2ECGA

Solution structure of the ring domain of the baculoviral iap repeat-containing protein 4 from homo sapiens
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
75
structure length
75
Chain Sequence
GSSGSSGSLQKEISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDKCPMCYTVITFKQKIFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Baculoviral IAP repeat-containing protein 4
publication title Solution structure of the ring domain of the Baculoviral IAP repeat-containing protein 4 from Homo sapiens
rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 6
structure length 75
sequence length 75
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2007-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2ecgA00
2VJEB 3T7LA 2K1JA 1Z6UA 2LGGA 2IDAA 2JMDA 3ZVYA 4W4UA 1WESA 2JMJA 5G04B 3M99A 1VD4A 3ZYQA 3L1XA 4XI1A 2ECWA 4P5OB 4WZ3B 2XEUA 2F6NA 2KGIA 2LN0A 1WEWA 2VPBA 3GV4A 5B77A 2YYRA 2RI7A 2F42A 2LGLA 3HTKC 5LKTA 3RPGC 4MSXA 2EA6A 4NN2A 1WEOA 2LXPC 4A49A 4TKPB 2KWNA 4A0CD 1K2FA 3LRQA 2KFTA 2YU4A 3N9LA 4ZDTA 3M63A 1WEVA 4YBSA 5D1MB 2YT5A 4GNFA 2Y1NA 3PURA 2MT5A 5DKAA 4X3GA 1HYJA 3I2DA 2LGKA 5AIUA 5FB1A 3C6WA 2QIZA 5KH9A 5FB0A 3LQIA 3U5MA 2MA6A 1N87A 4AYCA 4I7DA 1G25A 1ZBDB 4V3KC 2YUCA 4LJNA 4B7YC 3RTRB 1HYIA 1LDJB 1JM7A 4Q6FA 4S3OC 4FJCA 4N3WA 2MA5A 4A4CA 2MNZA 4GB0A 2Y43A 2LXHC 2YREA 4IC3A 3VK6A 2K16A 2LV9A 2EGPA 2F6JA 4ZQLA 4FO9A 3ZNIA 2HDPA 4QF3A 2ECTA 4IC2A 4L7XA 3ZTGA 1LDKC 5TDRA 1JM7B 4YBTA 3MHHA 2KIZA 3SHBA 5FERA 2KYUA 3SOUA 2EODA 5J3XA 4PTBA 3SOWA 2UZGA 2MNYA 5LCWB 4R2YA 5H9MA 1V87A 4LLBA 3N9MA 3HCTA 1E4UA 3DPLR 3O33A 5LKUA 2H0DA 5H1UA 5EYAF 2M6MA 2VPDA 2G6QA 5G05B 2CKLA 2VJFB 4AVXA 5G0FA 4CCGX 5TRBA 3EB6A 1X4UA 2FUUA 1T1HA 4LKAA 4O64A 2PNXA 3LQJA 2I50A 4R7EA 3NG2A 4UP5A 5C11A 2OXQC 3MHSA 3O37A 1F62A 2H0DB 3U5NA 3IHPA 5TBNA 2ECGA 2NAAA 4YADA 1WEQA 2K17A 5KH3A 3ZPVE 5JG6A 2G45A 2YSMA 1WIMA 2CKLB 4A4BA 4MVTA 2VPEA 2KWKA 2HYED 2KE1A 5B76A 5AITA 4WA6A 1WENA 1WGMA 4FK5A 3RPGB 2D8SA 3GL6A 4R8PK 2K4DA 3T6RA 3O7AA 2L5UA 2QJ0A 1X4IA 4AP4A 5B8DA 1XWHA 2L0BA 1DVPA 2L80A 2KWOA 3M62A 3N9QA 4F52B 2C2LA 3DQVR 2BAYA 2VP7A 5H1TA 2QICA 3EB5A 5KH7A 2CSZA 5B75A 2MD8C 5TABA 1X4JA 1BORA 2YHOA 4YATA 2YSJA 1JOCA 2KR4A 3QZVA 4YAXA 3N9PA 2G43A 2VJFA 3N9OA 2MIQA 4C9ZA 1FP0A 1Z2QA 3KQIA 2ZETC 3LQHA 4S3OB 4FIPA 4BHWA 2YQLA 3V43A 5B78A 4YC9A 3KV5A 5D1KB 2ECIA 2M3HA 3ZVZB 2FUIA 2CSYA 2JRJA 2L43A 4GNEA 3SOXA 2ECNA 2Y1MA 4V3LC 3O34A 4UI9B 2LRIC 3O70A 2ECJA 4ZUXU 1IYMA 2VNFA 2RSDA 2YQMA 1WEEA 3O35A 3ASLA 2PUYA 2E6RA 4LK9A 5LKZA 3U5PA 3HCSA 1WEPA 2XB1A 3O36A 2AN6A 3FL2A 5FEYA 1Z60A 2YURA 5D1LB 4AUQB 3PUQA 2MD7B 4N4FA 5DINA 5C13A 4CA1A 3N9NA 1U6GB 2KGGA 3PHDA 4L58A 1MM3A 1WEUA 3C5KA 4I7CA 4UP0A 5H1VA 4BBQA 4B86C 2DX8A 1CHCA 5TDWA 2KREA 1WE9A 2JMIA 2M1RA 3ZPV1 3HCUA 1RMDA 2CT2A 2L75A 4LADB 1VYXA 1WFKA 2ECVA 4WZ2A 2LDRA 2MUMA 1WILA 2FSAA 2VPGA 3KV6A 5I3LA 2LQ6A 4GNDA 5B79A 5LKXA 4YBMA 2VJEA 3L11A 1WEMA 4I7BA 2LGVA 4WZ0A 2M85A 4YABA 2C2VS 4PPEA 4AYCB 1MM2A 4QF2A 3KNVA 1VFYA 2YHNA 4GNGA 2KWJA 1FBVA 2KU3A 2YW8A 3U5OA 3L1ZB 2E6SA
chains in the Genus database with same CATH superfamily
2VJEB 3T7LA 2K1JA 1Z6UA 2DSMA 2IDAA 2JMDA 2LGGA 3ZVYA 4W4UA 1WESA 2OWAA 4OGCA 2JMJA 5G04B 3M99A 1VD4A 3ZYQA 3L1XA 4XI1A 2ECWA 4P5OB 4WZ3B 2XEUA 2F6NA 2KGIA 3GV4A 1WEWA 2LN0A 2VPBA 5B77A 2YYRA 2RI7A 2F42A 2LGLA 4Z0RA 3HTKC 5LKTA 3RPGC 4MSXA 2EA6A 4NN2A 2LAUA 1WEOA 2LXPC 2E61A 4A49A 4TKPB 2KWNA 2XOYA 4A0CD 1K2FA 3LRQA 2KFTA 2YU4A 3N9LA 4ZDTA 3M63A 1WEVA 4YBSA 5D1MB 2YT5A 4GNFA 2Y1NA 2JUNA 3PURA 2MT5A 5DKAA 4X3GA 1HYJA 3I2DA 2LGKA 5AIUA 5FB1A 3C6WA 3DDTA 2QIZA 5KH9A 5FB0A 3LQIA 3U5MA 2MA6A 1N87A 4AYCA 3M7KA 4I7DA 1G25A 1ZBDB 4V3KC 2YUCA 4LJNA 4B7YC 2RR4A 3RTRB 3JUEA 1HYIA 1LDJB 1JM7A 1MBMA 4Q6FA 4S3OC 4FJCA 4N3WA 2MA5A 4A4CA 2MNZA 2EXUA 4GB0A 2Y43A 2LXHC 2YREA 4IC3A 3VK6A 2K16A 2LV9A 2EGPA 2F6JA 4ZQLA 4FO9A 3ZNIA 2HDPA 4QF3A 2ECTA 4IC2A 4L7XA 3ZTGA 1LDKC 5TDRA 5SVYA 1JM7B 4YBTA 3MHHA 2KIZA 5SVXA 3SHBA 5FERA 2KYUA 3FM8C 3SOUA 2EODA 5J3XA 2KKXA 5K3QA 4PTBA 3H7HA 3E2DA 3SOWA 2UZGA 2MNYA 5LCWB 4R2YA 5H9MA 1V87A 4LLBA 3N9MA 3HCTA 1E4UA 3DPLR 1DCQA 3O33A 5LKUA 2H0DA 5H1UA 5EYAF 4O62A 2CONA 2IQJA 2M6MA 2VPDA 2G6QA 5G05B 2CKLA 2VJFB 3DWDA 4AVXA 5G0FA 4H9DA 4CCGX 5TRBA 3EB6A 1X4UA 2FUUA 1T1HA 4LKAA 4O64A 2PNXA 2CRWA 3LQJA 2I50A 4R7EA 3NG2A 4UP5A 5C11A 2OXQC 3MHSA 3O37A 1F62A 2H0DB 3U5NA 2XOCA 3IHPA 5TBNA 2ECGA 2NAAA 4YADA 1WEQA 2K17A 5KH3A 3ZPVE 5JG6A 4QQ4A 2G45A 2YSMA 1WIMA 2CKLB 4A4BA 4MVTA 2VPEA 3MDBC 2KWKA 2FD4A 2HYED 2KE1A 5B76A 5AITA 4WA6A 1WENA 1WGMA 4FK5A 3RPGB 2D8SA 3GL6A 2P57A 2XOZA 4R8PK 3SUBA 2K4DA 3T6RA 3O7AA 2L5UA 2QJ0A 1X4IA 4AP4A 5B8DA 1XWHA 2XP0A 5SVIA 2L0BA 1DVPA 2L80A 2KWOA 3M62A 4F1PA 3N9QA 4F52B 2C2LA 3DQVR 2BAYA 2VP7A 5H1TA 2QICA 3LJUX 3EB5A 5KH7A 2CSZA 5B75A 2MD8C 5TABA 1X4JA 1BORA 2YHOA 4YATA 2YSJA 1JOCA 2KR4A 3QZVA 4YAXA 5SVIB 3PLWA 2MKEA 3N9PA 2G43A 2VJFA 3N9OA 2MIQA 4C9ZA 1FP0A 1Z2QA 2KKYA 3KQIA 2ZETC 3FEHA 3LQHA 4S3OB 4FIPA 4BHWA 2YQLA 2DJAA 3V43A 5B78A 2FFWA 4YC9A 3KV5A 5D1KB 2ECIA 2M3HA 3ZVZB 2FUIA 2CSYA 2JRJA 2L43A 4GNEA 3SOXA 2ECNA 2Y1MA 4V3LC 2M13A 3O34A 4UI9B 2LRIC 3O70A 2ECJA 4ZUXU 4Z0OA 1IYMA 2VNFA 2RSDA 2YQMA 1WEEA 3O35A 3ASLA 2PUYA 3LDYA 2E6RA 4LK9A 4OGEA 5LKZA 3U5PA 3HCSA 1WEPA 2YVRA 2XB1A 3O36A 2AN6A 3FL2A 5FEYA 1Z60A 2YURA 2CSVA 5D1LB 4AUQB 3PUQA 2MD7B 4N4FA 5DINA 5C13A 4CA1A 3N9NA 1U6GB 2KGGA 3PHDA 4L58A 1MM3A 1WEUA 3C5KA 4I7CA 4UP0A 5H1VA 2JM3A 2B0OE 4BBQA 4B86C 2EGMA 2DX8A 1CHCA 5TDWA 2CRRA 2KREA 1WE9A 2JMIA 2M1RA 3ZPV1 3HCUA 3T9KA 1RMDA 2CT2A 2L75A 4LADB 1VYXA 1WFKA 2ECVA 4WZ2A 2LDRA 2MUMA 1WILA 2FSAA 2VPGA 3FJUB 3KV6A 5I3LA 2LQ6A 4GNDA 3FAOA 5B79A 5LKXA 4YBMA 2VJEA 2D8UA 1WEMA 3L11A 4I7BA 2LGVA 3LVRE 4WZ0A 3Q1DA 2M85A 3KDEC 4YABA 2C2VS 3FANA 4PPEA 4AYCB 3LVQE 1MM2A 4QF2A 3KNVA 1VFYA 2L7PA 2YHNA 4GNGA 2KWJA 1FBVA 2KU3A 3O47A 2YW8A 3U5OA 3L1ZB 2E6SA
chains in the Genus database with same CATH topology
2VJEB 3T7LA 2K1JA 1Z6UA 2LGGA 2IDAA 2JMDA 3ZVYA 4W4UA 1WESA 2JMJA 5G04B 3M99A 1VD4A 3ZYQA 3L1XA 4XI1A 2ECWA 4P5OB 4WZ3B 2XEUA 2F6NA 2KGIA 2LN0A 1WEWA 2VPBA 3GV4A 5B77A 2YYRA 2RI7A 2F42A 2LGLA 3HTKC 5LKTA 3RPGC 4MSXA 2EA6A 4NN2A 1WEOA 2LXPC 4A49A 4TKPB 2KWNA 4A0CD 1K2FA 3LRQA 2KFTA 2YU4A 3N9LA 4ZDTA 3M63A 1WEVA 4YBSA 5D1MB 2YT5A 4GNFA 2Y1NA 3PURA 2MT5A 5DKAA 4X3GA 1HYJA 3I2DA 2LGKA 5AIUA 5FB1A 3C6WA 2QIZA 5KH9A 5FB0A 3LQIA 3U5MA 2MA6A 1N87A 4AYCA 4I7DA 1G25A 1ZBDB 4V3KC 2YUCA 4LJNA 4B7YC 3RTRB 1HYIA 1LDJB 1JM7A 4Q6FA 4S3OC 4FJCA 4N3WA 2MA5A 4A4CA 2MNZA 4GB0A 2Y43A 2LXHC 2YREA 4IC3A 3VK6A 2K16A 2LV9A 2EGPA 2F6JA 4ZQLA 4FO9A 3ZNIA 2HDPA 4QF3A 2ECTA 4IC2A 4L7XA 3ZTGA 1LDKC 5TDRA 1JM7B 4YBTA 3MHHA 2KIZA 3SHBA 5FERA 2KYUA 3SOUA 2EODA 5J3XA 4PTBA 3SOWA 2UZGA 2MNYA 5LCWB 4R2YA 5H9MA 1V87A 4LLBA 3N9MA 3HCTA 1E4UA 3DPLR 3O33A 5LKUA 2H0DA 5H1UA 5EYAF 2M6MA 2VPDA 2G6QA 5G05B 2CKLA 2VJFB 4AVXA 5G0FA 4CCGX 5TRBA 3EB6A 1X4UA 2FUUA 1T1HA 4LKAA 4O64A 2PNXA 3LQJA 2I50A 4R7EA 3NG2A 4UP5A 5C11A 2OXQC 3MHSA 3O37A 1F62A 2H0DB 3U5NA 3IHPA 5TBNA 2ECGA 2NAAA 4YADA 1WEQA 2K17A 5KH3A 3ZPVE 5JG6A 2G45A 2YSMA 1WIMA 2CKLB 4A4BA 4MVTA 2VPEA 2KWKA 2HYED 2KE1A 5B76A 5AITA 4WA6A 1WENA 1WGMA 4FK5A 3RPGB 2D8SA 3GL6A 4R8PK 2K4DA 3T6RA 3O7AA 2L5UA 2QJ0A 1X4IA 4AP4A 5B8DA 1XWHA 2L0BA 1DVPA 2L80A 2KWOA 3M62A 3N9QA 4F52B 2C2LA 3DQVR 2BAYA 2VP7A 5H1TA 2QICA 3EB5A 5KH7A 2CSZA 5B75A 2MD8C 5TABA 1X4JA 1BORA 2YHOA 4YATA 2YSJA 1JOCA 2KR4A 3QZVA 4YAXA 3N9PA 2G43A 2VJFA 3N9OA 2MIQA 4C9ZA 1FP0A 1Z2QA 3KQIA 2ZETC 3LQHA 4S3OB 4FIPA 4BHWA 2YQLA 3V43A 5B78A 4YC9A 3KV5A 5D1KB 2ECIA 2M3HA 3ZVZB 2FUIA 2CSYA 2JRJA 2L43A 4GNEA 3SOXA 2ECNA 2Y1MA 4V3LC 3O34A 4UI9B 2LRIC 3O70A 2ECJA 4ZUXU 1IYMA 2VNFA 2RSDA 2YQMA 1WEEA 3O35A 3ASLA 2PUYA 2E6RA 4LK9A 5LKZA 3U5PA 3HCSA 1WEPA 2XB1A 3O36A 2AN6A 3FL2A 5FEYA 1Z60A 2YURA 5D1LB 4AUQB 3PUQA 2MD7B 4N4FA 5DINA 5C13A 4CA1A 3N9NA 1U6GB 2KGGA 3PHDA 4L58A 1MM3A 1WEUA 3C5KA 4I7CA 4UP0A 5H1VA 4BBQA 4B86C 2DX8A 1CHCA 5TDWA 2KREA 1WE9A 2JMIA 2M1RA 3ZPV1 3HCUA 1RMDA 2CT2A 2L75A 4LADB 1VYXA 1WFKA 2ECVA 4WZ2A 2LDRA 2MUMA 1WILA 2FSAA 2VPGA 3KV6A 5I3LA 2LQ6A 4GNDA 5B79A 5LKXA 4YBMA 2VJEA 3L11A 1WEMA 4I7BA 2LGVA 4WZ0A 2M85A 4YABA 2C2VS 4PPEA 4AYCB 1MM2A 4QF2A 3KNVA 1VFYA 2YHNA 4GNGA 2KWJA 1FBVA 2KU3A 2YW8A 3U5OA 3L1ZB 2E6SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VJE B;  3T7L A;  2K1J A;  1Z6U A;  2LGG A;  2IDA A;  2JMD A;  3ZVY A;  4W4U A;  1WES A;  2JMJ A;  5G04 B;  3M99 A;  1VD4 A;  3ZYQ A;  3L1X A;  4XI1 A;  2ECW A;  4P5O B;  4WZ3 B;  2XEU A;  2F6N A;  2KGI A;  2LN0 A;  1WEW A;  2VPB A;  3GV4 A;  5B77 A;  2YYR A;  2RI7 A;  2F42 A;  2LGL A;  3HTK C;  5LKT A;  3RPG C;  4MSX A;  2EA6 A;  4NN2 A;  1WEO A;  2LXP C;  4A49 A;  4TKP B;  2KWN A;  4A0C D;  1K2F A;  3LRQ A;  2KFT A;  2YU4 A;  3N9L A;  4ZDT A;  3M63 A;  1WEV A;  4YBS A;  5D1M B;  2YT5 A;  4GNF A;  2Y1N A;  3PUR A;  2MT5 A;  5DKA A;  4X3G A;  1HYJ A;  3I2D A;  2LGK A;  5AIU A;  5FB1 A;  3C6W A;  2QIZ A;  5KH9 A;  5FB0 A;  3LQI A;  3U5M A;  2MA6 A;  1N87 A;  4AYC A;  4I7D A;  1G25 A;  1ZBD B;  4V3K C;  2YUC A;  4LJN A;  4B7Y C;  3RTR B;  1HYI A;  1LDJ B;  1JM7 A;  4Q6F A;  4S3O C;  4FJC A;  4N3W A;  2MA5 A;  4A4C A;  2MNZ A;  4GB0 A;  2Y43 A;  2LXH C;  2YRE A;  4IC3 A;  3VK6 A;  2K16 A;  2LV9 A;  2EGP A;  2F6J A;  4ZQL A;  4FO9 A;  3ZNI A;  2HDP A;  4QF3 A;  2ECT A;  4IC2 A;  4L7X A;  3ZTG A;  1LDK C;  5TDR A;  1JM7 B;  4YBT A;  3MHH A;  2KIZ A;  3SHB A;  5FER A;  2KYU A;  3SOU A;  2EOD A;  5J3X A;  4PTB A;  3SOW A;  2UZG A;  2MNY A;  5LCW B;  4R2Y A;  5H9M A;  1V87 A;  4LLB A;  3N9M A;  3HCT A;  1E4U A;  3DPL R;  3O33 A;  5LKU A;  2H0D A;  5H1U A;  5EYA F;  2M6M A;  2VPD A;  2G6Q A;  5G05 B;  2CKL A;  2VJF B;  4AVX A;  5G0F A;  4CCG X;  5TRB A;  3EB6 A;  1X4U A;  2FUU A;  1T1H A;  4LKA A;  4O64 A;  2PNX A;  3LQJ A;  2I50 A;  4R7E A;  3NG2 A;  4UP5 A;  5C11 A;  2OXQ C;  3MHS A;  3O37 A;  1F62 A;  2H0D B;  3U5N A;  3IHP A;  5TBN A;  2ECG A;  2NAA A;  4YAD A;  1WEQ A;  2K17 A;  5KH3 A;  3ZPV E;  5JG6 A;  2G45 A;  2YSM A;  1WIM A;  2CKL B;  4A4B A;  4MVT A;  2VPE A;  2KWK A;  2HYE D;  2KE1 A;  5B76 A;  5AIT A;  4WA6 A;  1WEN A;  1WGM A;  4FK5 A;  3RPG B;  2D8S A;  3GL6 A;  4R8P K;  2K4D A;  3T6R A;  3O7A A;  2L5U A;  2QJ0 A;  1X4I A;  4AP4 A;  5B8D A;  1XWH A;  2L0B A;  1DVP A;  2L80 A;  2KWO A;  3M62 A;  3N9Q A;  4F52 B;  2C2L A;  3DQV R;  2BAY A;  2VP7 A;  5H1T A;  2QIC A;  3EB5 A;  5KH7 A;  2CSZ A;  5B75 A;  2MD8 C;  5TAB A;  1X4J A;  1BOR A;  2YHO A;  4YAT A;  2YSJ A;  1JOC A;  2KR4 A;  3QZV A;  4YAX A;  3N9P A;  2G43 A;  2VJF A;  3N9O A;  2MIQ A;  4C9Z A;  1FP0 A;  1Z2Q A;  3KQI A;  2ZET C;  3LQH A;  4S3O B;  4FIP A;  4BHW A;  2YQL A;  3V43 A;  5B78 A;  4YC9 A;  3KV5 A;  5D1K B;  2ECI A;  2M3H A;  3ZVZ B;  2FUI A;  2CSY A;  2JRJ A;  2L43 A;  4GNE A;  3SOX A;  2ECN A;  2Y1M A;  4V3L C;  3O34 A;  4UI9 B;  2LRI C;  3O70 A;  2ECJ A;  4ZUX U;  1IYM A;  2VNF A;  2RSD A;  2YQM A;  1WEE A;  3O35 A;  3ASL A;  2PUY A;  2E6R A;  4LK9 A;  5LKZ A;  3U5P A;  3HCS A;  1WEP A;  2XB1 A;  3O36 A;  2AN6 A;  3FL2 A;  5FEY A;  1Z60 A;  2YUR A;  5D1L B;  4AUQ B;  3PUQ A;  2MD7 B;  4N4F A;  5DIN A;  5C13 A;  4CA1 A;  3N9N A;  1U6G B;  2KGG A;  3PHD A;  4L58 A;  1MM3 A;  1WEU A;  3C5K A;  4I7C A;  4UP0 A;  5H1V A;  4BBQ A;  4B86 C;  2DX8 A;  1CHC A;  5TDW A;  2KRE A;  1WE9 A;  2JMI A;  2M1R A;  3ZPV 1;  3HCU A;  1RMD A;  2CT2 A;  2L75 A;  4LAD B;  1VYX A;  1WFK A;  2ECV A;  4WZ2 A;  2LDR A;  2MUM A;  1WIL A;  2FSA A;  2VPG A;  3KV6 A;  5I3L A;  2LQ6 A;  4GND A;  5B79 A;  5LKX A;  4YBM A;  2VJE A;  3L11 A;  1WEM A;  4I7B A;  2LGV A;  4WZ0 A;  2M85 A;  4YAB A;  2C2V S;  4PPE A;  4AYC B;  1MM2 A;  4QF2 A;  3KNV A;  1VFY A;  2YHN A;  4GNG A;  2KWJ A;  1FBV A;  2KU3 A;  2YW8 A;  3U5O A;  3L1Z B;  2E6S A; 
#chains in the Genus database with same CATH topology
 2VJE B;  3T7L A;  2K1J A;  1Z6U A;  2DSM A;  2IDA A;  2JMD A;  2LGG A;  3ZVY A;  4W4U A;  1WES A;  2OWA A;  4OGC A;  2JMJ A;  5G04 B;  3M99 A;  1VD4 A;  3ZYQ A;  3L1X A;  4XI1 A;  2ECW A;  4P5O B;  4WZ3 B;  2XEU A;  2F6N A;  2KGI A;  3GV4 A;  1WEW A;  2LN0 A;  2VPB A;  5B77 A;  2YYR A;  2RI7 A;  2F42 A;  2LGL A;  4Z0R A;  3HTK C;  5LKT A;  3RPG C;  4MSX A;  2EA6 A;  4NN2 A;  2LAU A;  1WEO A;  2LXP C;  2E61 A;  4A49 A;  4TKP B;  2KWN A;  2XOY A;  4A0C D;  1K2F A;  3LRQ A;  2KFT A;  2YU4 A;  3N9L A;  4ZDT A;  3M63 A;  1WEV A;  4YBS A;  5D1M B;  2YT5 A;  4GNF A;  2Y1N A;  2JUN A;  3PUR A;  2MT5 A;  5DKA A;  4X3G A;  1HYJ A;  3I2D A;  2LGK A;  5AIU A;  5FB1 A;  3C6W A;  3DDT A;  2QIZ A;  5KH9 A;  5FB0 A;  3LQI A;  3U5M A;  2MA6 A;  1N87 A;  4AYC A;  3M7K A;  4I7D A;  1G25 A;  1ZBD B;  4V3K C;  2YUC A;  4LJN A;  4B7Y C;  2RR4 A;  3RTR B;  3JUE A;  1HYI A;  1LDJ B;  1JM7 A;  1MBM A;  4Q6F A;  4S3O C;  4FJC A;  4N3W A;  2MA5 A;  4A4C A;  2MNZ A;  2EXU A;  4GB0 A;  2Y43 A;  2LXH C;  2YRE A;  4IC3 A;  3VK6 A;  2K16 A;  2LV9 A;  2EGP A;  2F6J A;  4ZQL A;  4FO9 A;  3ZNI A;  2HDP A;  4QF3 A;  2ECT A;  4IC2 A;  4L7X A;  3ZTG A;  1LDK C;  5TDR A;  5SVY A;  1JM7 B;  4YBT A;  3MHH A;  2KIZ A;  5SVX A;  3SHB A;  5FER A;  2KYU A;  3FM8 C;  3SOU A;  2EOD A;  5J3X A;  2KKX A;  5K3Q A;  4PTB A;  3H7H A;  3E2D A;  3SOW A;  2UZG A;  2MNY A;  5LCW B;  4R2Y A;  5H9M A;  1V87 A;  4LLB A;  3N9M A;  3HCT A;  1E4U A;  3DPL R;  1DCQ A;  3O33 A;  5LKU A;  2H0D A;  5H1U A;  5EYA F;  4O62 A;  2CON A;  2IQJ A;  2M6M A;  2VPD A;  2G6Q A;  5G05 B;  2CKL A;  2VJF B;  3DWD A;  4AVX A;  5G0F A;  4H9D A;  4CCG X;  5TRB A;  3EB6 A;  1X4U A;  2FUU A;  1T1H A;  4LKA A;  4O64 A;  2PNX A;  2CRW A;  3LQJ A;  2I50 A;  4R7E A;  3NG2 A;  4UP5 A;  5C11 A;  2OXQ C;  3MHS A;  3O37 A;  1F62 A;  2H0D B;  3U5N A;  2XOC A;  3IHP A;  5TBN A;  2ECG A;  2NAA A;  4YAD A;  1WEQ A;  2K17 A;  5KH3 A;  3ZPV E;  5JG6 A;  4QQ4 A;  2G45 A;  2YSM A;  1WIM A;  2CKL B;  4A4B A;  4MVT A;  2VPE A;  3MDB C;  2KWK A;  2FD4 A;  2HYE D;  2KE1 A;  5B76 A;  5AIT A;  4WA6 A;  1WEN A;  1WGM A;  4FK5 A;  3RPG B;  2D8S A;  3GL6 A;  2P57 A;  2XOZ A;  4R8P K;  3SUB A;  2K4D A;  3T6R A;  3O7A A;  2L5U A;  2QJ0 A;  1X4I A;  4AP4 A;  5B8D A;  1XWH A;  2XP0 A;  5SVI A;  2L0B A;  1DVP A;  2L80 A;  2KWO A;  3M62 A;  4F1P A;  3N9Q A;  4F52 B;  2C2L A;  3DQV R;  2BAY A;  2VP7 A;  5H1T A;  2QIC A;  3LJU X;  3EB5 A;  5KH7 A;  2CSZ A;  5B75 A;  2MD8 C;  5TAB A;  1X4J A;  1BOR A;  2YHO A;  4YAT A;  2YSJ A;  1JOC A;  2KR4 A;  3QZV A;  4YAX A;  5SVI B;  3PLW A;  2MKE A;  3N9P A;  2G43 A;  2VJF A;  3N9O A;  2MIQ A;  4C9Z A;  1FP0 A;  1Z2Q A;  2KKY A;  3KQI A;  2ZET C;  3FEH A;  3LQH A;  4S3O B;  4FIP A;  4BHW A;  2YQL A;  2DJA A;  3V43 A;  5B78 A;  2FFW A;  4YC9 A;  3KV5 A;  5D1K B;  2ECI A;  2M3H A;  3ZVZ B;  2FUI A;  2CSY A;  2JRJ A;  2L43 A;  4GNE A;  3SOX A;  2ECN A;  2Y1M A;  4V3L C;  2M13 A;  3O34 A;  4UI9 B;  2LRI C;  3O70 A;  2ECJ A;  4ZUX U;  4Z0O A;  1IYM A;  2VNF A;  2RSD A;  2YQM A;  1WEE A;  3O35 A;  3ASL A;  2PUY A;  3LDY A;  2E6R A;  4LK9 A;  4OGE A;  5LKZ A;  3U5P A;  3HCS A;  1WEP A;  2YVR A;  2XB1 A;  3O36 A;  2AN6 A;  3FL2 A;  5FEY A;  1Z60 A;  2YUR A;  2CSV A;  5D1L B;  4AUQ B;  3PUQ A;  2MD7 B;  4N4F A;  5DIN A;  5C13 A;  4CA1 A;  3N9N A;  1U6G B;  2KGG A;  3PHD A;  4L58 A;  1MM3 A;  1WEU A;  3C5K A;  4I7C A;  4UP0 A;  5H1V A;  2JM3 A;  2B0O E;  4BBQ A;  4B86 C;  2EGM A;  2DX8 A;  1CHC A;  5TDW A;  2CRR A;  2KRE A;  1WE9 A;  2JMI A;  2M1R A;  3ZPV 1;  3HCU A;  3T9K A;  1RMD A;  2CT2 A;  2L75 A;  4LAD B;  1VYX A;  1WFK A;  2ECV A;  4WZ2 A;  2LDR A;  2MUM A;  1WIL A;  2FSA A;  2VPG A;  3FJU B;  3KV6 A;  5I3L A;  2LQ6 A;  4GND A;  3FAO A;  5B79 A;  5LKX A;  4YBM A;  2VJE A;  2D8U A;  1WEM A;  3L11 A;  4I7B A;  2LGV A;  3LVR E;  4WZ0 A;  3Q1D A;  2M85 A;  3KDE C;  4YAB A;  2C2V S;  3FAN A;  4PPE A;  4AYC B;  3LVQ E;  1MM2 A;  4QF2 A;  3KNV A;  1VFY A;  2L7P A;  2YHN A;  4GNG A;  2KWJ A;  1FBV A;  2KU3 A;  3O47 A;  2YW8 A;  3U5O A;  3L1Z B;  2E6S A; 
#chains in the Genus database with same CATH homology
 2VJE B;  3T7L A;  2K1J A;  1Z6U A;  2LGG A;  2IDA A;  2JMD A;  3ZVY A;  4W4U A;  1WES A;  2JMJ A;  5G04 B;  3M99 A;  1VD4 A;  3ZYQ A;  3L1X A;  4XI1 A;  2ECW A;  4P5O B;  4WZ3 B;  2XEU A;  2F6N A;  2KGI A;  2LN0 A;  1WEW A;  2VPB A;  3GV4 A;  5B77 A;  2YYR A;  2RI7 A;  2F42 A;  2LGL A;  3HTK C;  5LKT A;  3RPG C;  4MSX A;  2EA6 A;  4NN2 A;  1WEO A;  2LXP C;  4A49 A;  4TKP B;  2KWN A;  4A0C D;  1K2F A;  3LRQ A;  2KFT A;  2YU4 A;  3N9L A;  4ZDT A;  3M63 A;  1WEV A;  4YBS A;  5D1M B;  2YT5 A;  4GNF A;  2Y1N A;  3PUR A;  2MT5 A;  5DKA A;  4X3G A;  1HYJ A;  3I2D A;  2LGK A;  5AIU A;  5FB1 A;  3C6W A;  2QIZ A;  5KH9 A;  5FB0 A;  3LQI A;  3U5M A;  2MA6 A;  1N87 A;  4AYC A;  4I7D A;  1G25 A;  1ZBD B;  4V3K C;  2YUC A;  4LJN A;  4B7Y C;  3RTR B;  1HYI A;  1LDJ B;  1JM7 A;  4Q6F A;  4S3O C;  4FJC A;  4N3W A;  2MA5 A;  4A4C A;  2MNZ A;  4GB0 A;  2Y43 A;  2LXH C;  2YRE A;  4IC3 A;  3VK6 A;  2K16 A;  2LV9 A;  2EGP A;  2F6J A;  4ZQL A;  4FO9 A;  3ZNI A;  2HDP A;  4QF3 A;  2ECT A;  4IC2 A;  4L7X A;  3ZTG A;  1LDK C;  5TDR A;  1JM7 B;  4YBT A;  3MHH A;  2KIZ A;  3SHB A;  5FER A;  2KYU A;  3SOU A;  2EOD A;  5J3X A;  4PTB A;  3SOW A;  2UZG A;  2MNY A;  5LCW B;  4R2Y A;  5H9M A;  1V87 A;  4LLB A;  3N9M A;  3HCT A;  1E4U A;  3DPL R;  3O33 A;  5LKU A;  2H0D A;  5H1U A;  5EYA F;  2M6M A;  2VPD A;  2G6Q A;  5G05 B;  2CKL A;  2VJF B;  4AVX A;  5G0F A;  4CCG X;  5TRB A;  3EB6 A;  1X4U A;  2FUU A;  1T1H A;  4LKA A;  4O64 A;  2PNX A;  3LQJ A;  2I50 A;  4R7E A;  3NG2 A;  4UP5 A;  5C11 A;  2OXQ C;  3MHS A;  3O37 A;  1F62 A;  2H0D B;  3U5N A;  3IHP A;  5TBN A;  2ECG A;  2NAA A;  4YAD A;  1WEQ A;  2K17 A;  5KH3 A;  3ZPV E;  5JG6 A;  2G45 A;  2YSM A;  1WIM A;  2CKL B;  4A4B A;  4MVT A;  2VPE A;  2KWK A;  2HYE D;  2KE1 A;  5B76 A;  5AIT A;  4WA6 A;  1WEN A;  1WGM A;  4FK5 A;  3RPG B;  2D8S A;  3GL6 A;  4R8P K;  2K4D A;  3T6R A;  3O7A A;  2L5U A;  2QJ0 A;  1X4I A;  4AP4 A;  5B8D A;  1XWH A;  2L0B A;  1DVP A;  2L80 A;  2KWO A;  3M62 A;  3N9Q A;  4F52 B;  2C2L A;  3DQV R;  2BAY A;  2VP7 A;  5H1T A;  2QIC A;  3EB5 A;  5KH7 A;  2CSZ A;  5B75 A;  2MD8 C;  5TAB A;  1X4J A;  1BOR A;  2YHO A;  4YAT A;  2YSJ A;  1JOC A;  2KR4 A;  3QZV A;  4YAX A;  3N9P A;  2G43 A;  2VJF A;  3N9O A;  2MIQ A;  4C9Z A;  1FP0 A;  1Z2Q A;  3KQI A;  2ZET C;  3LQH A;  4S3O B;  4FIP A;  4BHW A;  2YQL A;  3V43 A;  5B78 A;  4YC9 A;  3KV5 A;  5D1K B;  2ECI A;  2M3H A;  3ZVZ B;  2FUI A;  2CSY A;  2JRJ A;  2L43 A;  4GNE A;  3SOX A;  2ECN A;  2Y1M A;  4V3L C;  3O34 A;  4UI9 B;  2LRI C;  3O70 A;  2ECJ A;  4ZUX U;  1IYM A;  2VNF A;  2RSD A;  2YQM A;  1WEE A;  3O35 A;  3ASL A;  2PUY A;  2E6R A;  4LK9 A;  5LKZ A;  3U5P A;  3HCS A;  1WEP A;  2XB1 A;  3O36 A;  2AN6 A;  3FL2 A;  5FEY A;  1Z60 A;  2YUR A;  5D1L B;  4AUQ B;  3PUQ A;  2MD7 B;  4N4F A;  5DIN A;  5C13 A;  4CA1 A;  3N9N A;  1U6G B;  2KGG A;  3PHD A;  4L58 A;  1MM3 A;  1WEU A;  3C5K A;  4I7C A;  4UP0 A;  5H1V A;  4BBQ A;  4B86 C;  2DX8 A;  1CHC A;  5TDW A;  2KRE A;  1WE9 A;  2JMI A;  2M1R A;  3ZPV 1;  3HCU A;  1RMD A;  2CT2 A;  2L75 A;  4LAD B;  1VYX A;  1WFK A;  2ECV A;  4WZ2 A;  2LDR A;  2MUM A;  1WIL A;  2FSA A;  2VPG A;  3KV6 A;  5I3L A;  2LQ6 A;  4GND A;  5B79 A;  5LKX A;  4YBM A;  2VJE A;  3L11 A;  1WEM A;  4I7B A;  2LGV A;  4WZ0 A;  2M85 A;  4YAB A;  2C2V S;  4PPE A;  4AYC B;  1MM2 A;  4QF2 A;  3KNV A;  1VFY A;  2YHN A;  4GNG A;  2KWJ A;  1FBV A;  2KU3 A;  2YW8 A;  3U5O A;  3L1Z B;  2E6S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...