2CRWA

Solution structure of the arfgap domain of adp-ribosylation factor gtpaseactivating protein 3 (arfgap 3)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
149
structure length
149
Chain Sequence
GSSGSSGMGDPSKQDILTIFKRLRSVPTNKVCFDCGAKNPSWASITYGVFLCIDCSGSHRSLGVHLSFIRSTELDSNWSWFQLRCMQVGGNASASSFFHQHGCSTNDTNAKYNSRAAQLYREKIKSLASQATRKHGTDLWLDSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the ArfGap domain of ADP-ribosylation factor GTPaseactivating protein 3 (ArfGap 3)
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords ADP-ribosylation factor GTPase-activating protein 3
total genus 27
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01412 ArfGap Putative GTPase activating protein for Arf
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.160 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2crwA00
3LVQE 3DWDA 3FEHA 3SUBA 3JUEA 3LJUX 2IQJA 3T9KA 3FM8C 1DCQA 2OWAA 3LVRE 3MDBC 2CRRA 2B0OE 4F1PA 2CRWA 3O47A 2P57A
chains in the Genus database with same CATH superfamily
3E2DA 2L5UA 1WENA 1FBVA 5G05B 3MDBC 2C2LA 2KWOA 3LRQA 2LV9A 2VNFA 3RTRB 4N3WA 3FAOA 2ECTA 5SVYA 3FANA 4C9ZA 2KKYA 4GNEA 4LLBA 5I3LA 1WEQA 2MD7B 1VYXA 2E61A 2QIZA 2D8SA 2M85A 4A49A 2AN6A 4CCGX 2VP7A 4IC3A 3KV6A 2K16A 2E6SA 2ECVA 2D8UA 2Y43A 1JM7A 5DINA 3KDEC 5D1MB 2MKEA 1LDKC 2G6QA 1WEWA 4V3LC 3M7KA 2QICA 2ZETC 3HTKC 2DJAA 4YC9A 3DWDA 3O35A 5B76A 2KREA 1VD4A 4QQ4A 4L7XA 2G45A 3LQHA 4F1PA 5H1TA 5H1VA 2YU4A 3FM8C 2VPDA 3NG2A 1ZBDB 2HDPA 5C13A 3HCTA 5LKTA 2EODA 1BORA 5LCWB 2CSZA 4PPEA 2YURA 5TDWA 2KKXA 5FB0A 2CKLA 3RPGC 3LQJA 2MT5A 2L43A 2LGVA 3ZPV1 4X3GA 1Z60A 2YQLA 5AITA 2K17A 4B86C 3VK6A 2K1JA 4YBMA 2RI7A 5TABA 2FUIA 3U5MA 3U5OA 3ASLA 3MHSA 3KNVA 2KIZA 3SOUA 4CA1A 2LGKA 3SOXA 5D1LB 1WGMA 4GNGA 4ZUXU 3MHHA 3N9QA 2CRWA 2DX8A 3LVRE 2E6RA 2NAAA 2XB1A 3N9OA 2LQ6A 2YSMA 2EGMA 3GV4A 1VFYA 2CRRA 4YAXA 2JM3A 2Y1NA 4R8PK 4NN2A 4B7YC 2LN0A 1T1HA 4MSXA 2UZGA 4OGEA 3EB6A 4S3OB 4A4CA 2K4DA 2JMJA 1WEOA 2KGIA 4ZQLA 3LDYA 4I7BA 1JOCA 2Y1MA 2EGPA 3T6RA 4W4UA 1X4UA 4FO9A 2CT2A 3O34A 4BBQA 1JM7B 2G43A 1DVPA 2YYRA 2OXQC 2CSVA 2XOCA 2YT5A 5H1UA 5AIUA 2ECIA 1MM2A 2MIQA 3PUQA 4S3OC 2C2VS 1LDJB 5LKZA 3FEHA 1X4JA 4A4BA 2MNZA 4YBSA 3PLWA 4UP0A 3ZVYA 2VPEA 2LAUA 4PTBA 2LGGA 4WZ2A 3O37A 2IQJA 5D1KB 3C6WA 4FK5A 5SVXA 1WFKA 3KQIA 5B79A 5G04B 2BAYA 3L11A 3GL6A 2MD8C 2ECGA 2RSDA 1Z2QA 3O70A 1F62A 3JUEA 3EB5A 2MNYA 1MBMA 2ECJA 3V43A 3ZYQA 2IDAA 5SVIB 1DCQA 2YQMA 4LK9A 5JG6A 3M62A 4O62A 2XEUA 1WEMA 4I7DA 2YREA 2KWNA 5KH3A 1HYJA 4MVTA 5KH9A 1IYMA 1WEEA 1V87A 2KE1A 4TKPB 1CHCA 2L75A 5DKAA 3O33A 4WZ0A 3LQIA 4BHWA 3HCUA 3N9PA 4L58A 3L1ZB 5B77A 2H0DA 4AVXA 2I50A 2MA5A 1WE9A 4GNDA 4AUQB 3LJUX 4FIPA 5B75A 3ZNIA 5TBNA 2KGGA 3QZVA 3M99A 3ZTGA 2VJFA 2L0BA 4QF2A 1WEUA 3N9NA 4QF3A 5J3XA 3DQVR 4YBTA 3SUBA 2LGLA 4YATA 2YSJA 3ZPVE 5G0FA 3SOWA 4XI1A 2KWKA 2RR4A 5KH7A 1WESA 2CKLB 3O47A 2JMDA 5FB1A 2VPGA 4V3KC 2M1RA 2M3HA 3FJUB 4Q6FA 2YHNA 5TRBA 2CSYA 2M13A 3PURA 1WEPA 2YUCA 2KYUA 2PUYA 2FSAA 4ZDTA 3LVQE 2FUUA 4LJNA 2MUMA 2QJ0A 1X4IA 2JRJA 2FFWA 4N4FA 2ECNA 2ECWA 1WEVA 4IC2A 5H9MA 4AYCA 2YVRA 2FD4A 3ZVZB 4O64A 3RPGB 4GB0A 3HCSA 3Q1DA 2XP0A 3O36A 3N9LA 5FEYA 1WIMA 2PNXA 2LXHC 3L1XA 2F42A 1E4UA 1Z6UA 2CONA 2YHOA 5TDRA 5LKUA 3H7HA 2XOYA 3I2DA 2H0DB 4H9DA 3DPLR 4AYCB 2LDRA 3N9MA 2YW8A 2KU3A 4LADB 2DSMA 4UP5A 4WA6A 4AP4A 2XOZA 2KR4A 3U5NA 3T7LA 2EXUA 2L80A 5SVIA 1XWHA 2KFTA 2OWAA 4Z0RA 4Z0OA 2VJEA 4YABA 4WZ3B 2P57A 3IHPA 5C11A 3FL2A 4R7EA 2VJFB 1MM3A 2VJEB 4GNFA 1U6GB 2L7PA 2JMIA 5K3QA 3M63A 2JUNA 2KWJA 5FERA 4UI9B 1RMDA 4R2YA 4A0CD 3SHBA 2B0OE 2LRIC 5LKXA 4I7CA 1N87A 2MA6A 3KV5A 3PHDA 1K2FA 5B8DA 4YADA 1WILA 4LKAA 2VPBA 3DDTA 1G25A 1FP0A 2HYED 3O7AA 4FJCA 2M6MA 3T9KA 2EA6A 4P5OB 1HYIA 3C5KA 2LXPC 5B78A 5EYAF 2F6JA 2F6NA 3U5PA 4OGCA 4F52B
chains in the Genus database with same CATH topology
2M13A 3E2DA 3PLWA 3JUEA 2XOZA 3FM8C 2D8UA 3Q1DA 2LAUA 2EXUA 2XP0A 4OGEA 2CRWA 5SVIA 3LVQE 2L7PA 2CSVA 2XOCA 5K3QA 3KDEC 3SUBA 2JUNA 2IQJA 5SVIB 3LVRE 1DCQA 2OWAA 2MKEA 3MDBC 4Z0RA 3T9KA 2CONA 5SVXA 4Z0OA 4O62A 2YREA 3LDYA 2RR4A 2EGMA 3H7HA 3M7KA 5SVYA 2XOYA 2CRRA 2B0OE 2JM3A 2KKYA 2DJAA 2KKXA 2P57A 3O47A 4H9DA 2FFWA 2E61A 3DWDA 3FEHA 4F1PA 3LJUX 3FJUB 4QQ4A 4OGCA 2YVRA 2FD4A 3DDTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LVQ E;  3DWD A;  3FEH A;  3SUB A;  3JUE A;  3LJU X;  2IQJ A;  3T9K A;  3FM8 C;  1DCQ A;  2OWA A;  3LVR E;  3MDB C;  2CRR A;  2B0O E;  4F1P A;  2CRW A;  3O47 A;  2P57 A; 
#chains in the Genus database with same CATH topology
 3E2D A;  2L5U A;  1WEN A;  1FBV A;  5G05 B;  3MDB C;  2C2L A;  2KWO A;  3LRQ A;  2LV9 A;  2VNF A;  3RTR B;  4N3W A;  3FAO A;  2ECT A;  5SVY A;  3FAN A;  4C9Z A;  2KKY A;  4GNE A;  4LLB A;  5I3L A;  1WEQ A;  2MD7 B;  1VYX A;  2E61 A;  2QIZ A;  2D8S A;  2M85 A;  4A49 A;  2AN6 A;  4CCG X;  2VP7 A;  4IC3 A;  3KV6 A;  2K16 A;  2E6S A;  2ECV A;  2D8U A;  2Y43 A;  1JM7 A;  5DIN A;  3KDE C;  5D1M B;  2MKE A;  1LDK C;  2G6Q A;  1WEW A;  4V3L C;  3M7K A;  2QIC A;  2ZET C;  3HTK C;  2DJA A;  4YC9 A;  3DWD A;  3O35 A;  5B76 A;  2KRE A;  1VD4 A;  4QQ4 A;  4L7X A;  2G45 A;  3LQH A;  4F1P A;  5H1T A;  5H1V A;  2YU4 A;  3FM8 C;  2VPD A;  3NG2 A;  1ZBD B;  2HDP A;  5C13 A;  3HCT A;  5LKT A;  2EOD A;  1BOR A;  5LCW B;  2CSZ A;  4PPE A;  2YUR A;  5TDW A;  2KKX A;  5FB0 A;  2CKL A;  3RPG C;  3LQJ A;  2MT5 A;  2L43 A;  2LGV A;  3ZPV 1;  4X3G A;  1Z60 A;  2YQL A;  5AIT A;  2K17 A;  4B86 C;  3VK6 A;  2K1J A;  4YBM A;  2RI7 A;  5TAB A;  2FUI A;  3U5M A;  3U5O A;  3ASL A;  3MHS A;  3KNV A;  2KIZ A;  3SOU A;  4CA1 A;  2LGK A;  3SOX A;  5D1L B;  1WGM A;  4GNG A;  4ZUX U;  3MHH A;  3N9Q A;  2CRW A;  2DX8 A;  3LVR E;  2E6R A;  2NAA A;  2XB1 A;  3N9O A;  2LQ6 A;  2YSM A;  2EGM A;  3GV4 A;  1VFY A;  2CRR A;  4YAX A;  2JM3 A;  2Y1N A;  4R8P K;  4NN2 A;  4B7Y C;  2LN0 A;  1T1H A;  4MSX A;  2UZG A;  4OGE A;  3EB6 A;  4S3O B;  4A4C A;  2K4D A;  2JMJ A;  1WEO A;  2KGI A;  4ZQL A;  3LDY A;  4I7B A;  1JOC A;  2Y1M A;  2EGP A;  3T6R A;  4W4U A;  1X4U A;  4FO9 A;  2CT2 A;  3O34 A;  4BBQ A;  1JM7 B;  2G43 A;  1DVP A;  2YYR A;  2OXQ C;  2CSV A;  2XOC A;  2YT5 A;  5H1U A;  5AIU A;  2ECI A;  1MM2 A;  2MIQ A;  3PUQ A;  4S3O C;  2C2V S;  1LDJ B;  5LKZ A;  3FEH A;  1X4J A;  4A4B A;  2MNZ A;  4YBS A;  3PLW A;  4UP0 A;  3ZVY A;  2VPE A;  2LAU A;  4PTB A;  2LGG A;  4WZ2 A;  3O37 A;  2IQJ A;  5D1K B;  3C6W A;  4FK5 A;  5SVX A;  1WFK A;  3KQI A;  5B79 A;  5G04 B;  2BAY A;  3L11 A;  3GL6 A;  2MD8 C;  2ECG A;  2RSD A;  1Z2Q A;  3O70 A;  1F62 A;  3JUE A;  3EB5 A;  2MNY A;  1MBM A;  2ECJ A;  3V43 A;  3ZYQ A;  2IDA A;  5SVI B;  1DCQ A;  2YQM A;  4LK9 A;  5JG6 A;  3M62 A;  4O62 A;  2XEU A;  1WEM A;  4I7D A;  2YRE A;  2KWN A;  5KH3 A;  1HYJ A;  4MVT A;  5KH9 A;  1IYM A;  1WEE A;  1V87 A;  2KE1 A;  4TKP B;  1CHC A;  2L75 A;  5DKA A;  3O33 A;  4WZ0 A;  3LQI A;  4BHW A;  3HCU A;  3N9P A;  4L58 A;  3L1Z B;  5B77 A;  2H0D A;  4AVX A;  2I50 A;  2MA5 A;  1WE9 A;  4GND A;  4AUQ B;  3LJU X;  4FIP A;  5B75 A;  3ZNI A;  5TBN A;  2KGG A;  3QZV A;  3M99 A;  3ZTG A;  2VJF A;  2L0B A;  4QF2 A;  1WEU A;  3N9N A;  4QF3 A;  5J3X A;  3DQV R;  4YBT A;  3SUB A;  2LGL A;  4YAT A;  2YSJ A;  3ZPV E;  5G0F A;  3SOW A;  4XI1 A;  2KWK A;  2RR4 A;  5KH7 A;  1WES A;  2CKL B;  3O47 A;  2JMD A;  5FB1 A;  2VPG A;  4V3K C;  2M1R A;  2M3H A;  3FJU B;  4Q6F A;  2YHN A;  5TRB A;  2CSY A;  2M13 A;  3PUR A;  1WEP A;  2YUC A;  2KYU A;  2PUY A;  2FSA A;  4ZDT A;  3LVQ E;  2FUU A;  4LJN A;  2MUM A;  2QJ0 A;  1X4I A;  2JRJ A;  2FFW A;  4N4F A;  2ECN A;  2ECW A;  1WEV A;  4IC2 A;  5H9M A;  4AYC A;  2YVR A;  2FD4 A;  3ZVZ B;  4O64 A;  3RPG B;  4GB0 A;  3HCS A;  3Q1D A;  2XP0 A;  3O36 A;  3N9L A;  5FEY A;  1WIM A;  2PNX A;  2LXH C;  3L1X A;  2F42 A;  1E4U A;  1Z6U A;  2CON A;  2YHO A;  5TDR A;  5LKU A;  3H7H A;  2XOY A;  3I2D A;  2H0D B;  4H9D A;  3DPL R;  4AYC B;  2LDR A;  3N9M A;  2YW8 A;  2KU3 A;  4LAD B;  2DSM A;  4UP5 A;  4WA6 A;  4AP4 A;  2XOZ A;  2KR4 A;  3U5N A;  3T7L A;  2EXU A;  2L80 A;  5SVI A;  1XWH A;  2KFT A;  2OWA A;  4Z0R A;  4Z0O A;  2VJE A;  4YAB A;  4WZ3 B;  2P57 A;  3IHP A;  5C11 A;  3FL2 A;  4R7E A;  2VJF B;  1MM3 A;  2VJE B;  4GNF A;  1U6G B;  2L7P A;  2JMI A;  5K3Q A;  3M63 A;  2JUN A;  2KWJ A;  5FER A;  4UI9 B;  1RMD A;  4R2Y A;  4A0C D;  3SHB A;  2B0O E;  2LRI C;  5LKX A;  4I7C A;  1N87 A;  2MA6 A;  3KV5 A;  3PHD A;  1K2F A;  5B8D A;  4YAD A;  1WIL A;  4LKA A;  2VPB A;  3DDT A;  1G25 A;  1FP0 A;  2HYE D;  3O7A A;  4FJC A;  2M6M A;  3T9K A;  2EA6 A;  4P5O B;  1HYI A;  3C5K A;  2LXP C;  5B78 A;  5EYA F;  2F6J A;  2F6N A;  3U5P A;  4OGC A;  4F52 B; 
#chains in the Genus database with same CATH homology
 2M13 A;  3E2D A;  3PLW A;  3JUE A;  2XOZ A;  3FM8 C;  2D8U A;  3Q1D A;  2LAU A;  2EXU A;  2XP0 A;  4OGE A;  2CRW A;  5SVI A;  3LVQ E;  2L7P A;  2CSV A;  2XOC A;  5K3Q A;  3KDE C;  3SUB A;  2JUN A;  2IQJ A;  5SVI B;  3LVR E;  1DCQ A;  2OWA A;  2MKE A;  3MDB C;  4Z0R A;  3T9K A;  2CON A;  5SVX A;  4Z0O A;  4O62 A;  2YRE A;  3LDY A;  2RR4 A;  2EGM A;  3H7H A;  3M7K A;  5SVY A;  2XOY A;  2CRR A;  2B0O E;  2JM3 A;  2KKY A;  2DJA A;  2KKX A;  2P57 A;  3O47 A;  4H9D A;  2FFW A;  2E61 A;  3DWD A;  3FEH A;  4F1P A;  3LJU X;  3FJU B;  4QQ4 A;  4OGC A;  2YVR A;  2FD4 A;  3DDT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...