2ECGA

Solution structure of the ring domain of the baculoviral iap repeat-containing protein 4 from homo sapiens
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
75
structure length
75
Chain Sequence
GSSGSSGSLQKEISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDKCPMCYTVITFKQKIFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the ring domain of the Baculoviral IAP repeat-containing protein 4 from Homo sapiens
rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords Baculoviral IAP repeat-containing protein 4
total genus 6
structure length 75
sequence length 75
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2007-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2ecgA00
4WZ3B 3EB5A 5G05B 2XEUA 4S3OB 2ECIA 2YREA 4MVTA 2EODA 2M1RA 2JMIA 2ECWA 4Q6FA 1WE9A 2LXHC 5G04B 1WEQA 1WEEA 3O34A 4NN2A 2PNXA 5JG6A 4LLBA 5LKUA 1WENA 2CSZA 2VPDA 4CA1A 2C2VS 3LQIA 2CSYA 5C11A 4CCGX 1Z60A 2L0BA 5J3XA 3C5KA 3HCTA 4WZ0A 1VFYA 2CKLB 3M63A 5LCWB 2ECJA 5TDWA 5FEYA 2YQMA 3LRQA 2OXQC 2K4DA 5TDRA 2LGKA 3L1ZB 1N87A 2LQ6A 1E4UA 2VPEA 3N9PA 1DVPA 2E6SA 2K17A 4R2YA 4WA6A 2I50A 3IHPA 5H1VA 3V43A 4A4CA 2KYUA 1WEUA 1VD4A 2VJFB 1LDKC 2IDAA 3ZVZB 3O70A 4AUQB 3PURA 1JM7B 2Y43A 1BORA 4FJCA 4UP5A 3SOWA 4GNGA 2ECNA 2QIZA 2L80A 1G25A 2YYRA 3LQJA 5EYAF 1FP0A 2KE1A 4N4FA 3GV4A 4X3GA 2HYED 4IC2A 1K2FA 2F6NA 2RSDA 1U6GB 4QF3A 4GNEA 2FUUA 4MSXA 3KV5A 2KWKA 2YQLA 3RPGB 5LKZA 2LDRA 2L43A 4BHWA 4AYCA 1WFKA 3DQVR 4LKAA 5H1UA 3L11A 5FERA 2UZGA 5DINA 3QZVA 2LRIC 2DX8A 3O7AA 1JOCA 1WEOA 2YU4A 4LK9A 4YABA 1Z2QA 3MHHA 2PUYA 2Y1NA 1X4IA 4O64A 1Z6UA 2XB1A 3SHBA 5B77A 3ZPV1 4YBSA 2MNYA 4YBTA 3N9NA 3MHSA 2MD7B 3VK6A 5AITA 2LGGA 5TRBA 2AN6A 5B76A 3N9LA 4GNFA 1VYXA 5KH9A 3I2DA 5B78A 4UP0A 4A49A 2VNFA 1RMDA 2LV9A 5I3LA 3RTRB 2RI7A 2G45A 4N3WA 2M85A 4YC9A 1WGMA 5H1TA 4I7DA 3O37A 2VPBA 4FK5A 4P5OB 2CKLA 4XI1A 4ZQLA 5D1MB 4UI9B 2F42A 4YBMA 2YHOA 4YATA 2CT2A 4B86C 2YSMA 1MM3A 1WEWA 4YAXA 2VJEA 2K1JA 4GNDA 1FBVA 2VJEB 5B8DA 3T6RA 4PTBA 2MD8C 2EA6A 2LGLA 2G43A 2KGGA 2L75A 4S3OC 2K16A 4BBQA 2LN0A 4PPEA 3U5NA 2FSAA 3DPLR 1IYMA 2ECGA 4R7EA 2KR4A 3O33A 4A0CD 2F6JA 3ZNIA 4I7BA 3PHDA 2YHNA 2ZETC 3ASLA 3N9MA 2VPGA 1JM7A 3N9QA 2MA6A 2M6MA 5TABA 1T1HA 5LKXA 5D1KB 4L58A 2LXPC 3NG2A 2YT5A 2EGPA 3ZPVE 3O36A 2KU3A 3U5OA 1WIMA 1LDJB 1WEPA 3ZYQA 1MM2A 2MT5A 5KH7A 2KREA 3ZVYA 2HDPA 3U5PA 5FB1A 2H0DA 2QICA 4ZUXU 2MUMA 2VP7A 4IC3A 3M62A 4TKPB 3KNVA 1HYIA 2JRJA 3L1XA 5AIUA 1WILA 2YUCA 3RPGC 1X4UA 2D8SA 3GL6A 3EB6A 4V3KC 2ECTA 2KWOA 2YSJA 2JMJA 5G0FA 1F62A 4WZ2A 3HCUA 3ZTGA 2ECVA 4V3LC 1WEMA 1ZBDB 5B75A 3FL2A 5D1LB 5H9MA 4A4BA 2FUIA 5B79A 3LQHA 2M3HA 3T7LA 4L7XA 1XWHA 4I7CA 2KIZA 2KWNA 2MIQA 3KQIA 2YW8A 1WEVA 5LKTA 2H0DB 3SOXA 2VJFA 2MA5A 5TBNA 4QF2A 3HCSA 3PUQA 5FB0A 5DKAA 4R8PK 3HTKC 2NAAA 1WESA 2KFTA 2MNZA 4ZDTA 2BAYA 2YURA 4FIPA 2KWJA 4F52B 4AP4A 3N9OA 2G6QA 1CHCA 3KV6A 2Y1MA 4GB0A 4AVXA 3O35A 4LADB 3M99A 1V87A 4C9ZA 5KH3A 2LGVA 4AYCB 4FO9A 1X4JA 2KGIA 2L5UA 4LJNA 3U5MA 1HYJA 2C2LA 4B7YC 5C13A 3C6WA 2E6RA 4YADA 4W4UA 2QJ0A 2JMDA 3SOUA
chains in the Genus database with same CATH superfamily
4WZ3B 3EB5A 2CONA 2OWAA 5SVXA 5G05B 2XEUA 4S3OB 2ECIA 2YREA 4MVTA 2EODA 2M1RA 2JMIA 3LJUX 2ECWA 4Q6FA 1WE9A 2LXHC 5G04B 1WEQA 1WEEA 3O34A 2RR4A 4NN2A 2PNXA 5JG6A 4LLBA 2KKXA 5LKUA 3LDYA 1WENA 4QQ4A 2CSZA 2VPDA 4CA1A 2C2VS 3LQIA 2CSYA 5C11A 4CCGX 1Z60A 2L0BA 2KKYA 5J3XA 3C5KA 3HCTA 4WZ0A 1VFYA 2CKLB 3M63A 5LCWB 2ECJA 5TDWA 5FEYA 3T9KA 2YQMA 3LRQA 2OXQC 2K4DA 4Z0RA 5TDRA 2E61A 2LGKA 3PLWA 5SVIB 3L1ZB 1N87A 2CRWA 2LQ6A 1E4UA 2VPEA 2JM3A 3N9PA 1DVPA 2E6SA 2K17A 4R2YA 4WA6A 2CSVA 2I50A 3IHPA 5H1VA 3V43A 4A4CA 2KYUA 1WEUA 1VD4A 2VJFB 1LDKC 2IDAA 3ZVZB 3O70A 3MDBC 4AUQB 3PURA 1JM7B 4H9DA 2Y43A 1BORA 4FJCA 4UP5A 3FAOA 3SOWA 4GNGA 2ECNA 2QIZA 2L80A 1G25A 2YYRA 3LQJA 2L7PA 5EYAF 1FP0A 2KE1A 4N4FA 3GV4A 4X3GA 2HYED 4IC2A 1K2FA 2F6NA 2RSDA 1U6GB 4QF3A 4GNEA 2FUUA 4MSXA 3KV5A 2KWKA 2YQLA 3RPGB 5LKZA 2LDRA 2L43A 4BHWA 4AYCA 1WFKA 4LKAA 3DQVR 5H1UA 3L11A 3DDTA 2FD4A 3H7HA 5FERA 2UZGA 5DINA 2XOYA 3QZVA 2LRIC 2DX8A 3O7AA 1JOCA 1WEOA 2YU4A 4LK9A 4YABA 1Z2QA 3MHHA 3M7KA 2PUYA 2Y1NA 1X4IA 4O64A 1Z6UA 2XB1A 3SHBA 3FEHA 5B77A 3ZPV1 4YBSA 2MNYA 4YBTA 3N9NA 3MHSA 2MD7B 3VK6A 5AITA 2LGGA 5TRBA 2AN6A 5B76A 3N9LA 4GNFA 2DSMA 1VYXA 5KH9A 3I2DA 5B78A 5SVIA 4UP0A 4A49A 2VNFA 1RMDA 2LV9A 5I3LA 3RTRB 2RI7A 2G45A 4N3WA 2M85A 4YC9A 1WGMA 5H1TA 2P57A 4OGEA 4I7DA 4F1PA 3O37A 2VPBA 4FK5A 4P5OB 2CKLA 4XI1A 4ZQLA 5D1MB 4UI9B 2F42A 4YBMA 2YHOA 4YATA 2CT2A 4B86C 2YSMA 1MM3A 1WEWA 4YAXA 2VJEA 2K1JA 4GNDA 1FBVA 3JUEA 5K3QA 5SVYA 2VJEB 5B8DA 3T6RA 4OGCA 4O62A 4PTBA 2CRRA 3DWDA 2MD8C 2EA6A 2LGLA 2G43A 2KGGA 2L75A 4S3OC 2K16A 4BBQA 2LN0A 4PPEA 3U5NA 2FSAA 3DPLR 1IYMA 2XOZA 2ECGA 4R7EA 2KR4A 3O33A 4A0CD 2F6JA 2XP0A 3ZNIA 3KDEC 4I7BA 3PHDA 2YHNA 2ZETC 3ASLA 3N9MA 2VPGA 1JM7A 3N9QA 2MA6A 2M6MA 5TABA 1T1HA 3LVRE 5LKXA 5D1KB 4L58A 2LXPC 3NG2A 2YT5A 2EGPA 3ZPVE 3O36A 2KU3A 3U5OA 1WIMA 3LVQE 2XOCA 1LDJB 1WEPA 3ZYQA 1MM2A 2MT5A 5KH7A 2KREA 3ZVYA 2HDPA 3U5PA 5FB1A 2H0DA 2M13A 2QICA 2LAUA 4ZUXU 2DJAA 1DCQA 2MUMA 2VP7A 4IC3A 3M62A 4TKPB 3KNVA 1HYIA 2JRJA 3L1XA 5AIUA 1WILA 2YUCA 3RPGC 1X4UA 2D8SA 3GL6A 3EB6A 3FANA 4V3KC 2ECTA 2KWOA 2YSJA 2JMJA 5G0FA 1F62A 2FFWA 4WZ2A 2EGMA 2YVRA 3HCUA 3ZTGA 2ECVA 4V3LC 1WEMA 1ZBDB 5B75A 3FL2A 5D1LB 5H9MA 4A4BA 3O47A 3FM8C 2FUIA 4Z0OA 5B79A 3LQHA 3Q1DA 2M3HA 3T7LA 2MKEA 4L7XA 1XWHA 4I7CA 2KIZA 2KWNA 2MIQA 3KQIA 2YW8A 1WEVA 5LKTA 2H0DB 3SOXA 2VJFA 2MA5A 5TBNA 3E2DA 4QF2A 3HCSA 3PUQA 5FB0A 5DKAA 4R8PK 3HTKC 2NAAA 2EXUA 1WESA 2KFTA 2JUNA 2MNZA 4ZDTA 2BAYA 2YURA 4FIPA 2KWJA 4F52B 4AP4A 3N9OA 2G6QA 1CHCA 3KV6A 2Y1MA 4GB0A 4AVXA 3O35A 4LADB 3M99A 1V87A 4C9ZA 5KH3A 2D8UA 2IQJA 1MBMA 2LGVA 4AYCB 4FO9A 1X4JA 2KGIA 2L5UA 4LJNA 3U5MA 1HYJA 2C2LA 4B7YC 5C13A 3C6WA 3FJUB 2E6RA 2B0OE 4YADA 3SUBA 4W4UA 2QJ0A 2JMDA 3SOUA
chains in the Genus database with same CATH topology
4WZ3B 3EB5A 5G05B 2XEUA 4S3OB 2ECIA 2YREA 4MVTA 2EODA 2M1RA 2JMIA 2ECWA 4Q6FA 1WE9A 2LXHC 5G04B 1WEQA 1WEEA 3O34A 4NN2A 2PNXA 5JG6A 4LLBA 5LKUA 1WENA 2CSZA 2VPDA 4CA1A 2C2VS 3LQIA 2CSYA 5C11A 4CCGX 1Z60A 2L0BA 5J3XA 3C5KA 3HCTA 4WZ0A 1VFYA 2CKLB 3M63A 5LCWB 2ECJA 5TDWA 5FEYA 2YQMA 3LRQA 2OXQC 2K4DA 5TDRA 2LGKA 3L1ZB 1N87A 2LQ6A 1E4UA 2VPEA 3N9PA 1DVPA 2E6SA 2K17A 4R2YA 4WA6A 2I50A 3IHPA 5H1VA 3V43A 4A4CA 2KYUA 1WEUA 1VD4A 2VJFB 1LDKC 2IDAA 3ZVZB 3O70A 4AUQB 3PURA 1JM7B 2Y43A 1BORA 4FJCA 4UP5A 3SOWA 4GNGA 2ECNA 2QIZA 2L80A 1G25A 2YYRA 3LQJA 5EYAF 1FP0A 2KE1A 4N4FA 3GV4A 4X3GA 2HYED 4IC2A 1K2FA 2F6NA 2RSDA 1U6GB 4QF3A 4GNEA 2FUUA 4MSXA 3KV5A 2KWKA 2YQLA 3RPGB 5LKZA 2LDRA 2L43A 4BHWA 4AYCA 1WFKA 3DQVR 4LKAA 5H1UA 3L11A 5FERA 2UZGA 5DINA 3QZVA 2LRIC 2DX8A 3O7AA 1JOCA 1WEOA 2YU4A 4LK9A 4YABA 1Z2QA 3MHHA 2PUYA 2Y1NA 1X4IA 4O64A 1Z6UA 2XB1A 3SHBA 5B77A 3ZPV1 4YBSA 2MNYA 4YBTA 3N9NA 3MHSA 2MD7B 3VK6A 5AITA 2LGGA 5TRBA 2AN6A 5B76A 3N9LA 4GNFA 1VYXA 5KH9A 3I2DA 5B78A 4UP0A 4A49A 2VNFA 1RMDA 2LV9A 5I3LA 3RTRB 2RI7A 2G45A 4N3WA 2M85A 4YC9A 1WGMA 5H1TA 4I7DA 3O37A 2VPBA 4FK5A 4P5OB 2CKLA 4XI1A 4ZQLA 5D1MB 4UI9B 2F42A 4YBMA 2YHOA 4YATA 2CT2A 4B86C 2YSMA 1MM3A 1WEWA 4YAXA 2VJEA 2K1JA 4GNDA 1FBVA 2VJEB 5B8DA 3T6RA 4PTBA 2MD8C 2EA6A 2LGLA 2G43A 2KGGA 2L75A 4S3OC 2K16A 4BBQA 2LN0A 4PPEA 3U5NA 2FSAA 3DPLR 1IYMA 2ECGA 4R7EA 2KR4A 3O33A 4A0CD 2F6JA 3ZNIA 4I7BA 3PHDA 2YHNA 2ZETC 3ASLA 3N9MA 2VPGA 1JM7A 3N9QA 2MA6A 2M6MA 5TABA 1T1HA 5LKXA 5D1KB 4L58A 2LXPC 3NG2A 2YT5A 2EGPA 3ZPVE 3O36A 2KU3A 3U5OA 1WIMA 1LDJB 1WEPA 3ZYQA 1MM2A 2MT5A 5KH7A 2KREA 3ZVYA 2HDPA 3U5PA 5FB1A 2H0DA 2QICA 4ZUXU 2MUMA 2VP7A 4IC3A 3M62A 4TKPB 3KNVA 1HYIA 2JRJA 3L1XA 5AIUA 1WILA 2YUCA 3RPGC 1X4UA 2D8SA 3GL6A 3EB6A 4V3KC 2ECTA 2KWOA 2YSJA 2JMJA 5G0FA 1F62A 4WZ2A 3HCUA 3ZTGA 2ECVA 4V3LC 1WEMA 1ZBDB 5B75A 3FL2A 5D1LB 5H9MA 4A4BA 2FUIA 5B79A 3LQHA 2M3HA 3T7LA 4L7XA 1XWHA 4I7CA 2KIZA 2KWNA 2MIQA 3KQIA 2YW8A 1WEVA 5LKTA 2H0DB 3SOXA 2VJFA 2MA5A 5TBNA 4QF2A 3HCSA 3PUQA 5FB0A 5DKAA 4R8PK 3HTKC 2NAAA 1WESA 2KFTA 2MNZA 4ZDTA 2BAYA 2YURA 4FIPA 2KWJA 4F52B 4AP4A 3N9OA 2G6QA 1CHCA 3KV6A 2Y1MA 4GB0A 4AVXA 3O35A 4LADB 3M99A 1V87A 4C9ZA 5KH3A 2LGVA 4AYCB 4FO9A 1X4JA 2KGIA 2L5UA 4LJNA 3U5MA 1HYJA 2C2LA 4B7YC 5C13A 3C6WA 2E6RA 4YADA 4W4UA 2QJ0A 2JMDA 3SOUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WZ3 B;  3EB5 A;  5G05 B;  2XEU A;  4S3O B;  2ECI A;  2YRE A;  4MVT A;  2EOD A;  2M1R A;  2JMI A;  2ECW A;  4Q6F A;  1WE9 A;  2LXH C;  5G04 B;  1WEQ A;  1WEE A;  3O34 A;  4NN2 A;  2PNX A;  5JG6 A;  4LLB A;  5LKU A;  1WEN A;  2CSZ A;  2VPD A;  4CA1 A;  2C2V S;  3LQI A;  2CSY A;  5C11 A;  4CCG X;  1Z60 A;  2L0B A;  5J3X A;  3C5K A;  3HCT A;  4WZ0 A;  1VFY A;  2CKL B;  3M63 A;  5LCW B;  2ECJ A;  5TDW A;  5FEY A;  2YQM A;  3LRQ A;  2OXQ C;  2K4D A;  5TDR A;  2LGK A;  3L1Z B;  1N87 A;  2LQ6 A;  1E4U A;  2VPE A;  3N9P A;  1DVP A;  2E6S A;  2K17 A;  4R2Y A;  4WA6 A;  2I50 A;  3IHP A;  5H1V A;  3V43 A;  4A4C A;  2KYU A;  1WEU A;  1VD4 A;  2VJF B;  1LDK C;  2IDA A;  3ZVZ B;  3O70 A;  4AUQ B;  3PUR A;  1JM7 B;  2Y43 A;  1BOR A;  4FJC A;  4UP5 A;  3SOW A;  4GNG A;  2ECN A;  2QIZ A;  2L80 A;  1G25 A;  2YYR A;  3LQJ A;  5EYA F;  1FP0 A;  2KE1 A;  4N4F A;  3GV4 A;  4X3G A;  2HYE D;  4IC2 A;  1K2F A;  2F6N A;  2RSD A;  1U6G B;  4QF3 A;  4GNE A;  2FUU A;  4MSX A;  3KV5 A;  2KWK A;  2YQL A;  3RPG B;  5LKZ A;  2LDR A;  2L43 A;  4BHW A;  4AYC A;  1WFK A;  3DQV R;  4LKA A;  5H1U A;  3L11 A;  5FER A;  2UZG A;  5DIN A;  3QZV A;  2LRI C;  2DX8 A;  3O7A A;  1JOC A;  1WEO A;  2YU4 A;  4LK9 A;  4YAB A;  1Z2Q A;  3MHH A;  2PUY A;  2Y1N A;  1X4I A;  4O64 A;  1Z6U A;  2XB1 A;  3SHB A;  5B77 A;  3ZPV 1;  4YBS A;  2MNY A;  4YBT A;  3N9N A;  3MHS A;  2MD7 B;  3VK6 A;  5AIT A;  2LGG A;  5TRB A;  2AN6 A;  5B76 A;  3N9L A;  4GNF A;  1VYX A;  5KH9 A;  3I2D A;  5B78 A;  4UP0 A;  4A49 A;  2VNF A;  1RMD A;  2LV9 A;  5I3L A;  3RTR B;  2RI7 A;  2G45 A;  4N3W A;  2M85 A;  4YC9 A;  1WGM A;  5H1T A;  4I7D A;  3O37 A;  2VPB A;  4FK5 A;  4P5O B;  2CKL A;  4XI1 A;  4ZQL A;  5D1M B;  4UI9 B;  2F42 A;  4YBM A;  2YHO A;  4YAT A;  2CT2 A;  4B86 C;  2YSM A;  1MM3 A;  1WEW A;  4YAX A;  2VJE A;  2K1J A;  4GND A;  1FBV A;  2VJE B;  5B8D A;  3T6R A;  4PTB A;  2MD8 C;  2EA6 A;  2LGL A;  2G43 A;  2KGG A;  2L75 A;  4S3O C;  2K16 A;  4BBQ A;  2LN0 A;  4PPE A;  3U5N A;  2FSA A;  3DPL R;  1IYM A;  2ECG A;  4R7E A;  2KR4 A;  3O33 A;  4A0C D;  2F6J A;  3ZNI A;  4I7B A;  3PHD A;  2YHN A;  2ZET C;  3ASL A;  3N9M A;  2VPG A;  1JM7 A;  3N9Q A;  2MA6 A;  2M6M A;  5TAB A;  1T1H A;  5LKX A;  5D1K B;  4L58 A;  2LXP C;  3NG2 A;  2YT5 A;  2EGP A;  3ZPV E;  3O36 A;  2KU3 A;  3U5O A;  1WIM A;  1LDJ B;  1WEP A;  3ZYQ A;  1MM2 A;  2MT5 A;  5KH7 A;  2KRE A;  3ZVY A;  2HDP A;  3U5P A;  5FB1 A;  2H0D A;  2QIC A;  4ZUX U;  2MUM A;  2VP7 A;  4IC3 A;  3M62 A;  4TKP B;  3KNV A;  1HYI A;  2JRJ A;  3L1X A;  5AIU A;  1WIL A;  2YUC A;  3RPG C;  1X4U A;  2D8S A;  3GL6 A;  3EB6 A;  4V3K C;  2ECT A;  2KWO A;  2YSJ A;  2JMJ A;  5G0F A;  1F62 A;  4WZ2 A;  3HCU A;  3ZTG A;  2ECV A;  4V3L C;  1WEM A;  1ZBD B;  5B75 A;  3FL2 A;  5D1L B;  5H9M A;  4A4B A;  2FUI A;  5B79 A;  3LQH A;  2M3H A;  3T7L A;  4L7X A;  1XWH A;  4I7C A;  2KIZ A;  2KWN A;  2MIQ A;  3KQI A;  2YW8 A;  1WEV A;  5LKT A;  2H0D B;  3SOX A;  2VJF A;  2MA5 A;  5TBN A;  4QF2 A;  3HCS A;  3PUQ A;  5FB0 A;  5DKA A;  4R8P K;  3HTK C;  2NAA A;  1WES A;  2KFT A;  2MNZ A;  4ZDT A;  2BAY A;  2YUR A;  4FIP A;  2KWJ A;  4F52 B;  4AP4 A;  3N9O A;  2G6Q A;  1CHC A;  3KV6 A;  2Y1M A;  4GB0 A;  4AVX A;  3O35 A;  4LAD B;  3M99 A;  1V87 A;  4C9Z A;  5KH3 A;  2LGV A;  4AYC B;  4FO9 A;  1X4J A;  2KGI A;  2L5U A;  4LJN A;  3U5M A;  1HYJ A;  2C2L A;  4B7Y C;  5C13 A;  3C6W A;  2E6R A;  4YAD A;  4W4U A;  2QJ0 A;  2JMD A;  3SOU A; 
#chains in the Genus database with same CATH topology
 4WZ3 B;  3EB5 A;  2CON A;  2OWA A;  5SVX A;  5G05 B;  2XEU A;  4S3O B;  2ECI A;  2YRE A;  4MVT A;  2EOD A;  2M1R A;  2JMI A;  3LJU X;  2ECW A;  4Q6F A;  1WE9 A;  2LXH C;  5G04 B;  1WEQ A;  1WEE A;  3O34 A;  2RR4 A;  4NN2 A;  2PNX A;  5JG6 A;  4LLB A;  2KKX A;  5LKU A;  3LDY A;  1WEN A;  4QQ4 A;  2CSZ A;  2VPD A;  4CA1 A;  2C2V S;  3LQI A;  2CSY A;  5C11 A;  4CCG X;  1Z60 A;  2L0B A;  2KKY A;  5J3X A;  3C5K A;  3HCT A;  4WZ0 A;  1VFY A;  2CKL B;  3M63 A;  5LCW B;  2ECJ A;  5TDW A;  5FEY A;  3T9K A;  2YQM A;  3LRQ A;  2OXQ C;  2K4D A;  4Z0R A;  5TDR A;  2E61 A;  2LGK A;  3PLW A;  5SVI B;  3L1Z B;  1N87 A;  2CRW A;  2LQ6 A;  1E4U A;  2VPE A;  2JM3 A;  3N9P A;  1DVP A;  2E6S A;  2K17 A;  4R2Y A;  4WA6 A;  2CSV A;  2I50 A;  3IHP A;  5H1V A;  3V43 A;  4A4C A;  2KYU A;  1WEU A;  1VD4 A;  2VJF B;  1LDK C;  2IDA A;  3ZVZ B;  3O70 A;  3MDB C;  4AUQ B;  3PUR A;  1JM7 B;  4H9D A;  2Y43 A;  1BOR A;  4FJC A;  4UP5 A;  3FAO A;  3SOW A;  4GNG A;  2ECN A;  2QIZ A;  2L80 A;  1G25 A;  2YYR A;  3LQJ A;  2L7P A;  5EYA F;  1FP0 A;  2KE1 A;  4N4F A;  3GV4 A;  4X3G A;  2HYE D;  4IC2 A;  1K2F A;  2F6N A;  2RSD A;  1U6G B;  4QF3 A;  4GNE A;  2FUU A;  4MSX A;  3KV5 A;  2KWK A;  2YQL A;  3RPG B;  5LKZ A;  2LDR A;  2L43 A;  4BHW A;  4AYC A;  1WFK A;  4LKA A;  3DQV R;  5H1U A;  3L11 A;  3DDT A;  2FD4 A;  3H7H A;  5FER A;  2UZG A;  5DIN A;  2XOY A;  3QZV A;  2LRI C;  2DX8 A;  3O7A A;  1JOC A;  1WEO A;  2YU4 A;  4LK9 A;  4YAB A;  1Z2Q A;  3MHH A;  3M7K A;  2PUY A;  2Y1N A;  1X4I A;  4O64 A;  1Z6U A;  2XB1 A;  3SHB A;  3FEH A;  5B77 A;  3ZPV 1;  4YBS A;  2MNY A;  4YBT A;  3N9N A;  3MHS A;  2MD7 B;  3VK6 A;  5AIT A;  2LGG A;  5TRB A;  2AN6 A;  5B76 A;  3N9L A;  4GNF A;  2DSM A;  1VYX A;  5KH9 A;  3I2D A;  5B78 A;  5SVI A;  4UP0 A;  4A49 A;  2VNF A;  1RMD A;  2LV9 A;  5I3L A;  3RTR B;  2RI7 A;  2G45 A;  4N3W A;  2M85 A;  4YC9 A;  1WGM A;  5H1T A;  2P57 A;  4OGE A;  4I7D A;  4F1P A;  3O37 A;  2VPB A;  4FK5 A;  4P5O B;  2CKL A;  4XI1 A;  4ZQL A;  5D1M B;  4UI9 B;  2F42 A;  4YBM A;  2YHO A;  4YAT A;  2CT2 A;  4B86 C;  2YSM A;  1MM3 A;  1WEW A;  4YAX A;  2VJE A;  2K1J A;  4GND A;  1FBV A;  3JUE A;  5K3Q A;  5SVY A;  2VJE B;  5B8D A;  3T6R A;  4OGC A;  4O62 A;  4PTB A;  2CRR A;  3DWD A;  2MD8 C;  2EA6 A;  2LGL A;  2G43 A;  2KGG A;  2L75 A;  4S3O C;  2K16 A;  4BBQ A;  2LN0 A;  4PPE A;  3U5N A;  2FSA A;  3DPL R;  1IYM A;  2XOZ A;  2ECG A;  4R7E A;  2KR4 A;  3O33 A;  4A0C D;  2F6J A;  2XP0 A;  3ZNI A;  3KDE C;  4I7B A;  3PHD A;  2YHN A;  2ZET C;  3ASL A;  3N9M A;  2VPG A;  1JM7 A;  3N9Q A;  2MA6 A;  2M6M A;  5TAB A;  1T1H A;  3LVR E;  5LKX A;  5D1K B;  4L58 A;  2LXP C;  3NG2 A;  2YT5 A;  2EGP A;  3ZPV E;  3O36 A;  2KU3 A;  3U5O A;  1WIM A;  3LVQ E;  2XOC A;  1LDJ B;  1WEP A;  3ZYQ A;  1MM2 A;  2MT5 A;  5KH7 A;  2KRE A;  3ZVY A;  2HDP A;  3U5P A;  5FB1 A;  2H0D A;  2M13 A;  2QIC A;  2LAU A;  4ZUX U;  2DJA A;  1DCQ A;  2MUM A;  2VP7 A;  4IC3 A;  3M62 A;  4TKP B;  3KNV A;  1HYI A;  2JRJ A;  3L1X A;  5AIU A;  1WIL A;  2YUC A;  3RPG C;  1X4U A;  2D8S A;  3GL6 A;  3EB6 A;  3FAN A;  4V3K C;  2ECT A;  2KWO A;  2YSJ A;  2JMJ A;  5G0F A;  1F62 A;  2FFW A;  4WZ2 A;  2EGM A;  2YVR A;  3HCU A;  3ZTG A;  2ECV A;  4V3L C;  1WEM A;  1ZBD B;  5B75 A;  3FL2 A;  5D1L B;  5H9M A;  4A4B A;  3O47 A;  3FM8 C;  2FUI A;  4Z0O A;  5B79 A;  3LQH A;  3Q1D A;  2M3H A;  3T7L A;  2MKE A;  4L7X A;  1XWH A;  4I7C A;  2KIZ A;  2KWN A;  2MIQ A;  3KQI A;  2YW8 A;  1WEV A;  5LKT A;  2H0D B;  3SOX A;  2VJF A;  2MA5 A;  5TBN A;  3E2D A;  4QF2 A;  3HCS A;  3PUQ A;  5FB0 A;  5DKA A;  4R8P K;  3HTK C;  2NAA A;  2EXU A;  1WES A;  2KFT A;  2JUN A;  2MNZ A;  4ZDT A;  2BAY A;  2YUR A;  4FIP A;  2KWJ A;  4F52 B;  4AP4 A;  3N9O A;  2G6Q A;  1CHC A;  3KV6 A;  2Y1M A;  4GB0 A;  4AVX A;  3O35 A;  4LAD B;  3M99 A;  1V87 A;  4C9Z A;  5KH3 A;  2D8U A;  2IQJ A;  1MBM A;  2LGV A;  4AYC B;  4FO9 A;  1X4J A;  2KGI A;  2L5U A;  4LJN A;  3U5M A;  1HYJ A;  2C2L A;  4B7Y C;  5C13 A;  3C6W A;  3FJU B;  2E6R A;  2B0O E;  4YAD A;  3SUB A;  4W4U A;  2QJ0 A;  2JMD A;  3SOU A; 
#chains in the Genus database with same CATH homology
 4WZ3 B;  3EB5 A;  5G05 B;  2XEU A;  4S3O B;  2ECI A;  2YRE A;  4MVT A;  2EOD A;  2M1R A;  2JMI A;  2ECW A;  4Q6F A;  1WE9 A;  2LXH C;  5G04 B;  1WEQ A;  1WEE A;  3O34 A;  4NN2 A;  2PNX A;  5JG6 A;  4LLB A;  5LKU A;  1WEN A;  2CSZ A;  2VPD A;  4CA1 A;  2C2V S;  3LQI A;  2CSY A;  5C11 A;  4CCG X;  1Z60 A;  2L0B A;  5J3X A;  3C5K A;  3HCT A;  4WZ0 A;  1VFY A;  2CKL B;  3M63 A;  5LCW B;  2ECJ A;  5TDW A;  5FEY A;  2YQM A;  3LRQ A;  2OXQ C;  2K4D A;  5TDR A;  2LGK A;  3L1Z B;  1N87 A;  2LQ6 A;  1E4U A;  2VPE A;  3N9P A;  1DVP A;  2E6S A;  2K17 A;  4R2Y A;  4WA6 A;  2I50 A;  3IHP A;  5H1V A;  3V43 A;  4A4C A;  2KYU A;  1WEU A;  1VD4 A;  2VJF B;  1LDK C;  2IDA A;  3ZVZ B;  3O70 A;  4AUQ B;  3PUR A;  1JM7 B;  2Y43 A;  1BOR A;  4FJC A;  4UP5 A;  3SOW A;  4GNG A;  2ECN A;  2QIZ A;  2L80 A;  1G25 A;  2YYR A;  3LQJ A;  5EYA F;  1FP0 A;  2KE1 A;  4N4F A;  3GV4 A;  4X3G A;  2HYE D;  4IC2 A;  1K2F A;  2F6N A;  2RSD A;  1U6G B;  4QF3 A;  4GNE A;  2FUU A;  4MSX A;  3KV5 A;  2KWK A;  2YQL A;  3RPG B;  5LKZ A;  2LDR A;  2L43 A;  4BHW A;  4AYC A;  1WFK A;  3DQV R;  4LKA A;  5H1U A;  3L11 A;  5FER A;  2UZG A;  5DIN A;  3QZV A;  2LRI C;  2DX8 A;  3O7A A;  1JOC A;  1WEO A;  2YU4 A;  4LK9 A;  4YAB A;  1Z2Q A;  3MHH A;  2PUY A;  2Y1N A;  1X4I A;  4O64 A;  1Z6U A;  2XB1 A;  3SHB A;  5B77 A;  3ZPV 1;  4YBS A;  2MNY A;  4YBT A;  3N9N A;  3MHS A;  2MD7 B;  3VK6 A;  5AIT A;  2LGG A;  5TRB A;  2AN6 A;  5B76 A;  3N9L A;  4GNF A;  1VYX A;  5KH9 A;  3I2D A;  5B78 A;  4UP0 A;  4A49 A;  2VNF A;  1RMD A;  2LV9 A;  5I3L A;  3RTR B;  2RI7 A;  2G45 A;  4N3W A;  2M85 A;  4YC9 A;  1WGM A;  5H1T A;  4I7D A;  3O37 A;  2VPB A;  4FK5 A;  4P5O B;  2CKL A;  4XI1 A;  4ZQL A;  5D1M B;  4UI9 B;  2F42 A;  4YBM A;  2YHO A;  4YAT A;  2CT2 A;  4B86 C;  2YSM A;  1MM3 A;  1WEW A;  4YAX A;  2VJE A;  2K1J A;  4GND A;  1FBV A;  2VJE B;  5B8D A;  3T6R A;  4PTB A;  2MD8 C;  2EA6 A;  2LGL A;  2G43 A;  2KGG A;  2L75 A;  4S3O C;  2K16 A;  4BBQ A;  2LN0 A;  4PPE A;  3U5N A;  2FSA A;  3DPL R;  1IYM A;  2ECG A;  4R7E A;  2KR4 A;  3O33 A;  4A0C D;  2F6J A;  3ZNI A;  4I7B A;  3PHD A;  2YHN A;  2ZET C;  3ASL A;  3N9M A;  2VPG A;  1JM7 A;  3N9Q A;  2MA6 A;  2M6M A;  5TAB A;  1T1H A;  5LKX A;  5D1K B;  4L58 A;  2LXP C;  3NG2 A;  2YT5 A;  2EGP A;  3ZPV E;  3O36 A;  2KU3 A;  3U5O A;  1WIM A;  1LDJ B;  1WEP A;  3ZYQ A;  1MM2 A;  2MT5 A;  5KH7 A;  2KRE A;  3ZVY A;  2HDP A;  3U5P A;  5FB1 A;  2H0D A;  2QIC A;  4ZUX U;  2MUM A;  2VP7 A;  4IC3 A;  3M62 A;  4TKP B;  3KNV A;  1HYI A;  2JRJ A;  3L1X A;  5AIU A;  1WIL A;  2YUC A;  3RPG C;  1X4U A;  2D8S A;  3GL6 A;  3EB6 A;  4V3K C;  2ECT A;  2KWO A;  2YSJ A;  2JMJ A;  5G0F A;  1F62 A;  4WZ2 A;  3HCU A;  3ZTG A;  2ECV A;  4V3L C;  1WEM A;  1ZBD B;  5B75 A;  3FL2 A;  5D1L B;  5H9M A;  4A4B A;  2FUI A;  5B79 A;  3LQH A;  2M3H A;  3T7L A;  4L7X A;  1XWH A;  4I7C A;  2KIZ A;  2KWN A;  2MIQ A;  3KQI A;  2YW8 A;  1WEV A;  5LKT A;  2H0D B;  3SOX A;  2VJF A;  2MA5 A;  5TBN A;  4QF2 A;  3HCS A;  3PUQ A;  5FB0 A;  5DKA A;  4R8P K;  3HTK C;  2NAA A;  1WES A;  2KFT A;  2MNZ A;  4ZDT A;  2BAY A;  2YUR A;  4FIP A;  2KWJ A;  4F52 B;  4AP4 A;  3N9O A;  2G6Q A;  1CHC A;  3KV6 A;  2Y1M A;  4GB0 A;  4AVX A;  3O35 A;  4LAD B;  3M99 A;  1V87 A;  4C9Z A;  5KH3 A;  2LGV A;  4AYC B;  4FO9 A;  1X4J A;  2KGI A;  2L5U A;  4LJN A;  3U5M A;  1HYJ A;  2C2L A;  4B7Y C;  5C13 A;  3C6W A;  2E6R A;  4YAD A;  4W4U A;  2QJ0 A;  2JMD A;  3SOU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...