2ECGA

Solution structure of the ring domain of the baculoviral iap repeat-containing protein 4 from homo sapiens
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
75
structure length
75
Chain Sequence
GSSGSSGSLQKEISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDKCPMCYTVITFKQKIFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the ring domain of the Baculoviral IAP repeat-containing protein 4 from Homo sapiens
rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords Baculoviral IAP repeat-containing protein 4
total genus 6
structure length 75
sequence length 75
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2007-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2ecgA00
3KV5A 1Z2QA 4UP5A 3U5MA 3M63A 4PTBA 5B78A 2M6MA 2DX8A 3KV6A 4AVXA 5D1LB 1WEWA 2VJFB 2KWNA 2LGVA 2ECVA 3ZNIA 1T1HA 4YADA 5D1KB 2MA6A 3N9OA 2MNYA 2F6JA 2CSYA 3O33A 4XI1A 2CKLB 2LRIC 4LKAA 1Z60A 5DKAA 2M85A 1FBVA 2QJ0A 1WIMA 2HDPA 4CCGX 5B8DA 5G05B 1WE9A 2YREA 3L1ZB 1WEQA 4GNDA 3HCSA 3ZPVE 2G6QA 3EB5A 2KGIA 2F6NA 5LKXA 3MHHA 2KYUA 3T7LA 3VK6A 3PURA 3DQVR 4I7BA 2FSAA 2UZGA 2YYRA 4ZQLA 1F62A 4B7YC 5FEYA 4WZ2A 3EB6A 2ECGA 3LQHA 5TABA 2VJEA 2G43A 2QICA 2CKLA 1LDJB 3ZVYA 4TKPB 2MA5A 4AYCA 2E6RA 4UP0A 2VJFA 4YBTA 2YW8A 4WZ0A 2MD8C 2YQLA 2OXQC 4R7EA 1BORA 3PHDA 2YU4A 4IC3A 2LV9A 1MM3A 3RPGC 3RPGB 2VP7A 5LKTA 2PNXA 2JMDA 2KE1A 4A4BA 1WGMA 5C13A 2ECIA 4R8PK 4FJCA 2NAAA 3DPLR 5B76A 4A49A 2EA6A 1VYXA 1V87A 2VJEB 5FB1A 1WEEA 2YURA 5I3LA 2CSZA 3I2DA 2L0BA 3SHBA 2XEUA 2PUYA 4S3OB 1WENA 2VPGA 4GNEA 3U5NA 5H1TA 2K1JA 4AYCB 3C5KA 3ZTGA 3ZYQA 2M1RA 2YSJA 4ZUXU 1LDKC 2Y43A 1N87A 2Y1NA 5AIUA 3U5PA 2MUMA 4AUQB 2MIQA 4LK9A 4MVTA 2L80A 2MT5A 2K17A 3LRQA 4LJNA 5TRBA 2KWOA 5H1VA 4LADB 3KQIA 4YBMA 2Y1MA 1WEOA 4NN2A 2K4DA 3IHPA 4Q6FA 2C2LA 4AP4A 2VPDA 5H9MA 4X3GA 4C9ZA 2LQ6A 4FK5A 5TBNA 2VNFA 5FERA 5KH9A 1WEVA 5JG6A 5D1MB 5EYAF 2M3HA 1HYJA 3O7AA 1HYIA 1DVPA 2F42A 4GNFA 2I50A 2LDRA 4V3KC 3KNVA 2IDAA 1E4UA 3SOUA 1XWHA 1X4JA 2YSMA 2FUUA 2KGGA 3HCUA 1X4IA 2XB1A 1JM7B 3GV4A 4LLBA 3LQIA 2YHNA 2ZETC 4IC2A 5B75A 2VPEA 4WZ3B 1X4UA 2AN6A 1JOCA 5KH7A 4R2YA 2EGPA 3O34A 2L43A 4S3OC 3ASLA 3N9LA 2H0DB 4QF2A 2YHOA 2C2VS 3U5OA 3L1XA 3O35A 3L11A 3ZVZB 5TDRA 2L5UA 5FB0A 1FP0A 5G04B 1WESA 5DINA 1WEUA 3FL2A 4O64A 4GNGA 5B79A 5LKUA 1WEMA 2LXHC 1WFKA 2FUIA 2VPBA 2JMIA 1RMDA 1MM2A 4I7CA 5H1UA 4BHWA 3HCTA 2LGKA 3O70A 4WA6A 4ZDTA 2KIZA 2JRJA 5TDWA 2K16A 2ECWA 3N9QA 3HTKC 4L7XA 2YQMA 1IYMA 1G25A 1K2FA 4L58A 1CHCA 4UI9B 4PPEA 4YBSA 3QZVA 4N4FA 2CT2A 4B86C 3C6WA 4GB0A 2E6SA 2BAYA 5C11A 4FIPA 3N9NA 3M62A 3N9PA 2YT5A 3SOWA 3O37A 4YATA 4MSXA 2D8SA 2ECJA 2LGLA 2KWKA 2JMJA 4V3LC 1VD4A 2LGGA 3LQJA 3M99A 4A0CD 5LCWB 5G0FA 4P5OB 2HYED 1WILA 3N9MA 1U6GB 2MNZA 4YC9A 2KU3A 2KREA 2L75A 1WEPA 5B77A 3RTRB 1VFYA 2QIZA 4YAXA 3MHSA 5KH3A 5LKZA 1ZBDB 2RSDA 2ECNA 3PUQA 4CA1A 2KFTA 2LXPC 3V43A 3O36A 2KR4A 4FO9A 4A4CA 1JM7A 4YABA 3T6RA 3NG2A 1Z6UA 2RI7A 4QF3A 4F52B 2YUCA 4I7DA 2G45A 2KWJA 3SOXA 3ZPV1 2EODA 2ECTA 3GL6A 4W4UA 2H0DA 4N3WA 2MD7B 4BBQA 5AITA 5J3XA 2LN0A
chains in the Genus database with same CATH superfamily
3KV5A 1Z2QA 3U5MA 4UP5A 3M63A 4PTBA 5B78A 2M6MA 2DX8A 3KV6A 2E61A 4AVXA 5D1LB 1WEWA 2VJFB 2XOYA 2KWNA 2LGVA 2ECVA 3ZNIA 1T1HA 4YADA 5D1KB 2MA6A 3N9OA 2MNYA 2F6JA 2CSYA 3O33A 2L7PA 4XI1A 2CKLB 2LRIC 4LKAA 1Z60A 5DKAA 2M85A 1FBVA 2QJ0A 1WIMA 2HDPA 4CCGX 5B8DA 2MKEA 5G05B 1WE9A 3FJUB 2YREA 3L1ZB 1WEQA 4GNDA 3HCSA 2LAUA 3ZPVE 2G6QA 3EB5A 2KGIA 2F6NA 5LKXA 3MHHA 2KYUA 3T7LA 3VK6A 3PURA 3DQVR 4I7BA 2FSAA 2UZGA 2YYRA 4ZQLA 1F62A 4B7YC 5FEYA 4WZ2A 3EB6A 2ECGA 3LQHA 5TABA 2VJEA 2QICA 2G43A 2M13A 2CKLA 3O47A 1LDJB 3ZVYA 2CONA 4TKPB 4QQ4A 2JM3A 2MA5A 4AYCA 2E6RA 4UP0A 2P57A 2VJFA 4YBTA 5SVIA 2YW8A 4WZ0A 2MD8C 2YQLA 2OXQC 3LDYA 4R7EA 1BORA 3PHDA 2YU4A 4IC3A 2LV9A 1MM3A 2JUNA 3RPGC 3RPGB 2VP7A 3FEHA 5LKTA 2PNXA 2JMDA 2KE1A 5SVIB 4A4BA 1WGMA 5SVYA 5C13A 2ECIA 4R8PK 4FJCA 2NAAA 3DPLR 5B76A 4A49A 5SVXA 2EA6A 1VYXA 1V87A 2VJEB 5FB1A 2XP0A 1WEEA 2YURA 5I3LA 2CSZA 3I2DA 2L0BA 3SHBA 2XEUA 2PUYA 4S3OB 1WENA 2VPGA 4GNEA 3U5NA 5H1TA 2K1JA 4AYCB 3C5KA 3ZTGA 3ZYQA 2M1RA 3PLWA 2YSJA 4ZUXU 1LDKC 2KKYA 2Y43A 1N87A 2Y1NA 5AIUA 3U5PA 3LVQE 2MUMA 4AUQB 2MIQA 4LK9A 4MVTA 2L80A 2CRWA 2MT5A 2K17A 3LRQA 2EXUA 4LJNA 5TRBA 2KWOA 3T9KA 5H1VA 4LADB 3KQIA 4YBMA 3DWDA 2Y1MA 1WEOA 4NN2A 2K4DA 3IHPA 4Q6FA 2C2LA 4AP4A 2VPDA 2RR4A 5H9MA 4X3GA 4C9ZA 3KDEC 2LQ6A 4FK5A 5TBNA 2VNFA 5FERA 1WEVA 5KH9A 5JG6A 5D1MB 5EYAF 2M3HA 1DCQA 1HYJA 3O7AA 1HYIA 1DVPA 2F42A 4GNFA 2I50A 2LDRA 4V3KC 3KNVA 2IDAA 1E4UA 2KKXA 3SOUA 1XWHA 3LJUX 1X4JA 2YSMA 2FUUA 2KGGA 3HCUA 1X4IA 2XB1A 1JM7B 3GV4A 4LLBA 3LQIA 2YHNA 2ZETC 4IC2A 5B75A 2VPEA 4WZ3B 1X4UA 4Z0RA 2AN6A 1JOCA 5KH7A 4OGEA 4R2YA 2EGPA 3O34A 2L43A 4S3OC 3ASLA 3N9LA 2H0DB 4QF2A 2YHOA 2B0OE 2C2VS 3U5OA 3L1XA 3O35A 2DSMA 3L11A 3ZVZB 5TDRA 2L5UA 5FB0A 1FP0A 2FD4A 5G04B 1WESA 3MDBC 5DINA 1WEUA 3FL2A 4O64A 4GNGA 4OGCA 5B79A 5LKUA 1WEMA 3LVRE 2IQJA 3H7HA 2LXHC 1WFKA 2FUIA 2VPBA 2JMIA 2D8UA 1RMDA 1MM2A 4I7CA 5H1UA 4BHWA 3HCTA 2LGKA 3O70A 4WA6A 4ZDTA 2KIZA 2JRJA 5TDWA 2K16A 2ECWA 3N9QA 3HTKC 4L7XA 4F1PA 2YQMA 1IYMA 2YVRA 1G25A 1K2FA 4L58A 1CHCA 4UI9B 4PPEA 4YBSA 3QZVA 4N4FA 2CT2A 4B86C 3C6WA 2EGMA 4GB0A 2E6SA 2BAYA 5C11A 4FIPA 3N9NA 3M62A 3FANA 3N9PA 2YT5A 2XOZA 3SOWA 3O37A 4YATA 4MSXA 2FFWA 2D8SA 2ECJA 2LGLA 2KWKA 2JMJA 4V3LC 1VD4A 2LGGA 3LQJA 3M99A 4A0CD 5LCWB 5G0FA 4P5OB 2HYED 1WILA 4H9DA 3N9MA 1U6GB 2MNZA 2XOCA 4YC9A 2KU3A 3FM8C 2KREA 2L75A 1WEPA 5B77A 3RTRB 1VFYA 2QIZA 4YAXA 3MHSA 5KH3A 5LKZA 1ZBDB 2RSDA 2ECNA 1MBMA 2CRRA 3PUQA 4CA1A 3FAOA 2KFTA 2LXPC 3V43A 3O36A 2KR4A 4FO9A 4A4CA 1JM7A 4YABA 3T6RA 3NG2A 1Z6UA 2RI7A 3DDTA 4QF3A 4F52B 2YUCA 2OWAA 4I7DA 2G45A 2KWJA 3SOXA 3M7KA 3ZPV1 2EODA 4Z0OA 2ECTA 3GL6A 4W4UA 3Q1DA 4O62A 2H0DA 4N3WA 3SUBA 2MD7B 2CSVA 4BBQA 5AITA 5K3QA 2DJAA 3E2DA 3JUEA 5J3XA 2LN0A
chains in the Genus database with same CATH topology
3KV5A 1Z2QA 4UP5A 3U5MA 3M63A 4PTBA 5B78A 2M6MA 2DX8A 3KV6A 4AVXA 5D1LB 1WEWA 2VJFB 2KWNA 2LGVA 2ECVA 3ZNIA 1T1HA 4YADA 5D1KB 2MA6A 3N9OA 2MNYA 2F6JA 2CSYA 3O33A 4XI1A 2CKLB 2LRIC 4LKAA 1Z60A 5DKAA 2M85A 1FBVA 2QJ0A 1WIMA 2HDPA 4CCGX 5B8DA 5G05B 1WE9A 2YREA 3L1ZB 1WEQA 4GNDA 3HCSA 3ZPVE 2G6QA 3EB5A 2KGIA 2F6NA 5LKXA 3MHHA 2KYUA 3T7LA 3VK6A 3PURA 3DQVR 4I7BA 2FSAA 2UZGA 2YYRA 4ZQLA 1F62A 4B7YC 5FEYA 4WZ2A 3EB6A 2ECGA 3LQHA 5TABA 2VJEA 2G43A 2QICA 2CKLA 1LDJB 3ZVYA 4TKPB 2MA5A 4AYCA 2E6RA 4UP0A 2VJFA 4YBTA 2YW8A 4WZ0A 2MD8C 2YQLA 2OXQC 4R7EA 1BORA 3PHDA 2YU4A 4IC3A 2LV9A 1MM3A 3RPGC 3RPGB 2VP7A 5LKTA 2PNXA 2JMDA 2KE1A 4A4BA 1WGMA 5C13A 2ECIA 4R8PK 4FJCA 2NAAA 3DPLR 5B76A 4A49A 2EA6A 1VYXA 1V87A 2VJEB 5FB1A 1WEEA 2YURA 5I3LA 2CSZA 3I2DA 2L0BA 3SHBA 2XEUA 2PUYA 4S3OB 1WENA 2VPGA 4GNEA 3U5NA 5H1TA 2K1JA 4AYCB 3C5KA 3ZTGA 3ZYQA 2M1RA 2YSJA 4ZUXU 1LDKC 2Y43A 1N87A 2Y1NA 5AIUA 3U5PA 2MUMA 4AUQB 2MIQA 4LK9A 4MVTA 2L80A 2MT5A 2K17A 3LRQA 4LJNA 5TRBA 2KWOA 5H1VA 4LADB 3KQIA 4YBMA 2Y1MA 1WEOA 4NN2A 2K4DA 3IHPA 4Q6FA 2C2LA 4AP4A 2VPDA 5H9MA 4X3GA 4C9ZA 2LQ6A 4FK5A 5TBNA 2VNFA 5FERA 5KH9A 1WEVA 5JG6A 5D1MB 5EYAF 2M3HA 1HYJA 3O7AA 1HYIA 1DVPA 2F42A 4GNFA 2I50A 2LDRA 4V3KC 3KNVA 2IDAA 1E4UA 3SOUA 1XWHA 1X4JA 2YSMA 2FUUA 2KGGA 3HCUA 1X4IA 2XB1A 1JM7B 3GV4A 4LLBA 3LQIA 2YHNA 2ZETC 4IC2A 5B75A 2VPEA 4WZ3B 1X4UA 2AN6A 1JOCA 5KH7A 4R2YA 2EGPA 3O34A 2L43A 4S3OC 3ASLA 3N9LA 2H0DB 4QF2A 2YHOA 2C2VS 3U5OA 3L1XA 3O35A 3L11A 3ZVZB 5TDRA 2L5UA 5FB0A 1FP0A 5G04B 1WESA 5DINA 1WEUA 3FL2A 4O64A 4GNGA 5B79A 5LKUA 1WEMA 2LXHC 1WFKA 2FUIA 2VPBA 2JMIA 1RMDA 1MM2A 4I7CA 5H1UA 4BHWA 3HCTA 2LGKA 3O70A 4WA6A 4ZDTA 2KIZA 2JRJA 5TDWA 2K16A 2ECWA 3N9QA 3HTKC 4L7XA 2YQMA 1IYMA 1G25A 1K2FA 4L58A 1CHCA 4UI9B 4PPEA 4YBSA 3QZVA 4N4FA 2CT2A 4B86C 3C6WA 4GB0A 2E6SA 2BAYA 5C11A 4FIPA 3N9NA 3M62A 3N9PA 2YT5A 3SOWA 3O37A 4YATA 4MSXA 2D8SA 2ECJA 2LGLA 2KWKA 2JMJA 4V3LC 1VD4A 2LGGA 3LQJA 3M99A 4A0CD 5LCWB 5G0FA 4P5OB 2HYED 1WILA 3N9MA 1U6GB 2MNZA 4YC9A 2KU3A 2KREA 2L75A 1WEPA 5B77A 3RTRB 1VFYA 2QIZA 4YAXA 3MHSA 5KH3A 5LKZA 1ZBDB 2RSDA 2ECNA 3PUQA 4CA1A 2KFTA 2LXPC 3V43A 3O36A 2KR4A 4FO9A 4A4CA 1JM7A 4YABA 3T6RA 3NG2A 1Z6UA 2RI7A 4QF3A 4F52B 2YUCA 4I7DA 2G45A 2KWJA 3SOXA 3ZPV1 2EODA 2ECTA 3GL6A 4W4UA 2H0DA 4N3WA 2MD7B 4BBQA 5AITA 5J3XA 2LN0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KV5 A;  1Z2Q A;  4UP5 A;  3U5M A;  3M63 A;  4PTB A;  5B78 A;  2M6M A;  2DX8 A;  3KV6 A;  4AVX A;  5D1L B;  1WEW A;  2VJF B;  2KWN A;  2LGV A;  2ECV A;  3ZNI A;  1T1H A;  4YAD A;  5D1K B;  2MA6 A;  3N9O A;  2MNY A;  2F6J A;  2CSY A;  3O33 A;  4XI1 A;  2CKL B;  2LRI C;  4LKA A;  1Z60 A;  5DKA A;  2M85 A;  1FBV A;  2QJ0 A;  1WIM A;  2HDP A;  4CCG X;  5B8D A;  5G05 B;  1WE9 A;  2YRE A;  3L1Z B;  1WEQ A;  4GND A;  3HCS A;  3ZPV E;  2G6Q A;  3EB5 A;  2KGI A;  2F6N A;  5LKX A;  3MHH A;  2KYU A;  3T7L A;  3VK6 A;  3PUR A;  3DQV R;  4I7B A;  2FSA A;  2UZG A;  2YYR A;  4ZQL A;  1F62 A;  4B7Y C;  5FEY A;  4WZ2 A;  3EB6 A;  2ECG A;  3LQH A;  5TAB A;  2VJE A;  2G43 A;  2QIC A;  2CKL A;  1LDJ B;  3ZVY A;  4TKP B;  2MA5 A;  4AYC A;  2E6R A;  4UP0 A;  2VJF A;  4YBT A;  2YW8 A;  4WZ0 A;  2MD8 C;  2YQL A;  2OXQ C;  4R7E A;  1BOR A;  3PHD A;  2YU4 A;  4IC3 A;  2LV9 A;  1MM3 A;  3RPG C;  3RPG B;  2VP7 A;  5LKT A;  2PNX A;  2JMD A;  2KE1 A;  4A4B A;  1WGM A;  5C13 A;  2ECI A;  4R8P K;  4FJC A;  2NAA A;  3DPL R;  5B76 A;  4A49 A;  2EA6 A;  1VYX A;  1V87 A;  2VJE B;  5FB1 A;  1WEE A;  2YUR A;  5I3L A;  2CSZ A;  3I2D A;  2L0B A;  3SHB A;  2XEU A;  2PUY A;  4S3O B;  1WEN A;  2VPG A;  4GNE A;  3U5N A;  5H1T A;  2K1J A;  4AYC B;  3C5K A;  3ZTG A;  3ZYQ A;  2M1R A;  2YSJ A;  4ZUX U;  1LDK C;  2Y43 A;  1N87 A;  2Y1N A;  5AIU A;  3U5P A;  2MUM A;  4AUQ B;  2MIQ A;  4LK9 A;  4MVT A;  2L80 A;  2MT5 A;  2K17 A;  3LRQ A;  4LJN A;  5TRB A;  2KWO A;  5H1V A;  4LAD B;  3KQI A;  4YBM A;  2Y1M A;  1WEO A;  4NN2 A;  2K4D A;  3IHP A;  4Q6F A;  2C2L A;  4AP4 A;  2VPD A;  5H9M A;  4X3G A;  4C9Z A;  2LQ6 A;  4FK5 A;  5TBN A;  2VNF A;  5FER A;  5KH9 A;  1WEV A;  5JG6 A;  5D1M B;  5EYA F;  2M3H A;  1HYJ A;  3O7A A;  1HYI A;  1DVP A;  2F42 A;  4GNF A;  2I50 A;  2LDR A;  4V3K C;  3KNV A;  2IDA A;  1E4U A;  3SOU A;  1XWH A;  1X4J A;  2YSM A;  2FUU A;  2KGG A;  3HCU A;  1X4I A;  2XB1 A;  1JM7 B;  3GV4 A;  4LLB A;  3LQI A;  2YHN A;  2ZET C;  4IC2 A;  5B75 A;  2VPE A;  4WZ3 B;  1X4U A;  2AN6 A;  1JOC A;  5KH7 A;  4R2Y A;  2EGP A;  3O34 A;  2L43 A;  4S3O C;  3ASL A;  3N9L A;  2H0D B;  4QF2 A;  2YHO A;  2C2V S;  3U5O A;  3L1X A;  3O35 A;  3L11 A;  3ZVZ B;  5TDR A;  2L5U A;  5FB0 A;  1FP0 A;  5G04 B;  1WES A;  5DIN A;  1WEU A;  3FL2 A;  4O64 A;  4GNG A;  5B79 A;  5LKU A;  1WEM A;  2LXH C;  1WFK A;  2FUI A;  2VPB A;  2JMI A;  1RMD A;  1MM2 A;  4I7C A;  5H1U A;  4BHW A;  3HCT A;  2LGK A;  3O70 A;  4WA6 A;  4ZDT A;  2KIZ A;  2JRJ A;  5TDW A;  2K16 A;  2ECW A;  3N9Q A;  3HTK C;  4L7X A;  2YQM A;  1IYM A;  1G25 A;  1K2F A;  4L58 A;  1CHC A;  4UI9 B;  4PPE A;  4YBS A;  3QZV A;  4N4F A;  2CT2 A;  4B86 C;  3C6W A;  4GB0 A;  2E6S A;  2BAY A;  5C11 A;  4FIP A;  3N9N A;  3M62 A;  3N9P A;  2YT5 A;  3SOW A;  3O37 A;  4YAT A;  4MSX A;  2D8S A;  2ECJ A;  2LGL A;  2KWK A;  2JMJ A;  4V3L C;  1VD4 A;  2LGG A;  3LQJ A;  3M99 A;  4A0C D;  5LCW B;  5G0F A;  4P5O B;  2HYE D;  1WIL A;  3N9M A;  1U6G B;  2MNZ A;  4YC9 A;  2KU3 A;  2KRE A;  2L75 A;  1WEP A;  5B77 A;  3RTR B;  1VFY A;  2QIZ A;  4YAX A;  3MHS A;  5KH3 A;  5LKZ A;  1ZBD B;  2RSD A;  2ECN A;  3PUQ A;  4CA1 A;  2KFT A;  2LXP C;  3V43 A;  3O36 A;  2KR4 A;  4FO9 A;  4A4C A;  1JM7 A;  4YAB A;  3T6R A;  3NG2 A;  1Z6U A;  2RI7 A;  4QF3 A;  4F52 B;  2YUC A;  4I7D A;  2G45 A;  2KWJ A;  3SOX A;  3ZPV 1;  2EOD A;  2ECT A;  3GL6 A;  4W4U A;  2H0D A;  4N3W A;  2MD7 B;  4BBQ A;  5AIT A;  5J3X A;  2LN0 A; 
#chains in the Genus database with same CATH topology
 3KV5 A;  1Z2Q A;  3U5M A;  4UP5 A;  3M63 A;  4PTB A;  5B78 A;  2M6M A;  2DX8 A;  3KV6 A;  2E61 A;  4AVX A;  5D1L B;  1WEW A;  2VJF B;  2XOY A;  2KWN A;  2LGV A;  2ECV A;  3ZNI A;  1T1H A;  4YAD A;  5D1K B;  2MA6 A;  3N9O A;  2MNY A;  2F6J A;  2CSY A;  3O33 A;  2L7P A;  4XI1 A;  2CKL B;  2LRI C;  4LKA A;  1Z60 A;  5DKA A;  2M85 A;  1FBV A;  2QJ0 A;  1WIM A;  2HDP A;  4CCG X;  5B8D A;  2MKE A;  5G05 B;  1WE9 A;  3FJU B;  2YRE A;  3L1Z B;  1WEQ A;  4GND A;  3HCS A;  2LAU A;  3ZPV E;  2G6Q A;  3EB5 A;  2KGI A;  2F6N A;  5LKX A;  3MHH A;  2KYU A;  3T7L A;  3VK6 A;  3PUR A;  3DQV R;  4I7B A;  2FSA A;  2UZG A;  2YYR A;  4ZQL A;  1F62 A;  4B7Y C;  5FEY A;  4WZ2 A;  3EB6 A;  2ECG A;  3LQH A;  5TAB A;  2VJE A;  2QIC A;  2G43 A;  2M13 A;  2CKL A;  3O47 A;  1LDJ B;  3ZVY A;  2CON A;  4TKP B;  4QQ4 A;  2JM3 A;  2MA5 A;  4AYC A;  2E6R A;  4UP0 A;  2P57 A;  2VJF A;  4YBT A;  5SVI A;  2YW8 A;  4WZ0 A;  2MD8 C;  2YQL A;  2OXQ C;  3LDY A;  4R7E A;  1BOR A;  3PHD A;  2YU4 A;  4IC3 A;  2LV9 A;  1MM3 A;  2JUN A;  3RPG C;  3RPG B;  2VP7 A;  3FEH A;  5LKT A;  2PNX A;  2JMD A;  2KE1 A;  5SVI B;  4A4B A;  1WGM A;  5SVY A;  5C13 A;  2ECI A;  4R8P K;  4FJC A;  2NAA A;  3DPL R;  5B76 A;  4A49 A;  5SVX A;  2EA6 A;  1VYX A;  1V87 A;  2VJE B;  5FB1 A;  2XP0 A;  1WEE A;  2YUR A;  5I3L A;  2CSZ A;  3I2D A;  2L0B A;  3SHB A;  2XEU A;  2PUY A;  4S3O B;  1WEN A;  2VPG A;  4GNE A;  3U5N A;  5H1T A;  2K1J A;  4AYC B;  3C5K A;  3ZTG A;  3ZYQ A;  2M1R A;  3PLW A;  2YSJ A;  4ZUX U;  1LDK C;  2KKY A;  2Y43 A;  1N87 A;  2Y1N A;  5AIU A;  3U5P A;  3LVQ E;  2MUM A;  4AUQ B;  2MIQ A;  4LK9 A;  4MVT A;  2L80 A;  2CRW A;  2MT5 A;  2K17 A;  3LRQ A;  2EXU A;  4LJN A;  5TRB A;  2KWO A;  3T9K A;  5H1V A;  4LAD B;  3KQI A;  4YBM A;  3DWD A;  2Y1M A;  1WEO A;  4NN2 A;  2K4D A;  3IHP A;  4Q6F A;  2C2L A;  4AP4 A;  2VPD A;  2RR4 A;  5H9M A;  4X3G A;  4C9Z A;  3KDE C;  2LQ6 A;  4FK5 A;  5TBN A;  2VNF A;  5FER A;  1WEV A;  5KH9 A;  5JG6 A;  5D1M B;  5EYA F;  2M3H A;  1DCQ A;  1HYJ A;  3O7A A;  1HYI A;  1DVP A;  2F42 A;  4GNF A;  2I50 A;  2LDR A;  4V3K C;  3KNV A;  2IDA A;  1E4U A;  2KKX A;  3SOU A;  1XWH A;  3LJU X;  1X4J A;  2YSM A;  2FUU A;  2KGG A;  3HCU A;  1X4I A;  2XB1 A;  1JM7 B;  3GV4 A;  4LLB A;  3LQI A;  2YHN A;  2ZET C;  4IC2 A;  5B75 A;  2VPE A;  4WZ3 B;  1X4U A;  4Z0R A;  2AN6 A;  1JOC A;  5KH7 A;  4OGE A;  4R2Y A;  2EGP A;  3O34 A;  2L43 A;  4S3O C;  3ASL A;  3N9L A;  2H0D B;  4QF2 A;  2YHO A;  2B0O E;  2C2V S;  3U5O A;  3L1X A;  3O35 A;  2DSM A;  3L11 A;  3ZVZ B;  5TDR A;  2L5U A;  5FB0 A;  1FP0 A;  2FD4 A;  5G04 B;  1WES A;  3MDB C;  5DIN A;  1WEU A;  3FL2 A;  4O64 A;  4GNG A;  4OGC A;  5B79 A;  5LKU A;  1WEM A;  3LVR E;  2IQJ A;  3H7H A;  2LXH C;  1WFK A;  2FUI A;  2VPB A;  2JMI A;  2D8U A;  1RMD A;  1MM2 A;  4I7C A;  5H1U A;  4BHW A;  3HCT A;  2LGK A;  3O70 A;  4WA6 A;  4ZDT A;  2KIZ A;  2JRJ A;  5TDW A;  2K16 A;  2ECW A;  3N9Q A;  3HTK C;  4L7X A;  4F1P A;  2YQM A;  1IYM A;  2YVR A;  1G25 A;  1K2F A;  4L58 A;  1CHC A;  4UI9 B;  4PPE A;  4YBS A;  3QZV A;  4N4F A;  2CT2 A;  4B86 C;  3C6W A;  2EGM A;  4GB0 A;  2E6S A;  2BAY A;  5C11 A;  4FIP A;  3N9N A;  3M62 A;  3FAN A;  3N9P A;  2YT5 A;  2XOZ A;  3SOW A;  3O37 A;  4YAT A;  4MSX A;  2FFW A;  2D8S A;  2ECJ A;  2LGL A;  2KWK A;  2JMJ A;  4V3L C;  1VD4 A;  2LGG A;  3LQJ A;  3M99 A;  4A0C D;  5LCW B;  5G0F A;  4P5O B;  2HYE D;  1WIL A;  4H9D A;  3N9M A;  1U6G B;  2MNZ A;  2XOC A;  4YC9 A;  2KU3 A;  3FM8 C;  2KRE A;  2L75 A;  1WEP A;  5B77 A;  3RTR B;  1VFY A;  2QIZ A;  4YAX A;  3MHS A;  5KH3 A;  5LKZ A;  1ZBD B;  2RSD A;  2ECN A;  1MBM A;  2CRR A;  3PUQ A;  4CA1 A;  3FAO A;  2KFT A;  2LXP C;  3V43 A;  3O36 A;  2KR4 A;  4FO9 A;  4A4C A;  1JM7 A;  4YAB A;  3T6R A;  3NG2 A;  1Z6U A;  2RI7 A;  3DDT A;  4QF3 A;  4F52 B;  2YUC A;  2OWA A;  4I7D A;  2G45 A;  2KWJ A;  3SOX A;  3M7K A;  3ZPV 1;  2EOD A;  4Z0O A;  2ECT A;  3GL6 A;  4W4U A;  3Q1D A;  4O62 A;  2H0D A;  4N3W A;  3SUB A;  2MD7 B;  2CSV A;  4BBQ A;  5AIT A;  5K3Q A;  2DJA A;  3E2D A;  3JUE A;  5J3X A;  2LN0 A; 
#chains in the Genus database with same CATH homology
 3KV5 A;  1Z2Q A;  4UP5 A;  3U5M A;  3M63 A;  4PTB A;  5B78 A;  2M6M A;  2DX8 A;  3KV6 A;  4AVX A;  5D1L B;  1WEW A;  2VJF B;  2KWN A;  2LGV A;  2ECV A;  3ZNI A;  1T1H A;  4YAD A;  5D1K B;  2MA6 A;  3N9O A;  2MNY A;  2F6J A;  2CSY A;  3O33 A;  4XI1 A;  2CKL B;  2LRI C;  4LKA A;  1Z60 A;  5DKA A;  2M85 A;  1FBV A;  2QJ0 A;  1WIM A;  2HDP A;  4CCG X;  5B8D A;  5G05 B;  1WE9 A;  2YRE A;  3L1Z B;  1WEQ A;  4GND A;  3HCS A;  3ZPV E;  2G6Q A;  3EB5 A;  2KGI A;  2F6N A;  5LKX A;  3MHH A;  2KYU A;  3T7L A;  3VK6 A;  3PUR A;  3DQV R;  4I7B A;  2FSA A;  2UZG A;  2YYR A;  4ZQL A;  1F62 A;  4B7Y C;  5FEY A;  4WZ2 A;  3EB6 A;  2ECG A;  3LQH A;  5TAB A;  2VJE A;  2G43 A;  2QIC A;  2CKL A;  1LDJ B;  3ZVY A;  4TKP B;  2MA5 A;  4AYC A;  2E6R A;  4UP0 A;  2VJF A;  4YBT A;  2YW8 A;  4WZ0 A;  2MD8 C;  2YQL A;  2OXQ C;  4R7E A;  1BOR A;  3PHD A;  2YU4 A;  4IC3 A;  2LV9 A;  1MM3 A;  3RPG C;  3RPG B;  2VP7 A;  5LKT A;  2PNX A;  2JMD A;  2KE1 A;  4A4B A;  1WGM A;  5C13 A;  2ECI A;  4R8P K;  4FJC A;  2NAA A;  3DPL R;  5B76 A;  4A49 A;  2EA6 A;  1VYX A;  1V87 A;  2VJE B;  5FB1 A;  1WEE A;  2YUR A;  5I3L A;  2CSZ A;  3I2D A;  2L0B A;  3SHB A;  2XEU A;  2PUY A;  4S3O B;  1WEN A;  2VPG A;  4GNE A;  3U5N A;  5H1T A;  2K1J A;  4AYC B;  3C5K A;  3ZTG A;  3ZYQ A;  2M1R A;  2YSJ A;  4ZUX U;  1LDK C;  2Y43 A;  1N87 A;  2Y1N A;  5AIU A;  3U5P A;  2MUM A;  4AUQ B;  2MIQ A;  4LK9 A;  4MVT A;  2L80 A;  2MT5 A;  2K17 A;  3LRQ A;  4LJN A;  5TRB A;  2KWO A;  5H1V A;  4LAD B;  3KQI A;  4YBM A;  2Y1M A;  1WEO A;  4NN2 A;  2K4D A;  3IHP A;  4Q6F A;  2C2L A;  4AP4 A;  2VPD A;  5H9M A;  4X3G A;  4C9Z A;  2LQ6 A;  4FK5 A;  5TBN A;  2VNF A;  5FER A;  5KH9 A;  1WEV A;  5JG6 A;  5D1M B;  5EYA F;  2M3H A;  1HYJ A;  3O7A A;  1HYI A;  1DVP A;  2F42 A;  4GNF A;  2I50 A;  2LDR A;  4V3K C;  3KNV A;  2IDA A;  1E4U A;  3SOU A;  1XWH A;  1X4J A;  2YSM A;  2FUU A;  2KGG A;  3HCU A;  1X4I A;  2XB1 A;  1JM7 B;  3GV4 A;  4LLB A;  3LQI A;  2YHN A;  2ZET C;  4IC2 A;  5B75 A;  2VPE A;  4WZ3 B;  1X4U A;  2AN6 A;  1JOC A;  5KH7 A;  4R2Y A;  2EGP A;  3O34 A;  2L43 A;  4S3O C;  3ASL A;  3N9L A;  2H0D B;  4QF2 A;  2YHO A;  2C2V S;  3U5O A;  3L1X A;  3O35 A;  3L11 A;  3ZVZ B;  5TDR A;  2L5U A;  5FB0 A;  1FP0 A;  5G04 B;  1WES A;  5DIN A;  1WEU A;  3FL2 A;  4O64 A;  4GNG A;  5B79 A;  5LKU A;  1WEM A;  2LXH C;  1WFK A;  2FUI A;  2VPB A;  2JMI A;  1RMD A;  1MM2 A;  4I7C A;  5H1U A;  4BHW A;  3HCT A;  2LGK A;  3O70 A;  4WA6 A;  4ZDT A;  2KIZ A;  2JRJ A;  5TDW A;  2K16 A;  2ECW A;  3N9Q A;  3HTK C;  4L7X A;  2YQM A;  1IYM A;  1G25 A;  1K2F A;  4L58 A;  1CHC A;  4UI9 B;  4PPE A;  4YBS A;  3QZV A;  4N4F A;  2CT2 A;  4B86 C;  3C6W A;  4GB0 A;  2E6S A;  2BAY A;  5C11 A;  4FIP A;  3N9N A;  3M62 A;  3N9P A;  2YT5 A;  3SOW A;  3O37 A;  4YAT A;  4MSX A;  2D8S A;  2ECJ A;  2LGL A;  2KWK A;  2JMJ A;  4V3L C;  1VD4 A;  2LGG A;  3LQJ A;  3M99 A;  4A0C D;  5LCW B;  5G0F A;  4P5O B;  2HYE D;  1WIL A;  3N9M A;  1U6G B;  2MNZ A;  4YC9 A;  2KU3 A;  2KRE A;  2L75 A;  1WEP A;  5B77 A;  3RTR B;  1VFY A;  2QIZ A;  4YAX A;  3MHS A;  5KH3 A;  5LKZ A;  1ZBD B;  2RSD A;  2ECN A;  3PUQ A;  4CA1 A;  2KFT A;  2LXP C;  3V43 A;  3O36 A;  2KR4 A;  4FO9 A;  4A4C A;  1JM7 A;  4YAB A;  3T6R A;  3NG2 A;  1Z6U A;  2RI7 A;  4QF3 A;  4F52 B;  2YUC A;  4I7D A;  2G45 A;  2KWJ A;  3SOX A;  3ZPV 1;  2EOD A;  2ECT A;  3GL6 A;  4W4U A;  2H0D A;  4N3W A;  2MD7 B;  4BBQ A;  5AIT A;  5J3X A;  2LN0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...