1WEEA 5FEYA 2H0DB 5LCWB 3T6RA 2EGPA 2F42A 2LQ6A 2YYRA 1VYXA 3KNVA 3O34A 3FL2A 4X3GA 2CSZA 2IDAA 2BAYA 2YSJA 2LDRA 2PUYA 3MHHA 3SOXA 3NG2A 1Z60A 4S3OB 3HCSA 3LQJA 2YHNA 5AIUA 2VP7A 4UI9B 4YBSA 1Z6UA 2YU4A 5TABA 1WILA 4R8PK 1K2FA 1WGMA 4V3LC 3M63A 3O7AA 1WEUA 2L43A 3T7LA 2G45A 3N9QA 2Y1NA 2MNZA 4YAXA 2L75A 2CKLA 2KREA 1WEVA 2L5UA 5LKXA 4A0CD 3MHSA 5D1MB 2ECGA 4WZ3B 2VJEB 4WZ0A 3DPLR 2CT2A 3N9MA 2K16A 5B75A 4AYCA 2VJFB 2VPBA 5EYAF 4R2YA 5B77A 1T1HA 2MA5A 3EB6A 2LXHC 1X4UA 3O37A 4GNFA 2LGKA 1X4IA 3N9OA 4ZDTA 2VPEA 4MSXA 2HYED 2EODA 4IC3A 5H9MA 5B79A 4I7DA 3SOWA 4FK5A 5D1LB 4L7XA 3EB5A 5C11A 2G6QA 4GNDA 5G04B 2ECWA 4CCGX 3L1XA 2D8SA 4QF3A 4WZ2A 1CHCA 3GL6A 4WA6A 3ZPV1 3M99A 2CSYA 4FO9A 3ZPVE 4FIPA 2ECJA 2HDPA 4MVTA 4AVXA 4W4UA 2YQMA 3N9PA 2FUUA 4LJNA 2MD7B 1FBVA 1RMDA 4I7CA 4YABA 1WFKA 5LKTA 4O64A 3RPGC 2K1JA 2PNXA 1FP0A 2KGIA 2QICA 3QZVA 3SHBA 2ECIA 2JRJA 2JMDA 2Y1MA 5H1VA 4YBTA 2CKLB 2ECTA 4R7EA 4AP4A 1U6GB 4GNEA 2MA6A 3LQHA 2LGGA 3SOUA 5LKUA 5JG6A 2LRIC 4A4BA 3O36A 1JM7A 2Y43A 3KV5A 4AYCB 2VPDA 2YUCA 1WEOA 3PURA 3V43A 2YQLA 1F62A 2OXQC 2VPGA 4A4CA 2LGLA 1VD4A 2KR4A 2KE1A 2KYUA 4S3OC 1N87A 4L58A 3ZYQA 2LV9A 3RTRB 5KH9A 4C9ZA 5B78A 2C2LA 1MM3A 1WENA 2ECNA 2UZGA 4N4FA 3O70A 3PHDA 1IYMA 3N9LA 4YBMA 4LKAA 1VFYA 1WEQA 3U5MA 4YC9A 4YATA 2M3HA 4PPEA 4UP0A 1HYJA 2LGVA 4PTBA 5TRBA 2KWNA 1JOCA 5DINA 1V87A 3ZVYA 3U5OA 2AN6A 5I3LA 4V3KC 5AITA 2G43A 2JMIA 3LRQA 2RSDA 2KWJA 3HCTA 5DKAA 5G05B 1WE9A 2M85A 3HCUA 3KQIA 4ZUXU 5KH7A 4B7YC 3M62A 1WEPA 2KFTA 1WEMA 5TDRA 2MUMA 2FUIA 5KH3A 1HYIA 2K17A 5FERA 1E4UA 2JMJA 3U5PA 1G25A 3C6WA 2MNYA 4YADA 4Q6FA 2YSMA 3ZVZB 3VK6A 5LKZA 1WIMA 3KV6A 2YREA 2ZETC 5B8DA 1XWHA 2NAAA 3N9NA 3L1ZB 1JM7B 3C5KA 3GV4A 2RI7A 3PUQA 5FB0A 2F6NA 4QF2A 3L11A 4BHWA 3IHPA 4NN2A 2K4DA 2XB1A 4TKPB 2H0DA 2E6SA 4BBQA 1ZBDB 2KU3A 3HTKC 2E6RA 2QIZA 2L80A 5G0FA 2I50A 5FB1A 1DVPA 3U5NA 4CA1A 4GNGA 3ASLA 2KWKA 4LLBA 3I2DA 4IC2A 2LXPC 2MIQA 2ECVA 2YURA 1LDJB 5H1UA 4I7BA 2VNFA 1X4JA 4XI1A 4F52B 3LQIA 3O33A 4LADB 2C2VS 5TBNA 4B86C 2VJEA 1Z2QA 2DX8A 2M1RA
chains in the Genus database with same CATH superfamily
3ZTGA 2VJFA 4A49A 2XEUA 4FJCA 2KGGA 2EXUA 3JUEA 3KDEC 4LK9A 2KIZA 1MM2A 2LN0A 3LVRE 4ZQLA 2YT5A 2KWOA 4P5OB 4GB0A 1DCQA 1LDKC 1WESA 3RPGB 1WEWA 2M6MA 5K3QA 3ZNIA 2MT5A 2MD8C 2F6JA 3O35A 5B76A 1BORA 4N3WA 2QJ0A 5C13A 2YHOA 2MKEA 4AUQB 3DQVR 5J3XA 2L0BA 4UP5A 2YW8A 5D1KB 5TDWA 2EA6A 5H1TA 2FSAA 1WEEA 5FEYA 2H0DB 4Z0OA 5LCWB 4O62A 3T6RA 2EGPA 2F42A 2LQ6A 2YYRA 2JUNA 1VYXA 3KNVA 3O34A 1MBMA 3FL2A 4X3GA 2CSZA 2IDAA 2BAYA 2YSJA 2LDRA 2PUYA 3MHHA 3SOXA 3NG2A 2JM3A 1Z60A 4S3OB 5SVIA 3HCSA 3LQJA 2YHNA 5AIUA 2VP7A 4UI9B 4OGCA 4YBSA 1Z6UA 2YU4A 5TABA 1WILA 2XOCA 4R8PK 1K2FA 1WGMA 4V3LC 3M63A 3O7AA 1WEUA 2L43A 3T7LA 2G45A 3N9QA 2Y1NA 2MNZA 4YAXA 2L75A 2CKLA 2KREA 1WEVA 2L5UA 5LKXA 4A0CD 3MHSA 5D1MB 2ECGA 4WZ3B 2VJEB 4WZ0A 3DPLR 2CT2A 3N9MA 2K16A 5B75A 4AYCA 3LVQE 2VJFB 2VPBA 5EYAF 3Q1DA 4R2YA 2CRWA 5B77A 1T1HA 2MA5A 3EB6A 2LXHC 3T9KA 2KKYA 1X4UA 3O37A 4GNFA 2LGKA 1X4IA 3N9OA 4ZDTA 2VPEA 4MSXA 4F1PA 2HYED 2EODA 4IC3A 5H9MA 5B79A 4I7DA 3SOWA 4FK5A 5D1LB 4L7XA 3EB5A 5C11A 2G6QA 4GNDA 5G04B 2ECWA 2DJAA 4CCGX 3L1XA 2D8SA 4QF3A 2D8UA 4WZ2A 5SVYA 3FM8C 1CHCA 3GL6A 4WA6A 3ZPV1 3LDYA 3M99A 2CSYA 4FO9A 3ZPVE 4FIPA 2ECJA 2HDPA 4MVTA 4AVXA 4W4UA 2YQMA 3N9PA 2FUUA 2XP0A 4LJNA 5SVIB 3SUBA 2P57A 2LAUA 1FBVA 2MD7B 1RMDA 4I7CA 4YABA 2E61A 1WFKA 5LKTA 2B0OE 4O64A 3RPGC 2K1JA 2PNXA 1FP0A 3FJUB 2KGIA 2QICA 3E2DA 3QZVA 3SHBA 2ECIA 2JRJA 2JMDA 2Y1MA 5H1VA 4YBTA 2CKLB 3DWDA 2ECTA 4R7EA 4AP4A 1U6GB 4GNEA 2MA6A 3LQHA 2LGGA 3SOUA 5LKUA 5JG6A 4OGEA 3FEHA 3M7KA 2LRIC 4A4BA 3O36A 3FAOA 1JM7A 2Y43A 3KV5A 4AYCB 2VPDA 2YUCA 1WEOA 3PURA 4H9DA 3V43A 2YQLA 1F62A 2OXQC 2VPGA 4A4CA 2LGLA 1VD4A 2KR4A 2FFWA 2KE1A 2KYUA 4S3OC 2KKXA 2L7PA 1N87A 4L58A 3ZYQA 2LV9A 3RTRB 5KH9A 4C9ZA 2OWAA 5B78A 2C2LA 2XOYA 1MM3A 1WENA 2ECNA 2UZGA 4N4FA 3PLWA 3O70A 3PHDA 1IYMA 3N9LA 4YBMA 4LKAA 1VFYA 1WEQA 3U5MA 4YC9A 4YATA 2M3HA 4PPEA 2RR4A 4UP0A 1HYJA 2LGVA 4PTBA 5TRBA 2KWNA 1JOCA 5DINA 1V87A 3ZVYA 2CSVA 2CONA 3U5OA 2AN6A 5I3LA 4V3KC 5AITA 2G43A 2JMIA 3LRQA 2RSDA 2KWJA 3HCTA 5DKAA 5G05B 1WE9A 2DSMA 2M85A 3HCUA 3KQIA 4ZUXU 5KH7A 4B7YC 3M62A 1WEPA 2KFTA 1WEMA 5TDRA 2MUMA 2FUIA 5KH3A 1HYIA 2K17A 5FERA 1E4UA 2JMJA 3U5PA 1G25A 3C6WA 2MNYA 4QQ4A 4YADA 4Q6FA 2YSMA 2FD4A 3VK6A 3ZVZB 5LKZA 1WIMA 3KV6A 2YREA 2ZETC 5B8DA 1XWHA 2NAAA 3MDBC 3N9NA 3L1ZB 1JM7B 2CRRA 3C5KA 3GV4A 2RI7A 3PUQA 5FB0A 3FANA 2F6NA 4QF2A 3L11A 4BHWA 3IHPA 2EGMA 2YVRA 4NN2A 2K4DA 2XB1A 4TKPB 2H0DA 2E6SA 4Z0RA 3O47A 4BBQA 1ZBDB 2KU3A 3HTKC 2E6RA 2QIZA 2L80A 5G0FA 2I50A 5FB1A 1DVPA 3U5NA 4CA1A 4GNGA 3ASLA 3LJUX 5SVXA 2KWKA 4LLBA 3I2DA 2XOZA 4IC2A 2LXPC 2MIQA 2ECVA 2YURA 1LDJB 5H1UA 4I7BA 2VNFA 3H7HA 1X4JA 4XI1A 2IQJA 4F52B 3LQIA 3O33A 4LADB 2C2VS 2M13A 5TBNA 4B86C 2VJEA 1Z2QA 2DX8A 2M1RA 3DDTA
chains in the Genus database with same CATH topology
3ZTGA 2VJFA 4A49A 2XEUA 4FJCA 2KGGA 4LK9A 2KIZA 1MM2A 2LN0A 4ZQLA 2YT5A 2KWOA 4P5OB 4GB0A 1LDKC 1WESA 3RPGB 1WEWA 2M6MA 3ZNIA 2MT5A 2MD8C 2F6JA 3O35A 5B76A 1BORA 4N3WA 2QJ0A 5C13A 2YHOA 4AUQB 3DQVR 5J3XA 2L0BA 4UP5A 2YW8A 5D1KB 5TDWA 2EA6A 5H1TA 2FSAA 1WEEA 5FEYA 2H0DB 5LCWB 3T6RA 2EGPA 2F42A 2LQ6A 2YYRA 1VYXA 3KNVA 3O34A 3FL2A 4X3GA 2CSZA 2IDAA 2BAYA 2YSJA 2LDRA 2PUYA 3MHHA 3SOXA 3NG2A 1Z60A 4S3OB 3HCSA 3LQJA 2YHNA 5AIUA 2VP7A 4UI9B 4YBSA 1Z6UA 2YU4A 5TABA 1WILA 4R8PK 1K2FA 1WGMA 4V3LC 3M63A 3O7AA 1WEUA 2L43A 3T7LA 2G45A 3N9QA 2Y1NA 2MNZA 4YAXA 2L75A 2CKLA 2KREA 1WEVA 2L5UA 5LKXA 4A0CD 3MHSA 5D1MB 2ECGA 4WZ3B 2VJEB 4WZ0A 3DPLR 2CT2A 3N9MA 2K16A 5B75A 4AYCA 2VJFB 2VPBA 5EYAF 4R2YA 5B77A 1T1HA 2MA5A 3EB6A 2LXHC 1X4UA 3O37A 4GNFA 2LGKA 1X4IA 3N9OA 4ZDTA 2VPEA 4MSXA 2HYED 2EODA 4IC3A 5H9MA 5B79A 4I7DA 3SOWA 4FK5A 5D1LB 4L7XA 3EB5A 5C11A 2G6QA 4GNDA 5G04B 2ECWA 4CCGX 3L1XA 2D8SA 4QF3A 4WZ2A 1CHCA 3GL6A 4WA6A 3ZPV1 3M99A 2CSYA 4FO9A 3ZPVE 4FIPA 2ECJA 2HDPA 4MVTA 4AVXA 4W4UA 2YQMA 3N9PA 2FUUA 4LJNA 2MD7B 1FBVA 1RMDA 4I7CA 4YABA 1WFKA 5LKTA 4O64A 3RPGC 2K1JA 2PNXA 1FP0A 2KGIA 2QICA 3QZVA 3SHBA 2ECIA 2JRJA 2JMDA 2Y1MA 5H1VA 4YBTA 2CKLB 2ECTA 4R7EA 4AP4A 1U6GB 4GNEA 2MA6A 3LQHA 2LGGA 3SOUA 5LKUA 5JG6A 2LRIC 4A4BA 3O36A 1JM7A 2Y43A 3KV5A 4AYCB 2VPDA 2YUCA 1WEOA 3PURA 3V43A 2YQLA 1F62A 2OXQC 2VPGA 4A4CA 2LGLA 1VD4A 2KR4A 2KE1A 2KYUA 4S3OC 1N87A 4L58A 3ZYQA 2LV9A 3RTRB 5KH9A 4C9ZA 5B78A 2C2LA 1MM3A 1WENA 2ECNA 2UZGA 4N4FA 3O70A 3PHDA 1IYMA 3N9LA 4YBMA 4LKAA 1VFYA 1WEQA 3U5MA 4YC9A 4YATA 2M3HA 4PPEA 4UP0A 1HYJA 2LGVA 4PTBA 5TRBA 2KWNA 1JOCA 5DINA 1V87A 3ZVYA 3U5OA 2AN6A 5I3LA 4V3KC 5AITA 2G43A 2JMIA 3LRQA 2RSDA 2KWJA 3HCTA 5DKAA 5G05B 1WE9A 2M85A 3HCUA 3KQIA 4ZUXU 5KH7A 4B7YC 3M62A 1WEPA 2KFTA 1WEMA 5TDRA 2MUMA 2FUIA 5KH3A 1HYIA 2K17A 5FERA 1E4UA 2JMJA 3U5PA 1G25A 3C6WA 2MNYA 4YADA 4Q6FA 2YSMA 3ZVZB 3VK6A 5LKZA 1WIMA 3KV6A 2YREA 2ZETC 5B8DA 1XWHA 2NAAA 3N9NA 3L1ZB 1JM7B 3C5KA 3GV4A 2RI7A 3PUQA 5FB0A 2F6NA 4QF2A 3L11A 4BHWA 3IHPA 4NN2A 2K4DA 2XB1A 4TKPB 2H0DA 2E6SA 4BBQA 1ZBDB 2KU3A 3HTKC 2E6RA 2QIZA 2L80A 5G0FA 2I50A 5FB1A 1DVPA 3U5NA 4CA1A 4GNGA 3ASLA 2KWKA 4LLBA 3I2DA 4IC2A 2LXPC 2MIQA 2ECVA 2YURA 1LDJB 5H1UA 4I7BA 2VNFA 1X4JA 4XI1A 4F52B 3LQIA 3O33A 4LADB 2C2VS 5TBNA 4B86C 2VJEA 1Z2QA 2DX8A 2M1RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZTG A;  2VJF A;  4A49 A;  2XEU A;  4FJC A;  2KGG A;  4LK9 A;  2KIZ A;  1MM2 A;  2LN0 A;  4ZQL A;  2YT5 A;  2KWO A;  4P5O B;  4GB0 A;  1LDK C;  1WES A;  3RPG B;  1WEW A;  2M6M A;  3ZNI A;  2MT5 A;  2MD8 C;  2F6J A;  3O35 A;  5B76 A;  1BOR A;  4N3W A;  2QJ0 A;  5C13 A;  2YHO A;  4AUQ B;  3DQV R;  5J3X A;  2L0B A;  4UP5 A;  2YW8 A;  5D1K B;  5TDW A;  2EA6 A;  5H1T A;  2FSA A;  1WEE A;  5FEY A;  2H0D B;  5LCW B;  3T6R A;  2EGP A;  2F42 A;  2LQ6 A;  2YYR A;  1VYX A;  3KNV A;  3O34 A;  3FL2 A;  4X3G A;  2CSZ A;  2IDA A;  2BAY A;  2YSJ A;  2LDR A;  2PUY A;  3MHH A;  3SOX A;  3NG2 A;  1Z60 A;  4S3O B;  3HCS A;  3LQJ A;  2YHN A;  5AIU A;  2VP7 A;  4UI9 B;  4YBS A;  1Z6U A;  2YU4 A;  5TAB A;  1WIL A;  4R8P K;  1K2F A;  1WGM A;  4V3L C;  3M63 A;  3O7A A;  1WEU A;  2L43 A;  3T7L A;  2G45 A;  3N9Q A;  2Y1N A;  2MNZ A;  4YAX A;  2L75 A;  2CKL A;  2KRE A;  1WEV A;  2L5U A;  5LKX A;  4A0C D;  3MHS A;  5D1M B;  2ECG A;  4WZ3 B;  2VJE B;  4WZ0 A;  3DPL R;  2CT2 A;  3N9M A;  2K16 A;  5B75 A;  4AYC A;  2VJF B;  2VPB A;  5EYA F;  4R2Y A;  5B77 A;  1T1H A;  2MA5 A;  3EB6 A;  2LXH C;  1X4U A;  3O37 A;  4GNF A;  2LGK A;  1X4I A;  3N9O A;  4ZDT A;  2VPE A;  4MSX A;  2HYE D;  2EOD A;  4IC3 A;  5H9M A;  5B79 A;  4I7D A;  3SOW A;  4FK5 A;  5D1L B;  4L7X A;  3EB5 A;  5C11 A;  2G6Q A;  4GND A;  5G04 B;  2ECW A;  4CCG X;  3L1X A;  2D8S A;  4QF3 A;  4WZ2 A;  1CHC A;  3GL6 A;  4WA6 A;  3ZPV 1;  3M99 A;  2CSY A;  4FO9 A;  3ZPV E;  4FIP A;  2ECJ A;  2HDP A;  4MVT A;  4AVX A;  4W4U A;  2YQM A;  3N9P A;  2FUU A;  4LJN A;  2MD7 B;  1FBV A;  1RMD A;  4I7C A;  4YAB A;  1WFK A;  5LKT A;  4O64 A;  3RPG C;  2K1J A;  2PNX A;  1FP0 A;  2KGI A;  2QIC A;  3QZV A;  3SHB A;  2ECI A;  2JRJ A;  2JMD A;  2Y1M A;  5H1V A;  4YBT A;  2CKL B;  2ECT A;  4R7E A;  4AP4 A;  1U6G B;  4GNE A;  2MA6 A;  3LQH A;  2LGG A;  3SOU A;  5LKU A;  5JG6 A;  2LRI C;  4A4B A;  3O36 A;  1JM7 A;  2Y43 A;  3KV5 A;  4AYC B;  2VPD A;  2YUC A;  1WEO A;  3PUR A;  3V43 A;  2YQL A;  1F62 A;  2OXQ C;  2VPG A;  4A4C A;  2LGL A;  1VD4 A;  2KR4 A;  2KE1 A;  2KYU A;  4S3O C;  1N87 A;  4L58 A;  3ZYQ A;  2LV9 A;  3RTR B;  5KH9 A;  4C9Z A;  5B78 A;  2C2L A;  1MM3 A;  1WEN A;  2ECN A;  2UZG A;  4N4F A;  3O70 A;  3PHD A;  1IYM A;  3N9L A;  4YBM A;  4LKA A;  1VFY A;  1WEQ A;  3U5M A;  4YC9 A;  4YAT A;  2M3H A;  4PPE A;  4UP0 A;  1HYJ A;  2LGV A;  4PTB A;  5TRB A;  2KWN A;  1JOC A;  5DIN A;  1V87 A;  3ZVY A;  3U5O A;  2AN6 A;  5I3L A;  4V3K C;  5AIT A;  2G43 A;  2JMI A;  3LRQ A;  2RSD A;  2KWJ A;  3HCT A;  5DKA A;  5G05 B;  1WE9 A;  2M85 A;  3HCU A;  3KQI A;  4ZUX U;  5KH7 A;  4B7Y C;  3M62 A;  1WEP A;  2KFT A;  1WEM A;  5TDR A;  2MUM A;  2FUI A;  5KH3 A;  1HYI A;  2K17 A;  5FER A;  1E4U A;  2JMJ A;  3U5P A;  1G25 A;  3C6W A;  2MNY A;  4YAD A;  4Q6F A;  2YSM A;  3ZVZ B;  3VK6 A;  5LKZ A;  1WIM A;  3KV6 A;  2YRE A;  2ZET C;  5B8D A;  1XWH A;  2NAA A;  3N9N A;  3L1Z B;  1JM7 B;  3C5K A;  3GV4 A;  2RI7 A;  3PUQ A;  5FB0 A;  2F6N A;  4QF2 A;  3L11 A;  4BHW A;  3IHP A;  4NN2 A;  2K4D A;  2XB1 A;  4TKP B;  2H0D A;  2E6S A;  4BBQ A;  1ZBD B;  2KU3 A;  3HTK C;  2E6R A;  2QIZ A;  2L80 A;  5G0F A;  2I50 A;  5FB1 A;  1DVP A;  3U5N A;  4CA1 A;  4GNG A;  3ASL A;  2KWK A;  4LLB A;  3I2D A;  4IC2 A;  2LXP C;  2MIQ A;  2ECV A;  2YUR A;  1LDJ B;  5H1U A;  4I7B A;  2VNF A;  1X4J A;  4XI1 A;  4F52 B;  3LQI A;  3O33 A;  4LAD B;  2C2V S;  5TBN A;  4B86 C;  2VJE A;  1Z2Q A;  2DX8 A;  2M1R A; 
#chains in the Genus database with same CATH topology
 3ZTG A;  2VJF A;  4A49 A;  2XEU A;  4FJC A;  2KGG A;  2EXU A;  3JUE A;  3KDE C;  4LK9 A;  2KIZ A;  1MM2 A;  2LN0 A;  3LVR E;  4ZQL A;  2YT5 A;  2KWO A;  4P5O B;  4GB0 A;  1DCQ A;  1LDK C;  1WES A;  3RPG B;  1WEW A;  2M6M A;  5K3Q A;  3ZNI A;  2MT5 A;  2MD8 C;  2F6J A;  3O35 A;  5B76 A;  1BOR A;  4N3W A;  2QJ0 A;  5C13 A;  2YHO A;  2MKE A;  4AUQ B;  3DQV R;  5J3X A;  2L0B A;  4UP5 A;  2YW8 A;  5D1K B;  5TDW A;  2EA6 A;  5H1T A;  2FSA A;  1WEE A;  5FEY A;  2H0D B;  4Z0O A;  5LCW B;  4O62 A;  3T6R A;  2EGP A;  2F42 A;  2LQ6 A;  2YYR A;  2JUN A;  1VYX A;  3KNV A;  3O34 A;  1MBM A;  3FL2 A;  4X3G A;  2CSZ A;  2IDA A;  2BAY A;  2YSJ A;  2LDR A;  2PUY A;  3MHH A;  3SOX A;  3NG2 A;  2JM3 A;  1Z60 A;  4S3O B;  5SVI A;  3HCS A;  3LQJ A;  2YHN A;  5AIU A;  2VP7 A;  4UI9 B;  4OGC A;  4YBS A;  1Z6U A;  2YU4 A;  5TAB A;  1WIL A;  2XOC A;  4R8P K;  1K2F A;  1WGM A;  4V3L C;  3M63 A;  3O7A A;  1WEU A;  2L43 A;  3T7L A;  2G45 A;  3N9Q A;  2Y1N A;  2MNZ A;  4YAX A;  2L75 A;  2CKL A;  2KRE A;  1WEV A;  2L5U A;  5LKX A;  4A0C D;  3MHS A;  5D1M B;  2ECG A;  4WZ3 B;  2VJE B;  4WZ0 A;  3DPL R;  2CT2 A;  3N9M A;  2K16 A;  5B75 A;  4AYC A;  3LVQ E;  2VJF B;  2VPB A;  5EYA F;  3Q1D A;  4R2Y A;  2CRW A;  5B77 A;  1T1H A;  2MA5 A;  3EB6 A;  2LXH C;  3T9K A;  2KKY A;  1X4U A;  3O37 A;  4GNF A;  2LGK A;  1X4I A;  3N9O A;  4ZDT A;  2VPE A;  4MSX A;  4F1P A;  2HYE D;  2EOD A;  4IC3 A;  5H9M A;  5B79 A;  4I7D A;  3SOW A;  4FK5 A;  5D1L B;  4L7X A;  3EB5 A;  5C11 A;  2G6Q A;  4GND A;  5G04 B;  2ECW A;  2DJA A;  4CCG X;  3L1X A;  2D8S A;  4QF3 A;  2D8U A;  4WZ2 A;  5SVY A;  3FM8 C;  1CHC A;  3GL6 A;  4WA6 A;  3ZPV 1;  3LDY A;  3M99 A;  2CSY A;  4FO9 A;  3ZPV E;  4FIP A;  2ECJ A;  2HDP A;  4MVT A;  4AVX A;  4W4U A;  2YQM A;  3N9P A;  2FUU A;  2XP0 A;  4LJN A;  5SVI B;  3SUB A;  2P57 A;  2LAU A;  1FBV A;  2MD7 B;  1RMD A;  4I7C A;  4YAB A;  2E61 A;  1WFK A;  5LKT A;  2B0O E;  4O64 A;  3RPG C;  2K1J A;  2PNX A;  1FP0 A;  3FJU B;  2KGI A;  2QIC A;  3E2D A;  3QZV A;  3SHB A;  2ECI A;  2JRJ A;  2JMD A;  2Y1M A;  5H1V A;  4YBT A;  2CKL B;  3DWD A;  2ECT A;  4R7E A;  4AP4 A;  1U6G B;  4GNE A;  2MA6 A;  3LQH A;  2LGG A;  3SOU A;  5LKU A;  5JG6 A;  4OGE A;  3FEH A;  3M7K A;  2LRI C;  4A4B A;  3O36 A;  3FAO A;  1JM7 A;  2Y43 A;  3KV5 A;  4AYC B;  2VPD A;  2YUC A;  1WEO A;  3PUR A;  4H9D A;  3V43 A;  2YQL A;  1F62 A;  2OXQ C;  2VPG A;  4A4C A;  2LGL A;  1VD4 A;  2KR4 A;  2FFW A;  2KE1 A;  2KYU A;  4S3O C;  2KKX A;  2L7P A;  1N87 A;  4L58 A;  3ZYQ A;  2LV9 A;  3RTR B;  5KH9 A;  4C9Z A;  2OWA A;  5B78 A;  2C2L A;  2XOY A;  1MM3 A;  1WEN A;  2ECN A;  2UZG A;  4N4F A;  3PLW A;  3O70 A;  3PHD A;  1IYM A;  3N9L A;  4YBM A;  4LKA A;  1VFY A;  1WEQ A;  3U5M A;  4YC9 A;  4YAT A;  2M3H A;  4PPE A;  2RR4 A;  4UP0 A;  1HYJ A;  2LGV A;  4PTB A;  5TRB A;  2KWN A;  1JOC A;  5DIN A;  1V87 A;  3ZVY A;  2CSV A;  2CON A;  3U5O A;  2AN6 A;  5I3L A;  4V3K C;  5AIT A;  2G43 A;  2JMI A;  3LRQ A;  2RSD A;  2KWJ A;  3HCT A;  5DKA A;  5G05 B;  1WE9 A;  2DSM A;  2M85 A;  3HCU A;  3KQI A;  4ZUX U;  5KH7 A;  4B7Y C;  3M62 A;  1WEP A;  2KFT A;  1WEM A;  5TDR A;  2MUM A;  2FUI A;  5KH3 A;  1HYI A;  2K17 A;  5FER A;  1E4U A;  2JMJ A;  3U5P A;  1G25 A;  3C6W A;  2MNY A;  4QQ4 A;  4YAD A;  4Q6F A;  2YSM A;  2FD4 A;  3VK6 A;  3ZVZ B;  5LKZ A;  1WIM A;  3KV6 A;  2YRE A;  2ZET C;  5B8D A;  1XWH A;  2NAA A;  3MDB C;  3N9N A;  3L1Z B;  1JM7 B;  2CRR A;  3C5K A;  3GV4 A;  2RI7 A;  3PUQ A;  5FB0 A;  3FAN A;  2F6N A;  4QF2 A;  3L11 A;  4BHW A;  3IHP A;  2EGM A;  2YVR A;  4NN2 A;  2K4D A;  2XB1 A;  4TKP B;  2H0D A;  2E6S A;  4Z0R A;  3O47 A;  4BBQ A;  1ZBD B;  2KU3 A;  3HTK C;  2E6R A;  2QIZ A;  2L80 A;  5G0F A;  2I50 A;  5FB1 A;  1DVP A;  3U5N A;  4CA1 A;  4GNG A;  3ASL A;  3LJU X;  5SVX A;  2KWK A;  4LLB A;  3I2D A;  2XOZ A;  4IC2 A;  2LXP C;  2MIQ A;  2ECV A;  2YUR A;  1LDJ B;  5H1U A;  4I7B A;  2VNF A;  3H7H A;  1X4J A;  4XI1 A;  2IQJ A;  4F52 B;  3LQI A;  3O33 A;  4LAD B;  2C2V S;  2M13 A;  5TBN A;  4B86 C;  2VJE A;  1Z2Q A;  2DX8 A;  2M1R A;  3DDT A; 
#chains in the Genus database with same CATH homology
 3ZTG A;  2VJF A;  4A49 A;  2XEU A;  4FJC A;  2KGG A;  4LK9 A;  2KIZ A;  1MM2 A;  2LN0 A;  4ZQL A;  2YT5 A;  2KWO A;  4P5O B;  4GB0 A;  1LDK C;  1WES A;  3RPG B;  1WEW A;  2M6M A;  3ZNI A;  2MT5 A;  2MD8 C;  2F6J A;  3O35 A;  5B76 A;  1BOR A;  4N3W A;  2QJ0 A;  5C13 A;  2YHO A;  4AUQ B;  3DQV R;  5J3X A;  2L0B A;  4UP5 A;  2YW8 A;  5D1K B;  5TDW A;  2EA6 A;  5H1T A;  2FSA A;  1WEE A;  5FEY A;  2H0D B;  5LCW B;  3T6R A;  2EGP A;  2F42 A;  2LQ6 A;  2YYR A;  1VYX A;  3KNV A;  3O34 A;  3FL2 A;  4X3G A;  2CSZ A;  2IDA A;  2BAY A;  2YSJ A;  2LDR A;  2PUY A;  3MHH A;  3SOX A;  3NG2 A;  1Z60 A;  4S3O B;  3HCS A;  3LQJ A;  2YHN A;  5AIU A;  2VP7 A;  4UI9 B;  4YBS A;  1Z6U A;  2YU4 A;  5TAB A;  1WIL A;  4R8P K;  1K2F A;  1WGM A;  4V3L C;  3M63 A;  3O7A A;  1WEU A;  2L43 A;  3T7L A;  2G45 A;  3N9Q A;  2Y1N A;  2MNZ A;  4YAX A;  2L75 A;  2CKL A;  2KRE A;  1WEV A;  2L5U A;  5LKX A;  4A0C D;  3MHS A;  5D1M B;  2ECG A;  4WZ3 B;  2VJE B;  4WZ0 A;  3DPL R;  2CT2 A;  3N9M A;  2K16 A;  5B75 A;  4AYC A;  2VJF B;  2VPB A;  5EYA F;  4R2Y A;  5B77 A;  1T1H A;  2MA5 A;  3EB6 A;  2LXH C;  1X4U A;  3O37 A;  4GNF A;  2LGK A;  1X4I A;  3N9O A;  4ZDT A;  2VPE A;  4MSX A;  2HYE D;  2EOD A;  4IC3 A;  5H9M A;  5B79 A;  4I7D A;  3SOW A;  4FK5 A;  5D1L B;  4L7X A;  3EB5 A;  5C11 A;  2G6Q A;  4GND A;  5G04 B;  2ECW A;  4CCG X;  3L1X A;  2D8S A;  4QF3 A;  4WZ2 A;  1CHC A;  3GL6 A;  4WA6 A;  3ZPV 1;  3M99 A;  2CSY A;  4FO9 A;  3ZPV E;  4FIP A;  2ECJ A;  2HDP A;  4MVT A;  4AVX A;  4W4U A;  2YQM A;  3N9P A;  2FUU A;  4LJN A;  2MD7 B;  1FBV A;  1RMD A;  4I7C A;  4YAB A;  1WFK A;  5LKT A;  4O64 A;  3RPG C;  2K1J A;  2PNX A;  1FP0 A;  2KGI A;  2QIC A;  3QZV A;  3SHB A;  2ECI A;  2JRJ A;  2JMD A;  2Y1M A;  5H1V A;  4YBT A;  2CKL B;  2ECT A;  4R7E A;  4AP4 A;  1U6G B;  4GNE A;  2MA6 A;  3LQH A;  2LGG A;  3SOU A;  5LKU A;  5JG6 A;  2LRI C;  4A4B A;  3O36 A;  1JM7 A;  2Y43 A;  3KV5 A;  4AYC B;  2VPD A;  2YUC A;  1WEO A;  3PUR A;  3V43 A;  2YQL A;  1F62 A;  2OXQ C;  2VPG A;  4A4C A;  2LGL A;  1VD4 A;  2KR4 A;  2KE1 A;  2KYU A;  4S3O C;  1N87 A;  4L58 A;  3ZYQ A;  2LV9 A;  3RTR B;  5KH9 A;  4C9Z A;  5B78 A;  2C2L A;  1MM3 A;  1WEN A;  2ECN A;  2UZG A;  4N4F A;  3O70 A;  3PHD A;  1IYM A;  3N9L A;  4YBM A;  4LKA A;  1VFY A;  1WEQ A;  3U5M A;  4YC9 A;  4YAT A;  2M3H A;  4PPE A;  4UP0 A;  1HYJ A;  2LGV A;  4PTB A;  5TRB A;  2KWN A;  1JOC A;  5DIN A;  1V87 A;  3ZVY A;  3U5O A;  2AN6 A;  5I3L A;  4V3K C;  5AIT A;  2G43 A;  2JMI A;  3LRQ A;  2RSD A;  2KWJ A;  3HCT A;  5DKA A;  5G05 B;  1WE9 A;  2M85 A;  3HCU A;  3KQI A;  4ZUX U;  5KH7 A;  4B7Y C;  3M62 A;  1WEP A;  2KFT A;  1WEM A;  5TDR A;  2MUM A;  2FUI A;  5KH3 A;  1HYI A;  2K17 A;  5FER A;  1E4U A;  2JMJ A;  3U5P A;  1G25 A;  3C6W A;  2MNY A;  4YAD A;  4Q6F A;  2YSM A;  3ZVZ B;  3VK6 A;  5LKZ A;  1WIM A;  3KV6 A;  2YRE A;  2ZET C;  5B8D A;  1XWH A;  2NAA A;  3N9N A;  3L1Z B;  1JM7 B;  3C5K A;  3GV4 A;  2RI7 A;  3PUQ A;  5FB0 A;  2F6N A;  4QF2 A;  3L11 A;  4BHW A;  3IHP A;  4NN2 A;  2K4D A;  2XB1 A;  4TKP B;  2H0D A;  2E6S A;  4BBQ A;  1ZBD B;  2KU3 A;  3HTK C;  2E6R A;  2QIZ A;  2L80 A;  5G0F A;  2I50 A;  5FB1 A;  1DVP A;  3U5N A;  4CA1 A;  4GNG A;  3ASL A;  2KWK A;  4LLB A;  3I2D A;  4IC2 A;  2LXP C;  2MIQ A;  2ECV A;  2YUR A;  1LDJ B;  5H1U A;  4I7B A;  2VNF A;  1X4J A;  4XI1 A;  4F52 B;  3LQI A;  3O33 A;  4LAD B;  2C2V S;  5TBN A;  4B86 C;  2VJE A;  1Z2Q A;  2DX8 A;  2M1R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...