2ECGA

Solution structure of the ring domain of the baculoviral iap repeat-containing protein 4 from homo sapiens
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
75
structure length
75
Chain Sequence
b'GSSGSSGSLQKEISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDKCPMCYTVITFKQKIFMS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Baculoviral IAP repeat-containing protein 4
publication title Solution structure of the ring domain of the Baculoviral IAP repeat-containing protein 4 from Homo sapiens
rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 6
structure length 75
sequence length 75
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2007-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2ecgA00
5H1TA 2LGKA 3U5PA 3HTKC 1WILA 2YYRA 3M62A 2PNXA 2YURA 1WEWA 2L75A 4NN2A 4O64A 1WEEA 4LJNA 5DINA 3ZVYA 4IC3A 3GL6A 2DX8A 3SOWA 2LGVA 5EYAF 3ASLA 3RTRB 5DKAA 4A49A 2H0DA 4C9ZA 1FP0A 3PUQA 5TDWA 2YREA 2FUUA 4I7DA 2KWNA 4R7EA 4UP0A 2VPDA 2VJFB 2I50A 3IHPA 4XI1A 2LV9A 5FB0A 5B78A 5C13A 3SOXA 4L7XA 2QJ0A 3ZTGA 4A4CA 4WZ3B 4GNEA 1WEOA 4QF3A 2D8SA 4S3OB 3EB6A 2ECIA 3KV6A 4YABA 1VYXA 2C2VS 2ECJA 5H1UA 1WEUA 1CHCA 3HCUA 4LADB 2K17A 3C6WA 2NAAA 3HCSA 3N9PA 4ZQLA 1DVPA 4X3GA 2LRIC 3N9QA 3L11A 4FJCA 3N9OA 5TBNA 5LKUA 2MNYA 1G25A 2G43A 4YATA 2YSMA 2XB1A 3GV4A 2L43A 3HCTA 4FIPA 4S3OC 4UP5A 3M63A 4A4BA 3N9NA 1LDJB 2K4DA 2AN6A 4YBSA 2VPEA 1T1HA 5TABA 3FL2A 3O70A 4MVTA 3LRQA 2VPGA 5G04B 2KWOA 4P5OB 3T6RA 4R8PK 5I3LA 2VJEB 4ZDTA 5J3XA 4GNGA 1X4JA 2KR4A 2KGIA 3O35A 2MD7B 2MIQA 3ZYQA 5FB1A 4B7YC 4AVXA 1Z6UA 5H9MA 3T7LA 3ZPV1 4W4UA 2VJFA 1WIMA 5KH3A 2Y43A 2IDAA 5LKXA 5TRBA 5B76A 4YC9A 4FO9A 2EGPA 3DQVR 3V43A 5B8DA 2ECTA 3ZVZB 2MA5A 4FK5A 4GB0A 4YBTA 2LXPC 4N4FA 2UZGA 1WEVA 2M85A 2MD8C 2YQLA 1FBVA 2VP7A 1WEMA 1MM3A 4YADA 2L5UA 1K2FA 1XWHA 1Z60A 2LN0A 2YT5A 1WESA 1ZBDB 3LQIA 2L80A 2CSZA 2LGLA 3O36A 2KFTA 4MSXA 2XEUA 2LXHC 2ECVA 2EODA 1VFYA 2G45A 1JM7B 4I7BA 1X4IA 2KWKA 4CCGX 2F6JA 2F6NA 3L1ZB 5D1KB 2VPBA 5H1VA 1RMDA 3O34A 3U5NA 2K16A 2ZETC 2VJEA 5C11A 2JRJA 2M3HA 2L0BA 3ZNIA 3O37A 4BHWA 1U6GB 4CA1A 2CKLB 4YBMA 1X4UA 4AYCB 3LQJA 2MUMA 2Y1MA 1WEPA 4LLBA 4V3KC 2YSJA 2KGGA 4B86C 3M99A 5KH7A 2CT2A 2E6RA 2EA6A 1IYMA 5AITA 2LQ6A 5TDRA 5D1MB 4BBQA 5KH9A 4GNDA 2G6QA 2ECWA 2HYED 4A0CD 1LDKC 2QIZA 3U5MA 5B79A 4LKAA 1N87A 4V3LC 2ECNA 4WZ2A 2E6SA 3C5KA 3ZPVE 2MA6A 5B77A 1Z2QA 2KIZA 2F42A 1F62A 4Q6FA 3SOUA 2YUCA 4QF2A 3O7AA 2YU4A 2ECGA 2JMIA 5D1LB 3RPGB 2YW8A 1HYIA 3EB5A 3I2DA 4L58A 5G0FA 2M6MA 4GNFA 5LKZA 1JM7A 2YQMA 2JMJA 4ZUXU 3N9MA 2M1RA 3U5OA 3DPLR 2KYUA 3KV5A 3O33A 4IC2A 4LK9A 5FEYA 2HDPA 2KU3A 1WENA 2FUIA 2YHNA 4AUQB 2MNZA 2KREA 1WGMA 4PTBA 3SHBA 4WZ0A 3PURA 5FERA 4F52B 3KQIA 2Y1NA 2BAYA 2C2LA 1BORA 2CKLA 3QZVA 3MHSA 4AYCA 5LKTA 3RPGC 2FSAA 2H0DB 5G05B 2VNFA 4PPEA 5AIUA 3KNVA 4UI9B 3MHHA 3LQHA 2KE1A 4YAXA 2RI7A 4R2YA 2JMDA 2MT5A 2LDRA 5JG6A 5B75A 1HYJA 2YHOA 2K1JA 2LGGA 3N9LA 1WFKA 1JOCA 2RSDA 5LCWB 4I7CA 2QICA 1WE9A 4WA6A 4TKPB 2CSYA 1V87A 4N3WA 1VD4A 3VK6A 2OXQC 2PUYA 3PHDA 2KWJA 1MM2A 3NG2A 3L1XA 1E4UA 1WEQA 4AP4A
chains in the Genus database with same CATH superfamily
5H1TA 2LGKA 3U5PA 3HTKC 1WILA 2YYRA 3M62A 2PNXA 2YURA 1WEWA 2L75A 4NN2A 4O64A 1WEEA 4LJNA 5DINA 3ZVYA 5K3QA 4IC3A 3JUEA 3GL6A 2DX8A 3SOWA 2LGVA 5EYAF 3ASLA 3RTRB 4OGEA 5DKAA 2B0OE 4A49A 2H0DA 4C9ZA 1FP0A 3PUQA 5TDWA 2YREA 2YVRA 3FAOA 2FUUA 4I7DA 2KWNA 4R7EA 4UP0A 2VPDA 2VJFB 2I50A 3IHPA 4XI1A 2LV9A 3KDEC 5FB0A 5B78A 5C13A 3SOXA 4L7XA 2QJ0A 3ZTGA 2CSVA 4A4CA 4WZ3B 2XP0A 4Z0OA 4GNEA 1WEOA 4QF3A 2D8SA 4S3OB 3EB6A 2ECIA 3KV6A 4YABA 1VYXA 4H9DA 2C2VS 2ECJA 5H1UA 1WEUA 1CHCA 3HCUA 4LADB 2K17A 3C6WA 2NAAA 3HCSA 3N9PA 4ZQLA 1DVPA 2E61A 4X3GA 2LRIC 3N9QA 3L11A 4FJCA 3N9OA 5TBNA 5LKUA 2EXUA 2MNYA 1G25A 2G43A 4YATA 2YSMA 5SVIB 2XB1A 3GV4A 2L43A 5SVXA 2OWAA 3HCTA 4FIPA 4S3OC 4UP5A 3M63A 2KKXA 4A4BA 3N9NA 1LDJB 2K4DA 2P57A 2AN6A 4YBSA 2VPEA 1T1HA 5TABA 3FL2A 3O70A 4MVTA 3LRQA 2VPGA 5G04B 2KWOA 4P5OB 3T6RA 4R8PK 5I3LA 2VJEB 4ZDTA 3M7KA 5J3XA 4GNGA 4F1PA 1X4JA 3O47A 2KR4A 3LVQE 2KGIA 3O35A 2MD7B 4QQ4A 2MIQA 3ZYQA 5FB1A 4B7YC 4AVXA 1Z6UA 2XOCA 5H9MA 3T7LA 3ZPV1 4W4UA 2VJFA 1WIMA 5KH3A 2Y43A 2IDAA 5LKXA 5TRBA 5B76A 4YC9A 4FO9A 2EGPA 2CONA 3DQVR 2DJAA 3V43A 2DSMA 5B8DA 2ECTA 3ZVZB 2MA5A 3FEHA 3H7HA 4FK5A 4GB0A 4YBTA 2LXPC 4N4FA 2UZGA 1WEVA 2M85A 2MD8C 2YQLA 2CRRA 1FBVA 2VP7A 1WEMA 1MM3A 4YADA 2L5UA 2RR4A 1K2FA 1XWHA 1Z60A 2LN0A 2YT5A 2L7PA 1WESA 1ZBDB 3LQIA 2L80A 2CSZA 3PLWA 2LGLA 3O36A 2KFTA 4MSXA 2XEUA 2LXHC 5SVIA 2ECVA 2EODA 1VFYA 2G45A 1JM7B 2JUNA 4I7BA 1X4IA 2KWKA 4CCGX 2F6JA 3LJUX 2F6NA 3L1ZB 4O62A 5D1KB 2JM3A 2VPBA 3FM8C 5H1VA 1RMDA 3O34A 3U5NA 2K16A 2ZETC 2VJEA 3DDTA 5C11A 3FJUB 2JRJA 2M3HA 2L0BA 3LDYA 3ZNIA 2IQJA 3O37A 4OGCA 4BHWA 1U6GB 4CA1A 2CKLB 4YBMA 1X4UA 4AYCB 3LQJA 2XOYA 2MUMA 2Y1MA 1WEPA 4LLBA 4V3KC 2YSJA 2KGGA 4B86C 3M99A 5KH7A 2CT2A 3DWDA 2E6RA 2EA6A 1IYMA 5AITA 1DCQA 4Z0RA 2LQ6A 5TDRA 5D1MB 4BBQA 5KH9A 3FANA 2G6QA 4GNDA 2ECWA 2HYED 4A0CD 1LDKC 2QIZA 3U5MA 5B79A 4LKAA 1N87A 4V3LC 2ECNA 4WZ2A 2E6SA 3C5KA 3ZPVE 2MA6A 5B77A 1Z2QA 2KIZA 2F42A 2XOZA 1F62A 4Q6FA 3SOUA 2YUCA 4QF2A 3O7AA 2YU4A 2ECGA 2JMIA 5D1LB 3RPGB 2YW8A 1HYIA 3EB5A 3I2DA 4L58A 5G0FA 2M6MA 4GNFA 5LKZA 1JM7A 3T9KA 2YQMA 2JMJA 4ZUXU 3N9MA 2M1RA 3U5OA 3DPLR 2KYUA 3KV5A 3O33A 4IC2A 3E2DA 4LK9A 5FEYA 2HDPA 2KU3A 1WENA 2FUIA 2YHNA 2MKEA 4AUQB 2MNZA 2KREA 1WGMA 4PTBA 2FFWA 1MBMA 3SHBA 4WZ0A 3PURA 5FERA 4F52B 3KQIA 2Y1NA 2BAYA 2C2LA 1BORA 2CKLA 3QZVA 3MHSA 3Q1DA 4AYCA 2KKYA 5LKTA 3RPGC 2FSAA 2H0DB 5G05B 2VNFA 2LAUA 4PPEA 3MDBC 5AIUA 3KNVA 4UI9B 3MHHA 2D8UA 3LQHA 3LVRE 2FD4A 2KE1A 2M13A 4YAXA 2RI7A 2CRWA 4R2YA 2JMDA 2MT5A 2LDRA 5JG6A 5B75A 5SVYA 1HYJA 2YHOA 2K1JA 2LGGA 3N9LA 1WFKA 1JOCA 2RSDA 5LCWB 4I7CA 2QICA 1WE9A 3SUBA 4WA6A 4TKPB 2CSYA 1V87A 4N3WA 1VD4A 3VK6A 2OXQC 2PUYA 3PHDA 2KWJA 1MM2A 3NG2A 3L1XA 1E4UA 2EGMA 1WEQA 4AP4A
chains in the Genus database with same CATH topology
5H1TA 2LGKA 3U5PA 3HTKC 1WILA 2YYRA 3M62A 2PNXA 2YURA 1WEWA 2L75A 4NN2A 4O64A 1WEEA 4LJNA 5DINA 3ZVYA 4IC3A 3GL6A 2DX8A 3SOWA 2LGVA 5EYAF 3ASLA 3RTRB 5DKAA 4A49A 2H0DA 4C9ZA 1FP0A 3PUQA 5TDWA 2YREA 2FUUA 4I7DA 2KWNA 4R7EA 4UP0A 2VPDA 2VJFB 2I50A 3IHPA 4XI1A 2LV9A 5FB0A 5B78A 5C13A 3SOXA 4L7XA 2QJ0A 3ZTGA 4A4CA 4WZ3B 4GNEA 1WEOA 4QF3A 2D8SA 4S3OB 3EB6A 2ECIA 3KV6A 4YABA 1VYXA 2C2VS 2ECJA 5H1UA 1WEUA 1CHCA 3HCUA 4LADB 2K17A 3C6WA 2NAAA 3HCSA 3N9PA 4ZQLA 1DVPA 4X3GA 2LRIC 3N9QA 3L11A 4FJCA 3N9OA 5TBNA 5LKUA 2MNYA 1G25A 2G43A 4YATA 2YSMA 2XB1A 3GV4A 2L43A 3HCTA 4FIPA 4S3OC 4UP5A 3M63A 4A4BA 3N9NA 1LDJB 2K4DA 2AN6A 4YBSA 2VPEA 1T1HA 5TABA 3FL2A 3O70A 4MVTA 3LRQA 2VPGA 5G04B 2KWOA 4P5OB 3T6RA 4R8PK 5I3LA 2VJEB 4ZDTA 5J3XA 4GNGA 1X4JA 2KR4A 2KGIA 3O35A 2MD7B 2MIQA 3ZYQA 5FB1A 4B7YC 4AVXA 1Z6UA 5H9MA 3T7LA 3ZPV1 4W4UA 2VJFA 1WIMA 5KH3A 2Y43A 2IDAA 5LKXA 5TRBA 5B76A 4YC9A 4FO9A 2EGPA 3DQVR 3V43A 5B8DA 2ECTA 3ZVZB 2MA5A 4FK5A 4GB0A 4YBTA 2LXPC 4N4FA 2UZGA 1WEVA 2M85A 2MD8C 2YQLA 1FBVA 2VP7A 1WEMA 1MM3A 4YADA 2L5UA 1K2FA 1XWHA 1Z60A 2LN0A 2YT5A 1WESA 1ZBDB 3LQIA 2L80A 2CSZA 2LGLA 3O36A 2KFTA 4MSXA 2XEUA 2LXHC 2ECVA 2EODA 1VFYA 2G45A 1JM7B 4I7BA 1X4IA 2KWKA 4CCGX 2F6JA 2F6NA 3L1ZB 5D1KB 2VPBA 5H1VA 1RMDA 3O34A 3U5NA 2K16A 2ZETC 2VJEA 5C11A 2JRJA 2M3HA 2L0BA 3ZNIA 3O37A 4BHWA 1U6GB 4CA1A 2CKLB 4YBMA 1X4UA 4AYCB 3LQJA 2MUMA 2Y1MA 1WEPA 4LLBA 4V3KC 2YSJA 2KGGA 4B86C 3M99A 5KH7A 2CT2A 2E6RA 2EA6A 1IYMA 5AITA 2LQ6A 5TDRA 5D1MB 4BBQA 5KH9A 4GNDA 2G6QA 2ECWA 2HYED 4A0CD 1LDKC 2QIZA 3U5MA 5B79A 4LKAA 1N87A 4V3LC 2ECNA 4WZ2A 2E6SA 3C5KA 3ZPVE 2MA6A 5B77A 1Z2QA 2KIZA 2F42A 1F62A 4Q6FA 3SOUA 2YUCA 4QF2A 3O7AA 2YU4A 2ECGA 2JMIA 5D1LB 3RPGB 2YW8A 1HYIA 3EB5A 3I2DA 4L58A 5G0FA 2M6MA 4GNFA 5LKZA 1JM7A 2YQMA 2JMJA 4ZUXU 3N9MA 2M1RA 3U5OA 3DPLR 2KYUA 3KV5A 3O33A 4IC2A 4LK9A 5FEYA 2HDPA 2KU3A 1WENA 2FUIA 2YHNA 4AUQB 2MNZA 2KREA 1WGMA 4PTBA 3SHBA 4WZ0A 3PURA 5FERA 4F52B 3KQIA 2Y1NA 2BAYA 2C2LA 1BORA 2CKLA 3QZVA 3MHSA 4AYCA 5LKTA 3RPGC 2FSAA 2H0DB 5G05B 2VNFA 4PPEA 5AIUA 3KNVA 4UI9B 3MHHA 3LQHA 2KE1A 4YAXA 2RI7A 4R2YA 2JMDA 2MT5A 2LDRA 5JG6A 5B75A 1HYJA 2YHOA 2K1JA 2LGGA 3N9LA 1WFKA 1JOCA 2RSDA 5LCWB 4I7CA 2QICA 1WE9A 4WA6A 4TKPB 2CSYA 1V87A 4N3WA 1VD4A 3VK6A 2OXQC 2PUYA 3PHDA 2KWJA 1MM2A 3NG2A 3L1XA 1E4UA 1WEQA 4AP4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H1T A;  2LGK A;  3U5P A;  3HTK C;  1WIL A;  2YYR A;  3M62 A;  2PNX A;  2YUR A;  1WEW A;  2L75 A;  4NN2 A;  4O64 A;  1WEE A;  4LJN A;  5DIN A;  3ZVY A;  4IC3 A;  3GL6 A;  2DX8 A;  3SOW A;  2LGV A;  5EYA F;  3ASL A;  3RTR B;  5DKA A;  4A49 A;  2H0D A;  4C9Z A;  1FP0 A;  3PUQ A;  5TDW A;  2YRE A;  2FUU A;  4I7D A;  2KWN A;  4R7E A;  4UP0 A;  2VPD A;  2VJF B;  2I50 A;  3IHP A;  4XI1 A;  2LV9 A;  5FB0 A;  5B78 A;  5C13 A;  3SOX A;  4L7X A;  2QJ0 A;  3ZTG A;  4A4C A;  4WZ3 B;  4GNE A;  1WEO A;  4QF3 A;  2D8S A;  4S3O B;  3EB6 A;  2ECI A;  3KV6 A;  4YAB A;  1VYX A;  2C2V S;  2ECJ A;  5H1U A;  1WEU A;  1CHC A;  3HCU A;  4LAD B;  2K17 A;  3C6W A;  2NAA A;  3HCS A;  3N9P A;  4ZQL A;  1DVP A;  4X3G A;  2LRI C;  3N9Q A;  3L11 A;  4FJC A;  3N9O A;  5TBN A;  5LKU A;  2MNY A;  1G25 A;  2G43 A;  4YAT A;  2YSM A;  2XB1 A;  3GV4 A;  2L43 A;  3HCT A;  4FIP A;  4S3O C;  4UP5 A;  3M63 A;  4A4B A;  3N9N A;  1LDJ B;  2K4D A;  2AN6 A;  4YBS A;  2VPE A;  1T1H A;  5TAB A;  3FL2 A;  3O70 A;  4MVT A;  3LRQ A;  2VPG A;  5G04 B;  2KWO A;  4P5O B;  3T6R A;  4R8P K;  5I3L A;  2VJE B;  4ZDT A;  5J3X A;  4GNG A;  1X4J A;  2KR4 A;  2KGI A;  3O35 A;  2MD7 B;  2MIQ A;  3ZYQ A;  5FB1 A;  4B7Y C;  4AVX A;  1Z6U A;  5H9M A;  3T7L A;  3ZPV 1;  4W4U A;  2VJF A;  1WIM A;  5KH3 A;  2Y43 A;  2IDA A;  5LKX A;  5TRB A;  5B76 A;  4YC9 A;  4FO9 A;  2EGP A;  3DQV R;  3V43 A;  5B8D A;  2ECT A;  3ZVZ B;  2MA5 A;  4FK5 A;  4GB0 A;  4YBT A;  2LXP C;  4N4F A;  2UZG A;  1WEV A;  2M85 A;  2MD8 C;  2YQL A;  1FBV A;  2VP7 A;  1WEM A;  1MM3 A;  4YAD A;  2L5U A;  1K2F A;  1XWH A;  1Z60 A;  2LN0 A;  2YT5 A;  1WES A;  1ZBD B;  3LQI A;  2L80 A;  2CSZ A;  2LGL A;  3O36 A;  2KFT A;  4MSX A;  2XEU A;  2LXH C;  2ECV A;  2EOD A;  1VFY A;  2G45 A;  1JM7 B;  4I7B A;  1X4I A;  2KWK A;  4CCG X;  2F6J A;  2F6N A;  3L1Z B;  5D1K B;  2VPB A;  5H1V A;  1RMD A;  3O34 A;  3U5N A;  2K16 A;  2ZET C;  2VJE A;  5C11 A;  2JRJ A;  2M3H A;  2L0B A;  3ZNI A;  3O37 A;  4BHW A;  1U6G B;  4CA1 A;  2CKL B;  4YBM A;  1X4U A;  4AYC B;  3LQJ A;  2MUM A;  2Y1M A;  1WEP A;  4LLB A;  4V3K C;  2YSJ A;  2KGG A;  4B86 C;  3M99 A;  5KH7 A;  2CT2 A;  2E6R A;  2EA6 A;  1IYM A;  5AIT A;  2LQ6 A;  5TDR A;  5D1M B;  4BBQ A;  5KH9 A;  4GND A;  2G6Q A;  2ECW A;  2HYE D;  4A0C D;  1LDK C;  2QIZ A;  3U5M A;  5B79 A;  4LKA A;  1N87 A;  4V3L C;  2ECN A;  4WZ2 A;  2E6S A;  3C5K A;  3ZPV E;  2MA6 A;  5B77 A;  1Z2Q A;  2KIZ A;  2F42 A;  1F62 A;  4Q6F A;  3SOU A;  2YUC A;  4QF2 A;  3O7A A;  2YU4 A;  2ECG A;  2JMI A;  5D1L B;  3RPG B;  2YW8 A;  1HYI A;  3EB5 A;  3I2D A;  4L58 A;  5G0F A;  2M6M A;  4GNF A;  5LKZ A;  1JM7 A;  2YQM A;  2JMJ A;  4ZUX U;  3N9M A;  2M1R A;  3U5O A;  3DPL R;  2KYU A;  3KV5 A;  3O33 A;  4IC2 A;  4LK9 A;  5FEY A;  2HDP A;  2KU3 A;  1WEN A;  2FUI A;  2YHN A;  4AUQ B;  2MNZ A;  2KRE A;  1WGM A;  4PTB A;  3SHB A;  4WZ0 A;  3PUR A;  5FER A;  4F52 B;  3KQI A;  2Y1N A;  2BAY A;  2C2L A;  1BOR A;  2CKL A;  3QZV A;  3MHS A;  4AYC A;  5LKT A;  3RPG C;  2FSA A;  2H0D B;  5G05 B;  2VNF A;  4PPE A;  5AIU A;  3KNV A;  4UI9 B;  3MHH A;  3LQH A;  2KE1 A;  4YAX A;  2RI7 A;  4R2Y A;  2JMD A;  2MT5 A;  2LDR A;  5JG6 A;  5B75 A;  1HYJ A;  2YHO A;  2K1J A;  2LGG A;  3N9L A;  1WFK A;  1JOC A;  2RSD A;  5LCW B;  4I7C A;  2QIC A;  1WE9 A;  4WA6 A;  4TKP B;  2CSY A;  1V87 A;  4N3W A;  1VD4 A;  3VK6 A;  2OXQ C;  2PUY A;  3PHD A;  2KWJ A;  1MM2 A;  3NG2 A;  3L1X A;  1E4U A;  1WEQ A;  4AP4 A; 
#chains in the Genus database with same CATH topology
 5H1T A;  2LGK A;  3U5P A;  3HTK C;  1WIL A;  2YYR A;  3M62 A;  2PNX A;  2YUR A;  1WEW A;  2L75 A;  4NN2 A;  4O64 A;  1WEE A;  4LJN A;  5DIN A;  3ZVY A;  5K3Q A;  4IC3 A;  3JUE A;  3GL6 A;  2DX8 A;  3SOW A;  2LGV A;  5EYA F;  3ASL A;  3RTR B;  4OGE A;  5DKA A;  2B0O E;  4A49 A;  2H0D A;  4C9Z A;  1FP0 A;  3PUQ A;  5TDW A;  2YRE A;  2YVR A;  3FAO A;  2FUU A;  4I7D A;  2KWN A;  4R7E A;  4UP0 A;  2VPD A;  2VJF B;  2I50 A;  3IHP A;  4XI1 A;  2LV9 A;  3KDE C;  5FB0 A;  5B78 A;  5C13 A;  3SOX A;  4L7X A;  2QJ0 A;  3ZTG A;  2CSV A;  4A4C A;  4WZ3 B;  2XP0 A;  4Z0O A;  4GNE A;  1WEO A;  4QF3 A;  2D8S A;  4S3O B;  3EB6 A;  2ECI A;  3KV6 A;  4YAB A;  1VYX A;  4H9D A;  2C2V S;  2ECJ A;  5H1U A;  1WEU A;  1CHC A;  3HCU A;  4LAD B;  2K17 A;  3C6W A;  2NAA A;  3HCS A;  3N9P A;  4ZQL A;  1DVP A;  2E61 A;  4X3G A;  2LRI C;  3N9Q A;  3L11 A;  4FJC A;  3N9O A;  5TBN A;  5LKU A;  2EXU A;  2MNY A;  1G25 A;  2G43 A;  4YAT A;  2YSM A;  5SVI B;  2XB1 A;  3GV4 A;  2L43 A;  5SVX A;  2OWA A;  3HCT A;  4FIP A;  4S3O C;  4UP5 A;  3M63 A;  2KKX A;  4A4B A;  3N9N A;  1LDJ B;  2K4D A;  2P57 A;  2AN6 A;  4YBS A;  2VPE A;  1T1H A;  5TAB A;  3FL2 A;  3O70 A;  4MVT A;  3LRQ A;  2VPG A;  5G04 B;  2KWO A;  4P5O B;  3T6R A;  4R8P K;  5I3L A;  2VJE B;  4ZDT A;  3M7K A;  5J3X A;  4GNG A;  4F1P A;  1X4J A;  3O47 A;  2KR4 A;  3LVQ E;  2KGI A;  3O35 A;  2MD7 B;  4QQ4 A;  2MIQ A;  3ZYQ A;  5FB1 A;  4B7Y C;  4AVX A;  1Z6U A;  2XOC A;  5H9M A;  3T7L A;  3ZPV 1;  4W4U A;  2VJF A;  1WIM A;  5KH3 A;  2Y43 A;  2IDA A;  5LKX A;  5TRB A;  5B76 A;  4YC9 A;  4FO9 A;  2EGP A;  2CON A;  3DQV R;  2DJA A;  3V43 A;  2DSM A;  5B8D A;  2ECT A;  3ZVZ B;  2MA5 A;  3FEH A;  3H7H A;  4FK5 A;  4GB0 A;  4YBT A;  2LXP C;  4N4F A;  2UZG A;  1WEV A;  2M85 A;  2MD8 C;  2YQL A;  2CRR A;  1FBV A;  2VP7 A;  1WEM A;  1MM3 A;  4YAD A;  2L5U A;  2RR4 A;  1K2F A;  1XWH A;  1Z60 A;  2LN0 A;  2YT5 A;  2L7P A;  1WES A;  1ZBD B;  3LQI A;  2L80 A;  2CSZ A;  3PLW A;  2LGL A;  3O36 A;  2KFT A;  4MSX A;  2XEU A;  2LXH C;  5SVI A;  2ECV A;  2EOD A;  1VFY A;  2G45 A;  1JM7 B;  2JUN A;  4I7B A;  1X4I A;  2KWK A;  4CCG X;  2F6J A;  3LJU X;  2F6N A;  3L1Z B;  4O62 A;  5D1K B;  2JM3 A;  2VPB A;  3FM8 C;  5H1V A;  1RMD A;  3O34 A;  3U5N A;  2K16 A;  2ZET C;  2VJE A;  3DDT A;  5C11 A;  3FJU B;  2JRJ A;  2M3H A;  2L0B A;  3LDY A;  3ZNI A;  2IQJ A;  3O37 A;  4OGC A;  4BHW A;  1U6G B;  4CA1 A;  2CKL B;  4YBM A;  1X4U A;  4AYC B;  3LQJ A;  2XOY A;  2MUM A;  2Y1M A;  1WEP A;  4LLB A;  4V3K C;  2YSJ A;  2KGG A;  4B86 C;  3M99 A;  5KH7 A;  2CT2 A;  3DWD A;  2E6R A;  2EA6 A;  1IYM A;  5AIT A;  1DCQ A;  4Z0R A;  2LQ6 A;  5TDR A;  5D1M B;  4BBQ A;  5KH9 A;  3FAN A;  2G6Q A;  4GND A;  2ECW A;  2HYE D;  4A0C D;  1LDK C;  2QIZ A;  3U5M A;  5B79 A;  4LKA A;  1N87 A;  4V3L C;  2ECN A;  4WZ2 A;  2E6S A;  3C5K A;  3ZPV E;  2MA6 A;  5B77 A;  1Z2Q A;  2KIZ A;  2F42 A;  2XOZ A;  1F62 A;  4Q6F A;  3SOU A;  2YUC A;  4QF2 A;  3O7A A;  2YU4 A;  2ECG A;  2JMI A;  5D1L B;  3RPG B;  2YW8 A;  1HYI A;  3EB5 A;  3I2D A;  4L58 A;  5G0F A;  2M6M A;  4GNF A;  5LKZ A;  1JM7 A;  3T9K A;  2YQM A;  2JMJ A;  4ZUX U;  3N9M A;  2M1R A;  3U5O A;  3DPL R;  2KYU A;  3KV5 A;  3O33 A;  4IC2 A;  3E2D A;  4LK9 A;  5FEY A;  2HDP A;  2KU3 A;  1WEN A;  2FUI A;  2YHN A;  2MKE A;  4AUQ B;  2MNZ A;  2KRE A;  1WGM A;  4PTB A;  2FFW A;  1MBM A;  3SHB A;  4WZ0 A;  3PUR A;  5FER A;  4F52 B;  3KQI A;  2Y1N A;  2BAY A;  2C2L A;  1BOR A;  2CKL A;  3QZV A;  3MHS A;  3Q1D A;  4AYC A;  2KKY A;  5LKT A;  3RPG C;  2FSA A;  2H0D B;  5G05 B;  2VNF A;  2LAU A;  4PPE A;  3MDB C;  5AIU A;  3KNV A;  4UI9 B;  3MHH A;  2D8U A;  3LQH A;  3LVR E;  2FD4 A;  2KE1 A;  2M13 A;  4YAX A;  2RI7 A;  2CRW A;  4R2Y A;  2JMD A;  2MT5 A;  2LDR A;  5JG6 A;  5B75 A;  5SVY A;  1HYJ A;  2YHO A;  2K1J A;  2LGG A;  3N9L A;  1WFK A;  1JOC A;  2RSD A;  5LCW B;  4I7C A;  2QIC A;  1WE9 A;  3SUB A;  4WA6 A;  4TKP B;  2CSY A;  1V87 A;  4N3W A;  1VD4 A;  3VK6 A;  2OXQ C;  2PUY A;  3PHD A;  2KWJ A;  1MM2 A;  3NG2 A;  3L1X A;  1E4U A;  2EGM A;  1WEQ A;  4AP4 A; 
#chains in the Genus database with same CATH homology
 5H1T A;  2LGK A;  3U5P A;  3HTK C;  1WIL A;  2YYR A;  3M62 A;  2PNX A;  2YUR A;  1WEW A;  2L75 A;  4NN2 A;  4O64 A;  1WEE A;  4LJN A;  5DIN A;  3ZVY A;  4IC3 A;  3GL6 A;  2DX8 A;  3SOW A;  2LGV A;  5EYA F;  3ASL A;  3RTR B;  5DKA A;  4A49 A;  2H0D A;  4C9Z A;  1FP0 A;  3PUQ A;  5TDW A;  2YRE A;  2FUU A;  4I7D A;  2KWN A;  4R7E A;  4UP0 A;  2VPD A;  2VJF B;  2I50 A;  3IHP A;  4XI1 A;  2LV9 A;  5FB0 A;  5B78 A;  5C13 A;  3SOX A;  4L7X A;  2QJ0 A;  3ZTG A;  4A4C A;  4WZ3 B;  4GNE A;  1WEO A;  4QF3 A;  2D8S A;  4S3O B;  3EB6 A;  2ECI A;  3KV6 A;  4YAB A;  1VYX A;  2C2V S;  2ECJ A;  5H1U A;  1WEU A;  1CHC A;  3HCU A;  4LAD B;  2K17 A;  3C6W A;  2NAA A;  3HCS A;  3N9P A;  4ZQL A;  1DVP A;  4X3G A;  2LRI C;  3N9Q A;  3L11 A;  4FJC A;  3N9O A;  5TBN A;  5LKU A;  2MNY A;  1G25 A;  2G43 A;  4YAT A;  2YSM A;  2XB1 A;  3GV4 A;  2L43 A;  3HCT A;  4FIP A;  4S3O C;  4UP5 A;  3M63 A;  4A4B A;  3N9N A;  1LDJ B;  2K4D A;  2AN6 A;  4YBS A;  2VPE A;  1T1H A;  5TAB A;  3FL2 A;  3O70 A;  4MVT A;  3LRQ A;  2VPG A;  5G04 B;  2KWO A;  4P5O B;  3T6R A;  4R8P K;  5I3L A;  2VJE B;  4ZDT A;  5J3X A;  4GNG A;  1X4J A;  2KR4 A;  2KGI A;  3O35 A;  2MD7 B;  2MIQ A;  3ZYQ A;  5FB1 A;  4B7Y C;  4AVX A;  1Z6U A;  5H9M A;  3T7L A;  3ZPV 1;  4W4U A;  2VJF A;  1WIM A;  5KH3 A;  2Y43 A;  2IDA A;  5LKX A;  5TRB A;  5B76 A;  4YC9 A;  4FO9 A;  2EGP A;  3DQV R;  3V43 A;  5B8D A;  2ECT A;  3ZVZ B;  2MA5 A;  4FK5 A;  4GB0 A;  4YBT A;  2LXP C;  4N4F A;  2UZG A;  1WEV A;  2M85 A;  2MD8 C;  2YQL A;  1FBV A;  2VP7 A;  1WEM A;  1MM3 A;  4YAD A;  2L5U A;  1K2F A;  1XWH A;  1Z60 A;  2LN0 A;  2YT5 A;  1WES A;  1ZBD B;  3LQI A;  2L80 A;  2CSZ A;  2LGL A;  3O36 A;  2KFT A;  4MSX A;  2XEU A;  2LXH C;  2ECV A;  2EOD A;  1VFY A;  2G45 A;  1JM7 B;  4I7B A;  1X4I A;  2KWK A;  4CCG X;  2F6J A;  2F6N A;  3L1Z B;  5D1K B;  2VPB A;  5H1V A;  1RMD A;  3O34 A;  3U5N A;  2K16 A;  2ZET C;  2VJE A;  5C11 A;  2JRJ A;  2M3H A;  2L0B A;  3ZNI A;  3O37 A;  4BHW A;  1U6G B;  4CA1 A;  2CKL B;  4YBM A;  1X4U A;  4AYC B;  3LQJ A;  2MUM A;  2Y1M A;  1WEP A;  4LLB A;  4V3K C;  2YSJ A;  2KGG A;  4B86 C;  3M99 A;  5KH7 A;  2CT2 A;  2E6R A;  2EA6 A;  1IYM A;  5AIT A;  2LQ6 A;  5TDR A;  5D1M B;  4BBQ A;  5KH9 A;  4GND A;  2G6Q A;  2ECW A;  2HYE D;  4A0C D;  1LDK C;  2QIZ A;  3U5M A;  5B79 A;  4LKA A;  1N87 A;  4V3L C;  2ECN A;  4WZ2 A;  2E6S A;  3C5K A;  3ZPV E;  2MA6 A;  5B77 A;  1Z2Q A;  2KIZ A;  2F42 A;  1F62 A;  4Q6F A;  3SOU A;  2YUC A;  4QF2 A;  3O7A A;  2YU4 A;  2ECG A;  2JMI A;  5D1L B;  3RPG B;  2YW8 A;  1HYI A;  3EB5 A;  3I2D A;  4L58 A;  5G0F A;  2M6M A;  4GNF A;  5LKZ A;  1JM7 A;  2YQM A;  2JMJ A;  4ZUX U;  3N9M A;  2M1R A;  3U5O A;  3DPL R;  2KYU A;  3KV5 A;  3O33 A;  4IC2 A;  4LK9 A;  5FEY A;  2HDP A;  2KU3 A;  1WEN A;  2FUI A;  2YHN A;  4AUQ B;  2MNZ A;  2KRE A;  1WGM A;  4PTB A;  3SHB A;  4WZ0 A;  3PUR A;  5FER A;  4F52 B;  3KQI A;  2Y1N A;  2BAY A;  2C2L A;  1BOR A;  2CKL A;  3QZV A;  3MHS A;  4AYC A;  5LKT A;  3RPG C;  2FSA A;  2H0D B;  5G05 B;  2VNF A;  4PPE A;  5AIU A;  3KNV A;  4UI9 B;  3MHH A;  3LQH A;  2KE1 A;  4YAX A;  2RI7 A;  4R2Y A;  2JMD A;  2MT5 A;  2LDR A;  5JG6 A;  5B75 A;  1HYJ A;  2YHO A;  2K1J A;  2LGG A;  3N9L A;  1WFK A;  1JOC A;  2RSD A;  5LCW B;  4I7C A;  2QIC A;  1WE9 A;  4WA6 A;  4TKP B;  2CSY A;  1V87 A;  4N3W A;  1VD4 A;  3VK6 A;  2OXQ C;  2PUY A;  3PHD A;  2KWJ A;  1MM2 A;  3NG2 A;  3L1X A;  1E4U A;  1WEQ A;  4AP4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...