2ECGA

Solution structure of the ring domain of the baculoviral iap repeat-containing protein 4 from homo sapiens
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
75
structure length
75
Chain Sequence
GSSGSSGSLQKEISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDKCPMCYTVITFKQKIFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apoptosis
molecule keywords Baculoviral IAP repeat-containing protein 4
publication title Solution structure of the ring domain of the Baculoviral IAP repeat-containing protein 4 from Homo sapiens
rcsb
source organism Homo sapiens
total genus 6
structure length 75
sequence length 75
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2007-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2ecgA00
3PHDA 1WILA 3HTKC 4PPEA 2VJFA 4L7XA 3M99A 2VPGA 3N9QA 2VJEB 4AUQB 3VK6A 3DQVR 3O7AA 3PURA 2FUUA 5D1MB 5KH7A 2K1JA 2EA6A 1DVPA 3ZTGA 4MSXA 1WEQA 1WFKA 3ZVZB 4IC3A 2YQMA 2QICA 2YT5A 5TRBA 2KE1A 5DKAA 4WZ0A 2KYUA 2MNYA 2FUIA 5KH3A 1WEWA 4O64A 1VYXA 3C6WA 2ECWA 5I3LA 1RMDA 2DX8A 1WEVA 2BAYA 1V87A 3LQIA 3U5OA 4GNGA 5DINA 3O34A 1WEMA 4GNEA 2VPDA 3U5MA 2VPEA 4A49A 1WGMA 2K16A 2MT5A 2YURA 1LDJB 2ECGA 5AITA 1WESA 3O35A 4R7EA 4N3WA 5TDRA 2L80A 4R8PK 3NG2A 2UZGA 4ZUXU 4WZ2A 2Y1NA 1XWHA 5JG6A 5B78A 2YSJA 2VNFA 2KWOA 2YREA 4P5OB 3O37A 2MD8C 2YUCA 1IYMA 2F6JA 4V3KC 4QF3A 3N9MA 5J3XA 4AYCA 2M6MA 4GNDA 2LGLA 5LKUA 2YHNA 3M63A 2CKLB 2H0DA 1WEOA 5B8DA 4FK5A 2E6SA 4C9ZA 2FSAA 4B86C 1E4UA 2KU3A 4BBQA 4A4CA 4I7CA 3PUQA 2KR4A 2AN6A 2YSMA 2HYED 2Y43A 2RI7A 1N87A 2LXHC 2C2LA 4FO9A 2JMDA 5TDWA 3O36A 3O70A 1G25A 4YBSA 3KNVA 5LKZA 3RTRB 4Q6FA 5G05B 2XEUA 1Z60A 4L58A 1JM7B 2MA6A 2C2VS 1HYIA 4IC2A 3RPGC 1U6GB 2G6QA 5FB1A 1BORA 2VJFB 3FL2A 3N9PA 2LDRA 4NN2A 5EYAF 1Z6UA 3C5KA 2VPBA 3N9LA 5KH9A 3HCTA 5G04B 1WE9A 5D1KB 1LDKC 5D1LB 3L1XA 2G43A 3MHHA 2MA5A 4LADB 4YBMA 4CA1A 2YU4A 3ZVYA 3GL6A 4B7YC 2EGPA 2F6NA 4LLBA 4ZQLA 4PTBA 5H9MA 1WEEA 2K4DA 5LKTA 3LRQA 2JMIA 2LV9A 4YAXA 2Y1MA 5B79A 4R2YA 4YADA 2LXPC 2CSZA 2ECIA 2KREA 4ZDTA 3GV4A 4XI1A 5LKXA 3N9OA 2KWJA 3SHBA 3SOWA 4CCGX 4QF2A 3ZNIA 5C13A 3I2DA 2ECVA 2CKLA 2KFTA 1VFYA 3ASLA 2ECTA 2HDPA 4FJCA 4S3OB 2F42A 3U5PA 4F52B 2YYRA 2YQLA 2PUYA 3LQJA 3ZPV1 4YBTA 3L11A 1X4JA 3HCSA 2VJEA 2L5UA 4MVTA 4YATA 2M3HA 2LGKA 2CSYA 1MM3A 3MHSA 2K17A 1K2FA 4UP0A 1X4IA 4UI9B 4WZ3B 2L0BA 1JM7A 4N4FA 2PNXA 5H1VA 2H0DB 2E6RA 2L43A 4FIPA 4AVXA 2NAAA 2ZETC 3LQHA 4LKAA 2MNZA 2CT2A 1ZBDB 2KGGA 4I7DA 3ZPVE 3IHPA 2OXQC 3SOUA 3ZYQA 5H1UA 3KV5A 2XB1A 2YHOA 2RSDA 1FP0A 4V3LC 2M1RA 5B75A 2G45A 2M85A 3EB5A 2D8SA 3KQIA 2IDAA 2ECNA 3SOXA 4I7BA 3O33A 4WA6A 1MM2A 2JRJA 4GNFA 4YC9A 1WIMA 2VP7A 4TKPB 2YW8A 4GB0A 3N9NA 5FB0A 2LQ6A 4BHWA 1CHCA 5G0FA 3L1ZB 4LK9A 1FBVA 4UP5A 4LJNA 5H1TA 2LRIC 3QZVA 3EB6A 4A4BA 5AIUA 1X4UA 2MD7B 1T1HA 2ECJA 2I50A 2L75A 5FERA 3HCUA 5LCWB 4YABA 2KWNA 4A0CD 3T7LA 5C11A 1F62A 3KV6A 3V43A 2LN0A 2QIZA 2KIZA 4X3GA 1WENA 5B76A 2LGVA 5TBNA 2MIQA 4AP4A 2QJ0A 1VD4A 2JMJA 1JOCA 5FEYA 3DPLR 4AYCB 2LGGA 2MUMA 4W4UA 1HYJA 1WEPA 4S3OC 2EODA 5TABA 3T6RA 2KWKA 1WEUA 1Z2QA 3RPGB 2KGIA 3M62A 3U5NA 5B77A
chains in the Genus database with same CATH superfamily
3PHDA 1WILA 3HTKC 4PPEA 2JM3A 2VJFA 4L7XA 3M99A 4QQ4A 2VPGA 3N9QA 2VJEB 4AUQB 3VK6A 3DQVR 3O7AA 3PURA 2FUUA 5D1MB 5KH7A 2K1JA 2EA6A 1DVPA 3ZTGA 4MSXA 4F1PA 1WEQA 1WFKA 3ZVZB 4IC3A 2YQMA 2QICA 2YT5A 3LVRE 5TRBA 2KE1A 5DKAA 4WZ0A 2KYUA 3LJUX 2MNYA 2FUIA 5KH3A 1WEWA 4O64A 1VYXA 3C6WA 2KKYA 2ECWA 5I3LA 1RMDA 2DX8A 1WEVA 2BAYA 1V87A 3LVQE 3LQIA 3U5OA 3FEHA 4GNGA 5DINA 3O34A 1WEMA 3FANA 4GNEA 2VPDA 3U5MA 2VPEA 4A49A 1WGMA 2K16A 3O47A 2MT5A 3SUBA 2YURA 2XOYA 1LDJB 2ECGA 5AITA 4OGEA 1WESA 3O35A 4R7EA 3FAOA 4N3WA 5TDRA 2L80A 4R8PK 3NG2A 2UZGA 4ZUXU 2P57A 2Y1NA 1XWHA 4WZ2A 5JG6A 5B78A 4Z0RA 2YSJA 2VNFA 2KWOA 2YREA 4P5OB 3O37A 2MD8C 2YUCA 1IYMA 2F6JA 4V3KC 5K3QA 4QF3A 3N9MA 5J3XA 4AYCA 2M6MA 4GNDA 2LGLA 5LKUA 2YHNA 2IQJA 3M63A 2CKLB 2H0DA 1WEOA 3T9KA 5B8DA 4FK5A 2CRWA 1MBMA 2CSVA 2E6SA 4C9ZA 2FSAA 2XOZA 4B86C 1E4UA 3H7HA 2KU3A 4BBQA 4A4CA 4I7CA 3PUQA 2KR4A 2AN6A 2YSMA 2CRRA 2HYED 2Y43A 2RI7A 2RR4A 1N87A 2LXHC 2C2LA 4FO9A 3Q1DA 2MKEA 2JMDA 5TDWA 3O36A 3O70A 1G25A 4YBSA 3KNVA 5LKZA 3FM8C 3RTRB 4Q6FA 5G05B 2XEUA 1Z60A 4L58A 1JM7B 2MA6A 2C2VS 5SVIB 1HYIA 4IC2A 3RPGC 1U6GB 2G6QA 5FB1A 1BORA 2VJFB 3FL2A 3N9PA 2LDRA 4NN2A 5EYAF 3MDBC 1Z6UA 3C5KA 2VPBA 3N9LA 5KH9A 3HCTA 5G04B 2DSMA 2D8UA 1WE9A 5D1KB 1LDKC 5D1LB 3L1XA 2G43A 3MHHA 2MA5A 4LADB 4YBMA 4CA1A 2YU4A 3ZVYA 3GL6A 4B7YC 2EGPA 2F6NA 4LLBA 4ZQLA 4PTBA 5H9MA 1WEEA 2K4DA 5LKTA 3LRQA 2JMIA 2LV9A 4YAXA 2Y1MA 5B79A 4R2YA 4YADA 2LXPC 2CSZA 3M7KA 2ECIA 2KREA 4ZDTA 3GV4A 4XI1A 5LKXA 3N9OA 2KWJA 3SHBA 3SOWA 4CCGX 4QF2A 3ZNIA 5C13A 2XOCA 2ECVA 3I2DA 2CKLA 2EXUA 2KFTA 1VFYA 5SVYA 3ASLA 2ECTA 2HDPA 4FJCA 4S3OB 2F42A 2FFWA 3U5PA 4F52B 2YYRA 2YQLA 2JUNA 2PUYA 4O62A 3LQJA 3ZPV1 4Z0OA 4YBTA 3L11A 3LDYA 1X4JA 3HCSA 2VJEA 2L5UA 4MVTA 4YATA 2M3HA 2LGKA 5SVXA 2CSYA 1MM3A 3MHSA 2K17A 1K2FA 4UP0A 1X4IA 4UI9B 4WZ3B 2L0BA 1JM7A 2E61A 4N4FA 2PNXA 2H0DB 2E6RA 5H1VA 5SVIA 2L43A 4FIPA 4AVXA 2NAAA 2ZETC 3LQHA 4LKAA 3DDTA 2MNZA 2CT2A 1ZBDB 2KGGA 4I7DA 3ZPVE 3IHPA 2OXQC 3SOUA 3ZYQA 5H1UA 3KV5A 2XB1A 2YHOA 2RSDA 1FP0A 3KDEC 4V3LC 2M1RA 5B75A 2G45A 2FD4A 2M85A 3EB5A 2D8SA 3KQIA 2IDAA 2ECNA 3JUEA 3SOXA 4I7BA 2CONA 2EGMA 3O33A 4WA6A 1MM2A 2JRJA 4GNFA 4YC9A 1WIMA 3DWDA 2KKXA 2VP7A 4TKPB 2YW8A 4GB0A 3N9NA 5FB0A 2LQ6A 4BHWA 3E2DA 1CHCA 5G0FA 2YVRA 3L1ZB 4LK9A 1FBVA 4UP5A 4LJNA 2XP0A 5H1TA 2LRIC 3QZVA 3EB6A 4A4BA 5AIUA 1X4UA 2MD7B 1T1HA 2ECJA 2I50A 2L75A 5FERA 3HCUA 5LCWB 4YABA 2KWNA 4A0CD 2B0OE 3T7LA 5C11A 3FJUB 1F62A 2LAUA 3KV6A 3V43A 2DJAA 4OGCA 2LN0A 2QIZA 2KIZA 4X3GA 2L7PA 1DCQA 1WENA 5B76A 2LGVA 5TBNA 2MIQA 4AP4A 2QJ0A 1VD4A 2JMJA 1JOCA 4H9DA 5FEYA 3DPLR 4AYCB 2LGGA 2MUMA 4W4UA 3PLWA 1HYJA 1WEPA 4S3OC 2EODA 5TABA 3T6RA 2KWKA 1WEUA 2OWAA 1Z2QA 2M13A 3RPGB 2KGIA 3M62A 3U5NA 5B77A
chains in the Genus database with same CATH topology
3PHDA 1WILA 3HTKC 4PPEA 2VJFA 4L7XA 3M99A 2VPGA 3N9QA 2VJEB 4AUQB 3VK6A 3DQVR 3O7AA 3PURA 2FUUA 5D1MB 5KH7A 2K1JA 2EA6A 1DVPA 3ZTGA 4MSXA 1WEQA 1WFKA 3ZVZB 4IC3A 2YQMA 2QICA 2YT5A 5TRBA 2KE1A 5DKAA 4WZ0A 2KYUA 2MNYA 2FUIA 5KH3A 1WEWA 4O64A 1VYXA 3C6WA 2ECWA 5I3LA 1RMDA 2DX8A 1WEVA 2BAYA 1V87A 3LQIA 3U5OA 4GNGA 5DINA 3O34A 1WEMA 4GNEA 2VPDA 3U5MA 2VPEA 4A49A 1WGMA 2K16A 2MT5A 2YURA 1LDJB 2ECGA 5AITA 1WESA 3O35A 4R7EA 4N3WA 5TDRA 2L80A 4R8PK 3NG2A 2UZGA 4ZUXU 4WZ2A 2Y1NA 1XWHA 5JG6A 5B78A 2YSJA 2VNFA 2KWOA 2YREA 4P5OB 3O37A 2MD8C 2YUCA 1IYMA 2F6JA 4V3KC 4QF3A 3N9MA 5J3XA 4AYCA 2M6MA 4GNDA 2LGLA 5LKUA 2YHNA 3M63A 2CKLB 2H0DA 1WEOA 5B8DA 4FK5A 2E6SA 4C9ZA 2FSAA 4B86C 1E4UA 2KU3A 4BBQA 4A4CA 4I7CA 3PUQA 2KR4A 2AN6A 2YSMA 2HYED 2Y43A 2RI7A 1N87A 2LXHC 2C2LA 4FO9A 2JMDA 5TDWA 3O36A 3O70A 1G25A 4YBSA 3KNVA 5LKZA 3RTRB 4Q6FA 5G05B 2XEUA 1Z60A 4L58A 1JM7B 2MA6A 2C2VS 1HYIA 4IC2A 3RPGC 1U6GB 2G6QA 5FB1A 1BORA 2VJFB 3FL2A 3N9PA 2LDRA 4NN2A 5EYAF 1Z6UA 3C5KA 2VPBA 3N9LA 5KH9A 3HCTA 5G04B 1WE9A 5D1KB 1LDKC 5D1LB 3L1XA 2G43A 3MHHA 2MA5A 4LADB 4YBMA 4CA1A 2YU4A 3ZVYA 3GL6A 4B7YC 2EGPA 2F6NA 4LLBA 4ZQLA 4PTBA 5H9MA 1WEEA 2K4DA 5LKTA 3LRQA 2JMIA 2LV9A 4YAXA 2Y1MA 5B79A 4R2YA 4YADA 2LXPC 2CSZA 2ECIA 2KREA 4ZDTA 3GV4A 4XI1A 5LKXA 3N9OA 2KWJA 3SHBA 3SOWA 4CCGX 4QF2A 3ZNIA 5C13A 3I2DA 2ECVA 2CKLA 2KFTA 1VFYA 3ASLA 2ECTA 2HDPA 4FJCA 4S3OB 2F42A 3U5PA 4F52B 2YYRA 2YQLA 2PUYA 3LQJA 3ZPV1 4YBTA 3L11A 1X4JA 3HCSA 2VJEA 2L5UA 4MVTA 4YATA 2M3HA 2LGKA 2CSYA 1MM3A 3MHSA 2K17A 1K2FA 4UP0A 1X4IA 4UI9B 4WZ3B 2L0BA 1JM7A 4N4FA 2PNXA 5H1VA 2H0DB 2E6RA 2L43A 4FIPA 4AVXA 2NAAA 2ZETC 3LQHA 4LKAA 2MNZA 2CT2A 1ZBDB 2KGGA 4I7DA 3ZPVE 3IHPA 2OXQC 3SOUA 3ZYQA 5H1UA 3KV5A 2XB1A 2YHOA 2RSDA 1FP0A 4V3LC 2M1RA 5B75A 2G45A 2M85A 3EB5A 2D8SA 3KQIA 2IDAA 2ECNA 3SOXA 4I7BA 3O33A 4WA6A 1MM2A 2JRJA 4GNFA 4YC9A 1WIMA 2VP7A 4TKPB 2YW8A 4GB0A 3N9NA 5FB0A 2LQ6A 4BHWA 1CHCA 5G0FA 3L1ZB 4LK9A 1FBVA 4UP5A 4LJNA 5H1TA 2LRIC 3QZVA 3EB6A 4A4BA 5AIUA 1X4UA 2MD7B 1T1HA 2ECJA 2I50A 2L75A 5FERA 3HCUA 5LCWB 4YABA 2KWNA 4A0CD 3T7LA 5C11A 1F62A 3KV6A 3V43A 2LN0A 2QIZA 2KIZA 4X3GA 1WENA 5B76A 2LGVA 5TBNA 2MIQA 4AP4A 2QJ0A 1VD4A 2JMJA 1JOCA 5FEYA 3DPLR 4AYCB 2LGGA 2MUMA 4W4UA 1HYJA 1WEPA 4S3OC 2EODA 5TABA 3T6RA 2KWKA 1WEUA 1Z2QA 3RPGB 2KGIA 3M62A 3U5NA 5B77A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PHD A;  1WIL A;  3HTK C;  4PPE A;  2VJF A;  4L7X A;  3M99 A;  2VPG A;  3N9Q A;  2VJE B;  4AUQ B;  3VK6 A;  3DQV R;  3O7A A;  3PUR A;  2FUU A;  5D1M B;  5KH7 A;  2K1J A;  2EA6 A;  1DVP A;  3ZTG A;  4MSX A;  1WEQ A;  1WFK A;  3ZVZ B;  4IC3 A;  2YQM A;  2QIC A;  2YT5 A;  5TRB A;  2KE1 A;  5DKA A;  4WZ0 A;  2KYU A;  2MNY A;  2FUI A;  5KH3 A;  1WEW A;  4O64 A;  1VYX A;  3C6W A;  2ECW A;  5I3L A;  1RMD A;  2DX8 A;  1WEV A;  2BAY A;  1V87 A;  3LQI A;  3U5O A;  4GNG A;  5DIN A;  3O34 A;  1WEM A;  4GNE A;  2VPD A;  3U5M A;  2VPE A;  4A49 A;  1WGM A;  2K16 A;  2MT5 A;  2YUR A;  1LDJ B;  2ECG A;  5AIT A;  1WES A;  3O35 A;  4R7E A;  4N3W A;  5TDR A;  2L80 A;  4R8P K;  3NG2 A;  2UZG A;  4ZUX U;  4WZ2 A;  2Y1N A;  1XWH A;  5JG6 A;  5B78 A;  2YSJ A;  2VNF A;  2KWO A;  2YRE A;  4P5O B;  3O37 A;  2MD8 C;  2YUC A;  1IYM A;  2F6J A;  4V3K C;  4QF3 A;  3N9M A;  5J3X A;  4AYC A;  2M6M A;  4GND A;  2LGL A;  5LKU A;  2YHN A;  3M63 A;  2CKL B;  2H0D A;  1WEO A;  5B8D A;  4FK5 A;  2E6S A;  4C9Z A;  2FSA A;  4B86 C;  1E4U A;  2KU3 A;  4BBQ A;  4A4C A;  4I7C A;  3PUQ A;  2KR4 A;  2AN6 A;  2YSM A;  2HYE D;  2Y43 A;  2RI7 A;  1N87 A;  2LXH C;  2C2L A;  4FO9 A;  2JMD A;  5TDW A;  3O36 A;  3O70 A;  1G25 A;  4YBS A;  3KNV A;  5LKZ A;  3RTR B;  4Q6F A;  5G05 B;  2XEU A;  1Z60 A;  4L58 A;  1JM7 B;  2MA6 A;  2C2V S;  1HYI A;  4IC2 A;  3RPG C;  1U6G B;  2G6Q A;  5FB1 A;  1BOR A;  2VJF B;  3FL2 A;  3N9P A;  2LDR A;  4NN2 A;  5EYA F;  1Z6U A;  3C5K A;  2VPB A;  3N9L A;  5KH9 A;  3HCT A;  5G04 B;  1WE9 A;  5D1K B;  1LDK C;  5D1L B;  3L1X A;  2G43 A;  3MHH A;  2MA5 A;  4LAD B;  4YBM A;  4CA1 A;  2YU4 A;  3ZVY A;  3GL6 A;  4B7Y C;  2EGP A;  2F6N A;  4LLB A;  4ZQL A;  4PTB A;  5H9M A;  1WEE A;  2K4D A;  5LKT A;  3LRQ A;  2JMI A;  2LV9 A;  4YAX A;  2Y1M A;  5B79 A;  4R2Y A;  4YAD A;  2LXP C;  2CSZ A;  2ECI A;  2KRE A;  4ZDT A;  3GV4 A;  4XI1 A;  5LKX A;  3N9O A;  2KWJ A;  3SHB A;  3SOW A;  4CCG X;  4QF2 A;  3ZNI A;  5C13 A;  3I2D A;  2ECV A;  2CKL A;  2KFT A;  1VFY A;  3ASL A;  2ECT A;  2HDP A;  4FJC A;  4S3O B;  2F42 A;  3U5P A;  4F52 B;  2YYR A;  2YQL A;  2PUY A;  3LQJ A;  3ZPV 1;  4YBT A;  3L11 A;  1X4J A;  3HCS A;  2VJE A;  2L5U A;  4MVT A;  4YAT A;  2M3H A;  2LGK A;  2CSY A;  1MM3 A;  3MHS A;  2K17 A;  1K2F A;  4UP0 A;  1X4I A;  4UI9 B;  4WZ3 B;  2L0B A;  1JM7 A;  4N4F A;  2PNX A;  5H1V A;  2H0D B;  2E6R A;  2L43 A;  4FIP A;  4AVX A;  2NAA A;  2ZET C;  3LQH A;  4LKA A;  2MNZ A;  2CT2 A;  1ZBD B;  2KGG A;  4I7D A;  3ZPV E;  3IHP A;  2OXQ C;  3SOU A;  3ZYQ A;  5H1U A;  3KV5 A;  2XB1 A;  2YHO A;  2RSD A;  1FP0 A;  4V3L C;  2M1R A;  5B75 A;  2G45 A;  2M85 A;  3EB5 A;  2D8S A;  3KQI A;  2IDA A;  2ECN A;  3SOX A;  4I7B A;  3O33 A;  4WA6 A;  1MM2 A;  2JRJ A;  4GNF A;  4YC9 A;  1WIM A;  2VP7 A;  4TKP B;  2YW8 A;  4GB0 A;  3N9N A;  5FB0 A;  2LQ6 A;  4BHW A;  1CHC A;  5G0F A;  3L1Z B;  4LK9 A;  1FBV A;  4UP5 A;  4LJN A;  5H1T A;  2LRI C;  3QZV A;  3EB6 A;  4A4B A;  5AIU A;  1X4U A;  2MD7 B;  1T1H A;  2ECJ A;  2I50 A;  2L75 A;  5FER A;  3HCU A;  5LCW B;  4YAB A;  2KWN A;  4A0C D;  3T7L A;  5C11 A;  1F62 A;  3KV6 A;  3V43 A;  2LN0 A;  2QIZ A;  2KIZ A;  4X3G A;  1WEN A;  5B76 A;  2LGV A;  5TBN A;  2MIQ A;  4AP4 A;  2QJ0 A;  1VD4 A;  2JMJ A;  1JOC A;  5FEY A;  3DPL R;  4AYC B;  2LGG A;  2MUM A;  4W4U A;  1HYJ A;  1WEP A;  4S3O C;  2EOD A;  5TAB A;  3T6R A;  2KWK A;  1WEU A;  1Z2Q A;  3RPG B;  2KGI A;  3M62 A;  3U5N A;  5B77 A; 
#chains in the Genus database with same CATH topology
 3PHD A;  1WIL A;  3HTK C;  4PPE A;  2JM3 A;  2VJF A;  4L7X A;  3M99 A;  4QQ4 A;  2VPG A;  3N9Q A;  2VJE B;  4AUQ B;  3VK6 A;  3DQV R;  3O7A A;  3PUR A;  2FUU A;  5D1M B;  5KH7 A;  2K1J A;  2EA6 A;  1DVP A;  3ZTG A;  4MSX A;  4F1P A;  1WEQ A;  1WFK A;  3ZVZ B;  4IC3 A;  2YQM A;  2QIC A;  2YT5 A;  3LVR E;  5TRB A;  2KE1 A;  5DKA A;  4WZ0 A;  2KYU A;  3LJU X;  2MNY A;  2FUI A;  5KH3 A;  1WEW A;  4O64 A;  1VYX A;  3C6W A;  2KKY A;  2ECW A;  5I3L A;  1RMD A;  2DX8 A;  1WEV A;  2BAY A;  1V87 A;  3LVQ E;  3LQI A;  3U5O A;  3FEH A;  4GNG A;  5DIN A;  3O34 A;  1WEM A;  3FAN A;  4GNE A;  2VPD A;  3U5M A;  2VPE A;  4A49 A;  1WGM A;  2K16 A;  3O47 A;  2MT5 A;  3SUB A;  2YUR A;  2XOY A;  1LDJ B;  2ECG A;  5AIT A;  4OGE A;  1WES A;  3O35 A;  4R7E A;  3FAO A;  4N3W A;  5TDR A;  2L80 A;  4R8P K;  3NG2 A;  2UZG A;  4ZUX U;  2P57 A;  2Y1N A;  1XWH A;  4WZ2 A;  5JG6 A;  5B78 A;  4Z0R A;  2YSJ A;  2VNF A;  2KWO A;  2YRE A;  4P5O B;  3O37 A;  2MD8 C;  2YUC A;  1IYM A;  2F6J A;  4V3K C;  5K3Q A;  4QF3 A;  3N9M A;  5J3X A;  4AYC A;  2M6M A;  4GND A;  2LGL A;  5LKU A;  2YHN A;  2IQJ A;  3M63 A;  2CKL B;  2H0D A;  1WEO A;  3T9K A;  5B8D A;  4FK5 A;  2CRW A;  1MBM A;  2CSV A;  2E6S A;  4C9Z A;  2FSA A;  2XOZ A;  4B86 C;  1E4U A;  3H7H A;  2KU3 A;  4BBQ A;  4A4C A;  4I7C A;  3PUQ A;  2KR4 A;  2AN6 A;  2YSM A;  2CRR A;  2HYE D;  2Y43 A;  2RI7 A;  2RR4 A;  1N87 A;  2LXH C;  2C2L A;  4FO9 A;  3Q1D A;  2MKE A;  2JMD A;  5TDW A;  3O36 A;  3O70 A;  1G25 A;  4YBS A;  3KNV A;  5LKZ A;  3FM8 C;  3RTR B;  4Q6F A;  5G05 B;  2XEU A;  1Z60 A;  4L58 A;  1JM7 B;  2MA6 A;  2C2V S;  5SVI B;  1HYI A;  4IC2 A;  3RPG C;  1U6G B;  2G6Q A;  5FB1 A;  1BOR A;  2VJF B;  3FL2 A;  3N9P A;  2LDR A;  4NN2 A;  5EYA F;  3MDB C;  1Z6U A;  3C5K A;  2VPB A;  3N9L A;  5KH9 A;  3HCT A;  5G04 B;  2DSM A;  2D8U A;  1WE9 A;  5D1K B;  1LDK C;  5D1L B;  3L1X A;  2G43 A;  3MHH A;  2MA5 A;  4LAD B;  4YBM A;  4CA1 A;  2YU4 A;  3ZVY A;  3GL6 A;  4B7Y C;  2EGP A;  2F6N A;  4LLB A;  4ZQL A;  4PTB A;  5H9M A;  1WEE A;  2K4D A;  5LKT A;  3LRQ A;  2JMI A;  2LV9 A;  4YAX A;  2Y1M A;  5B79 A;  4R2Y A;  4YAD A;  2LXP C;  2CSZ A;  3M7K A;  2ECI A;  2KRE A;  4ZDT A;  3GV4 A;  4XI1 A;  5LKX A;  3N9O A;  2KWJ A;  3SHB A;  3SOW A;  4CCG X;  4QF2 A;  3ZNI A;  5C13 A;  2XOC A;  2ECV A;  3I2D A;  2CKL A;  2EXU A;  2KFT A;  1VFY A;  5SVY A;  3ASL A;  2ECT A;  2HDP A;  4FJC A;  4S3O B;  2F42 A;  2FFW A;  3U5P A;  4F52 B;  2YYR A;  2YQL A;  2JUN A;  2PUY A;  4O62 A;  3LQJ A;  3ZPV 1;  4Z0O A;  4YBT A;  3L11 A;  3LDY A;  1X4J A;  3HCS A;  2VJE A;  2L5U A;  4MVT A;  4YAT A;  2M3H A;  2LGK A;  5SVX A;  2CSY A;  1MM3 A;  3MHS A;  2K17 A;  1K2F A;  4UP0 A;  1X4I A;  4UI9 B;  4WZ3 B;  2L0B A;  1JM7 A;  2E61 A;  4N4F A;  2PNX A;  2H0D B;  2E6R A;  5H1V A;  5SVI A;  2L43 A;  4FIP A;  4AVX A;  2NAA A;  2ZET C;  3LQH A;  4LKA A;  3DDT A;  2MNZ A;  2CT2 A;  1ZBD B;  2KGG A;  4I7D A;  3ZPV E;  3IHP A;  2OXQ C;  3SOU A;  3ZYQ A;  5H1U A;  3KV5 A;  2XB1 A;  2YHO A;  2RSD A;  1FP0 A;  3KDE C;  4V3L C;  2M1R A;  5B75 A;  2G45 A;  2FD4 A;  2M85 A;  3EB5 A;  2D8S A;  3KQI A;  2IDA A;  2ECN A;  3JUE A;  3SOX A;  4I7B A;  2CON A;  2EGM A;  3O33 A;  4WA6 A;  1MM2 A;  2JRJ A;  4GNF A;  4YC9 A;  1WIM A;  3DWD A;  2KKX A;  2VP7 A;  4TKP B;  2YW8 A;  4GB0 A;  3N9N A;  5FB0 A;  2LQ6 A;  4BHW A;  3E2D A;  1CHC A;  5G0F A;  2YVR A;  3L1Z B;  4LK9 A;  1FBV A;  4UP5 A;  4LJN A;  2XP0 A;  5H1T A;  2LRI C;  3QZV A;  3EB6 A;  4A4B A;  5AIU A;  1X4U A;  2MD7 B;  1T1H A;  2ECJ A;  2I50 A;  2L75 A;  5FER A;  3HCU A;  5LCW B;  4YAB A;  2KWN A;  4A0C D;  2B0O E;  3T7L A;  5C11 A;  3FJU B;  1F62 A;  2LAU A;  3KV6 A;  3V43 A;  2DJA A;  4OGC A;  2LN0 A;  2QIZ A;  2KIZ A;  4X3G A;  2L7P A;  1DCQ A;  1WEN A;  5B76 A;  2LGV A;  5TBN A;  2MIQ A;  4AP4 A;  2QJ0 A;  1VD4 A;  2JMJ A;  1JOC A;  4H9D A;  5FEY A;  3DPL R;  4AYC B;  2LGG A;  2MUM A;  4W4U A;  3PLW A;  1HYJ A;  1WEP A;  4S3O C;  2EOD A;  5TAB A;  3T6R A;  2KWK A;  1WEU A;  2OWA A;  1Z2Q A;  2M13 A;  3RPG B;  2KGI A;  3M62 A;  3U5N A;  5B77 A; 
#chains in the Genus database with same CATH homology
 3PHD A;  1WIL A;  3HTK C;  4PPE A;  2VJF A;  4L7X A;  3M99 A;  2VPG A;  3N9Q A;  2VJE B;  4AUQ B;  3VK6 A;  3DQV R;  3O7A A;  3PUR A;  2FUU A;  5D1M B;  5KH7 A;  2K1J A;  2EA6 A;  1DVP A;  3ZTG A;  4MSX A;  1WEQ A;  1WFK A;  3ZVZ B;  4IC3 A;  2YQM A;  2QIC A;  2YT5 A;  5TRB A;  2KE1 A;  5DKA A;  4WZ0 A;  2KYU A;  2MNY A;  2FUI A;  5KH3 A;  1WEW A;  4O64 A;  1VYX A;  3C6W A;  2ECW A;  5I3L A;  1RMD A;  2DX8 A;  1WEV A;  2BAY A;  1V87 A;  3LQI A;  3U5O A;  4GNG A;  5DIN A;  3O34 A;  1WEM A;  4GNE A;  2VPD A;  3U5M A;  2VPE A;  4A49 A;  1WGM A;  2K16 A;  2MT5 A;  2YUR A;  1LDJ B;  2ECG A;  5AIT A;  1WES A;  3O35 A;  4R7E A;  4N3W A;  5TDR A;  2L80 A;  4R8P K;  3NG2 A;  2UZG A;  4ZUX U;  4WZ2 A;  2Y1N A;  1XWH A;  5JG6 A;  5B78 A;  2YSJ A;  2VNF A;  2KWO A;  2YRE A;  4P5O B;  3O37 A;  2MD8 C;  2YUC A;  1IYM A;  2F6J A;  4V3K C;  4QF3 A;  3N9M A;  5J3X A;  4AYC A;  2M6M A;  4GND A;  2LGL A;  5LKU A;  2YHN A;  3M63 A;  2CKL B;  2H0D A;  1WEO A;  5B8D A;  4FK5 A;  2E6S A;  4C9Z A;  2FSA A;  4B86 C;  1E4U A;  2KU3 A;  4BBQ A;  4A4C A;  4I7C A;  3PUQ A;  2KR4 A;  2AN6 A;  2YSM A;  2HYE D;  2Y43 A;  2RI7 A;  1N87 A;  2LXH C;  2C2L A;  4FO9 A;  2JMD A;  5TDW A;  3O36 A;  3O70 A;  1G25 A;  4YBS A;  3KNV A;  5LKZ A;  3RTR B;  4Q6F A;  5G05 B;  2XEU A;  1Z60 A;  4L58 A;  1JM7 B;  2MA6 A;  2C2V S;  1HYI A;  4IC2 A;  3RPG C;  1U6G B;  2G6Q A;  5FB1 A;  1BOR A;  2VJF B;  3FL2 A;  3N9P A;  2LDR A;  4NN2 A;  5EYA F;  1Z6U A;  3C5K A;  2VPB A;  3N9L A;  5KH9 A;  3HCT A;  5G04 B;  1WE9 A;  5D1K B;  1LDK C;  5D1L B;  3L1X A;  2G43 A;  3MHH A;  2MA5 A;  4LAD B;  4YBM A;  4CA1 A;  2YU4 A;  3ZVY A;  3GL6 A;  4B7Y C;  2EGP A;  2F6N A;  4LLB A;  4ZQL A;  4PTB A;  5H9M A;  1WEE A;  2K4D A;  5LKT A;  3LRQ A;  2JMI A;  2LV9 A;  4YAX A;  2Y1M A;  5B79 A;  4R2Y A;  4YAD A;  2LXP C;  2CSZ A;  2ECI A;  2KRE A;  4ZDT A;  3GV4 A;  4XI1 A;  5LKX A;  3N9O A;  2KWJ A;  3SHB A;  3SOW A;  4CCG X;  4QF2 A;  3ZNI A;  5C13 A;  3I2D A;  2ECV A;  2CKL A;  2KFT A;  1VFY A;  3ASL A;  2ECT A;  2HDP A;  4FJC A;  4S3O B;  2F42 A;  3U5P A;  4F52 B;  2YYR A;  2YQL A;  2PUY A;  3LQJ A;  3ZPV 1;  4YBT A;  3L11 A;  1X4J A;  3HCS A;  2VJE A;  2L5U A;  4MVT A;  4YAT A;  2M3H A;  2LGK A;  2CSY A;  1MM3 A;  3MHS A;  2K17 A;  1K2F A;  4UP0 A;  1X4I A;  4UI9 B;  4WZ3 B;  2L0B A;  1JM7 A;  4N4F A;  2PNX A;  5H1V A;  2H0D B;  2E6R A;  2L43 A;  4FIP A;  4AVX A;  2NAA A;  2ZET C;  3LQH A;  4LKA A;  2MNZ A;  2CT2 A;  1ZBD B;  2KGG A;  4I7D A;  3ZPV E;  3IHP A;  2OXQ C;  3SOU A;  3ZYQ A;  5H1U A;  3KV5 A;  2XB1 A;  2YHO A;  2RSD A;  1FP0 A;  4V3L C;  2M1R A;  5B75 A;  2G45 A;  2M85 A;  3EB5 A;  2D8S A;  3KQI A;  2IDA A;  2ECN A;  3SOX A;  4I7B A;  3O33 A;  4WA6 A;  1MM2 A;  2JRJ A;  4GNF A;  4YC9 A;  1WIM A;  2VP7 A;  4TKP B;  2YW8 A;  4GB0 A;  3N9N A;  5FB0 A;  2LQ6 A;  4BHW A;  1CHC A;  5G0F A;  3L1Z B;  4LK9 A;  1FBV A;  4UP5 A;  4LJN A;  5H1T A;  2LRI C;  3QZV A;  3EB6 A;  4A4B A;  5AIU A;  1X4U A;  2MD7 B;  1T1H A;  2ECJ A;  2I50 A;  2L75 A;  5FER A;  3HCU A;  5LCW B;  4YAB A;  2KWN A;  4A0C D;  3T7L A;  5C11 A;  1F62 A;  3KV6 A;  3V43 A;  2LN0 A;  2QIZ A;  2KIZ A;  4X3G A;  1WEN A;  5B76 A;  2LGV A;  5TBN A;  2MIQ A;  4AP4 A;  2QJ0 A;  1VD4 A;  2JMJ A;  1JOC A;  5FEY A;  3DPL R;  4AYC B;  2LGG A;  2MUM A;  4W4U A;  1HYJ A;  1WEP A;  4S3O C;  2EOD A;  5TAB A;  3T6R A;  2KWK A;  1WEU A;  1Z2Q A;  3RPG B;  2KGI A;  3M62 A;  3U5N A;  5B77 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...