2CRWA

Solution structure of the arfgap domain of adp-ribosylation factor gtpaseactivating protein 3 (arfgap 3)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
149
structure length
149
Chain Sequence
GSSGSSGMGDPSKQDILTIFKRLRSVPTNKVCFDCGAKNPSWASITYGVFLCIDCSGSHRSLGVHLSFIRSTELDSNWSWFQLRCMQVGGNASASSFFHQHGCSTNDTNAKYNSRAAQLYREKIKSLASQATRKHGTDLWLDSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor GTPase-activating protein 3
publication title Solution structure of the ArfGap domain of ADP-ribosylation factor GTPaseactivating protein 3 (ArfGap 3)
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 27
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01412 ArfGap Putative GTPase activating protein for Arf
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.160 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2crwA00
3FM8C 2IQJA 2OWAA 3T9KA 3LVQE 3O47A 3FEHA 3SUBA 3MDBC 3DWDA 2CRWA 2P57A 3JUEA 2CRRA 2B0OE 4F1PA 1DCQA 3LJUX 3LVRE
chains in the Genus database with same CATH superfamily
1X4UA 4UI9B 2VPDA 2IQJA 3ASLA 2G45A 3LVQE 5TABA 1E4UA 4WZ0A 1WESA 2H0DA 4MSXA 5EYAF 1ZBDB 2FUUA 3SHBA 2E6SA 3O33A 4LJNA 3ZVZB 3L11A 2F6JA 3RTRB 2KFTA 1WEEA 4YADA 2YQLA 3FEHA 4I7CA 4YATA 4W4UA 2YREA 2Y1NA 2VJFB 3PHDA 2KWOA 2Y43A 3U5NA 2KIZA 4A0CD 4ZDTA 5K3QA 3LQJA 2ECNA 4V3LC 4A49A 2M6MA 2MD8C 4CA1A 5FERA 4MVTA 1Z60A 4A4BA 2L5UA 3MHSA 2KREA 2LN0A 3ZNIA 4IC3A 2QICA 2JMJA 2ECIA 5G04B 3ZPV1 2E6RA 5TRBA 2CSYA 5H9MA 1BORA 5H1VA 1VFYA 2M13A 4UP5A 2XOCA 2EA6A 4I7DA 2MNZA 2OWAA 3HCSA 1WGMA 4B86C 5KH7A 4GNGA 4LLBA 2XOZA 2ECTA 1U6GB 2KWNA 3JUEA 5I3LA 5LKUA 4B7YC 3M99A 2K17A 3SOUA 2MA6A 2KGIA 1JM7A 3O34A 2RI7A 2ECVA 1MM2A 3N9NA 1CHCA 2CKLB 1IYMA 3T9KA 3ZTGA 3O7AA 4A4CA 3U5MA 3N9QA 1HYJA 3MDBC 2YURA 2KKYA 2ZETC 2YUCA 3LRQA 2I50A 5H1TA 1HYIA 3I2DA 2YT5A 3FJUB 4GNEA 2EGMA 5G0FA 4YBSA 1DVPA 3PLWA 4YBTA 4WA6A 2VNFA 3HCUA 4AYCB 2MD7B 2YYRA 2IDAA 2LGLA 2XOYA 4WZ3B 2ECWA 4N3WA 5H1UA 2KWJA 2YU4A 5SVYA 5B75A 1WEMA 2G43A 2NAAA 2UZGA 1LDJB 2VJFA 2VJEA 2JM3A 3M62A 2JMDA 4ZUXU 5J3XA 3PUQA 1RMDA 2L43A 3IHPA 4TKPB 1FBVA 2PUYA 3LVRE 2KE1A 2LV9A 2LXPC 5TBNA 2EODA 4Z0RA 3V43A 3SOXA 4FIPA 2K4DA 2YSJA 3FANA 2FUIA 2LQ6A 2XP0A 4P5OB 5C11A 4BHWA 1DCQA 4R7EA 3SOWA 3T7LA 2PNXA 5SVXA 4AVXA 1WE9A 3L1XA 1WIMA 3U5PA 2DSMA 3C5KA 5B78A 2LGGA 2LXHC 1Z2QA 1G25A 2OXQC 2LDRA 3N9MA 3O37A 3DWDA 3EB6A 2KWKA 3FAOA 2C2LA 5FEYA 4C9ZA 4NN2A 1V87A 1MM3A 2QJ0A 1JOCA 4LK9A 3N9PA 5FB0A 2MUMA 3LDYA 2KYUA 4AUQB 3DDTA 2LRIC 5G05B 2FFWA 5LKZA 2F6NA 3LQHA 4QF2A 3ZPVE 4GNDA 1WFKA 2YW8A 5FB1A 4ZQLA 4YABA 5TDWA 2JUNA 3MHHA 2MA5A 4V3KC 4Z0OA 5B79A 4Q6FA 1N87A 2VPGA 4S3OB 1X4JA 4AYCA 3RPGB 1Z6UA 2JMIA 4FJCA 5B8DA 2C2VS 1WEPA 3O47A 2E61A 1T1HA 3DQVR 4CCGX 2HYED 3KDEC 3N9LA 4OGCA 3T6RA 2VP7A 3VK6A 2EXUA 3DPLR 2M1RA 2MIQA 3N9OA 4BBQA 4YBMA 4PTBA 4H9DA 5JG6A 1WILA 5KH3A 1WEOA 2BAYA 4S3OC 4F52B 1X4IA 2XB1A 2K1JA 2B0OE 4QF3A 4PPEA 3LJUX 1JM7B 3KQIA 2RSDA 4GNFA 1VD4A 2FD4A 2MNYA 2DJAA 4QQ4A 2CT2A 2Y1MA 4OGEA 2YVRA 5SVIB 3M63A 2VPBA 2YSMA 2KKXA 3E2DA 5B76A 2F42A 5KH9A 2CSVA 3HTKC 4R2YA 3Q1DA 2XEUA 5DKAA 4IC2A 4LADB 2M3HA 3LQIA 4L7XA 4O62A 3ZVYA 2L80A 3HCTA 2CONA 2JRJA 5AIUA 2KGGA 2D8UA 3ZYQA 4UP0A 2LGKA 3KNVA 3SUBA 3GV4A 2ECJA 2H0DB 2MT5A 3U5OA 3H7HA 2CRWA 3C6WA 2VJEB 4XI1A 4YAXA 5LKTA 2YHOA 3QZVA 5C13A 2VPEA 3FM8C 4GB0A 5DINA 4X3GA 2G6QA 3KV5A 2CKLA 3FL2A 3GL6A 2CSZA 2D8SA 3NG2A 1WEWA 1WEVA 2CRRA 2YQMA 2HDPA 3M7KA 4YC9A 1LDKC 5LCWB 2K16A 2KR4A 2FSAA 2MKEA 1F62A 3O36A 5D1MB 1XWHA 4O64A 5B77A 5TDRA 3EB5A 2L0BA 2KU3A 3O70A 1K2FA 4WZ2A 4L58A 2YHNA 3KV6A 4F1PA 2QIZA 5D1LB 3L1ZB 2LGVA 4FK5A 2DX8A 3PURA 4AP4A 3O35A 1WEQA 5D1KB 5LKXA 4I7BA 5AITA 2M85A 2L7PA 1WENA 5SVIA 4LKAA 2LAUA 1VYXA 2P57A 3RPGC 2ECGA 1FP0A 4R8PK 2EGPA 2L75A 4N4FA 2AN6A 4FO9A 1MBMA 1WEUA 2RR4A
chains in the Genus database with same CATH topology
2DJAA 4QQ4A 3FM8C 2IQJA 2OWAA 2CONA 2FFWA 2XOYA 4H9DA 4OGEA 3T9KA 3LVQE 2YVRA 2D8UA 5SVYA 5SVIB 3O47A 3FEHA 2L7PA 2E61A 2KKXA 3E2DA 3MDBC 5SVIA 3SUBA 2YREA 2KKYA 2XP0A 3DWDA 2LAUA 2XOZA 2CSVA 2CRWA 3H7HA 2P57A 3Q1DA 3JUEA 3KDEC 2CRRA 2B0OE 4F1PA 1DCQA 3LJUX 2JM3A 4OGCA 3M7KA 2JUNA 3FJUB 2EGMA 5SVXA 4Z0OA 2M13A 2RR4A 3LDYA 3PLWA 3LVRE 5K3QA 2XOCA 4O62A 2FD4A 2MKEA 2EXUA 3DDTA 4Z0RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FM8 C;  2IQJ A;  2OWA A;  3T9K A;  3LVQ E;  3O47 A;  3FEH A;  3SUB A;  3MDB C;  3DWD A;  2CRW A;  2P57 A;  3JUE A;  2CRR A;  2B0O E;  4F1P A;  1DCQ A;  3LJU X;  3LVR E; 
#chains in the Genus database with same CATH topology
 1X4U A;  4UI9 B;  2VPD A;  2IQJ A;  3ASL A;  2G45 A;  3LVQ E;  5TAB A;  1E4U A;  4WZ0 A;  1WES A;  2H0D A;  4MSX A;  5EYA F;  1ZBD B;  2FUU A;  3SHB A;  2E6S A;  3O33 A;  4LJN A;  3ZVZ B;  3L11 A;  2F6J A;  3RTR B;  2KFT A;  1WEE A;  4YAD A;  2YQL A;  3FEH A;  4I7C A;  4YAT A;  4W4U A;  2YRE A;  2Y1N A;  2VJF B;  3PHD A;  2KWO A;  2Y43 A;  3U5N A;  2KIZ A;  4A0C D;  4ZDT A;  5K3Q A;  3LQJ A;  2ECN A;  4V3L C;  4A49 A;  2M6M A;  2MD8 C;  4CA1 A;  5FER A;  4MVT A;  1Z60 A;  4A4B A;  2L5U A;  3MHS A;  2KRE A;  2LN0 A;  3ZNI A;  4IC3 A;  2QIC A;  2JMJ A;  2ECI A;  5G04 B;  3ZPV 1;  2E6R A;  5TRB A;  2CSY A;  5H9M A;  1BOR A;  5H1V A;  1VFY A;  2M13 A;  4UP5 A;  2XOC A;  2EA6 A;  4I7D A;  2MNZ A;  2OWA A;  3HCS A;  1WGM A;  4B86 C;  5KH7 A;  4GNG A;  4LLB A;  2XOZ A;  2ECT A;  1U6G B;  2KWN A;  3JUE A;  5I3L A;  5LKU A;  4B7Y C;  3M99 A;  2K17 A;  3SOU A;  2MA6 A;  2KGI A;  1JM7 A;  3O34 A;  2RI7 A;  2ECV A;  1MM2 A;  3N9N A;  1CHC A;  2CKL B;  1IYM A;  3T9K A;  3ZTG A;  3O7A A;  4A4C A;  3U5M A;  3N9Q A;  1HYJ A;  3MDB C;  2YUR A;  2KKY A;  2ZET C;  2YUC A;  3LRQ A;  2I50 A;  5H1T A;  1HYI A;  3I2D A;  2YT5 A;  3FJU B;  4GNE A;  2EGM A;  5G0F A;  4YBS A;  1DVP A;  3PLW A;  4YBT A;  4WA6 A;  2VNF A;  3HCU A;  4AYC B;  2MD7 B;  2YYR A;  2IDA A;  2LGL A;  2XOY A;  4WZ3 B;  2ECW A;  4N3W A;  5H1U A;  2KWJ A;  2YU4 A;  5SVY A;  5B75 A;  1WEM A;  2G43 A;  2NAA A;  2UZG A;  1LDJ B;  2VJF A;  2VJE A;  2JM3 A;  3M62 A;  2JMD A;  4ZUX U;  5J3X A;  3PUQ A;  1RMD A;  2L43 A;  3IHP A;  4TKP B;  1FBV A;  2PUY A;  3LVR E;  2KE1 A;  2LV9 A;  2LXP C;  5TBN A;  2EOD A;  4Z0R A;  3V43 A;  3SOX A;  4FIP A;  2K4D A;  2YSJ A;  3FAN A;  2FUI A;  2LQ6 A;  2XP0 A;  4P5O B;  5C11 A;  4BHW A;  1DCQ A;  4R7E A;  3SOW A;  3T7L A;  2PNX A;  5SVX A;  4AVX A;  1WE9 A;  3L1X A;  1WIM A;  3U5P A;  2DSM A;  3C5K A;  5B78 A;  2LGG A;  2LXH C;  1Z2Q A;  1G25 A;  2OXQ C;  2LDR A;  3N9M A;  3O37 A;  3DWD A;  3EB6 A;  2KWK A;  3FAO A;  2C2L A;  5FEY A;  4C9Z A;  4NN2 A;  1V87 A;  1MM3 A;  2QJ0 A;  1JOC A;  4LK9 A;  3N9P A;  5FB0 A;  2MUM A;  3LDY A;  2KYU A;  4AUQ B;  3DDT A;  2LRI C;  5G05 B;  2FFW A;  5LKZ A;  2F6N A;  3LQH A;  4QF2 A;  3ZPV E;  4GND A;  1WFK A;  2YW8 A;  5FB1 A;  4ZQL A;  4YAB A;  5TDW A;  2JUN A;  3MHH A;  2MA5 A;  4V3K C;  4Z0O A;  5B79 A;  4Q6F A;  1N87 A;  2VPG A;  4S3O B;  1X4J A;  4AYC A;  3RPG B;  1Z6U A;  2JMI A;  4FJC A;  5B8D A;  2C2V S;  1WEP A;  3O47 A;  2E61 A;  1T1H A;  3DQV R;  4CCG X;  2HYE D;  3KDE C;  3N9L A;  4OGC A;  3T6R A;  2VP7 A;  3VK6 A;  2EXU A;  3DPL R;  2M1R A;  2MIQ A;  3N9O A;  4BBQ A;  4YBM A;  4PTB A;  4H9D A;  5JG6 A;  1WIL A;  5KH3 A;  1WEO A;  2BAY A;  4S3O C;  4F52 B;  1X4I A;  2XB1 A;  2K1J A;  2B0O E;  4QF3 A;  4PPE A;  3LJU X;  1JM7 B;  3KQI A;  2RSD A;  4GNF A;  1VD4 A;  2FD4 A;  2MNY A;  2DJA A;  4QQ4 A;  2CT2 A;  2Y1M A;  4OGE A;  2YVR A;  5SVI B;  3M63 A;  2VPB A;  2YSM A;  2KKX A;  3E2D A;  5B76 A;  2F42 A;  5KH9 A;  2CSV A;  3HTK C;  4R2Y A;  3Q1D A;  2XEU A;  5DKA A;  4IC2 A;  4LAD B;  2M3H A;  3LQI A;  4L7X A;  4O62 A;  3ZVY A;  2L80 A;  3HCT A;  2CON A;  2JRJ A;  5AIU A;  2KGG A;  2D8U A;  3ZYQ A;  4UP0 A;  2LGK A;  3KNV A;  3SUB A;  3GV4 A;  2ECJ A;  2H0D B;  2MT5 A;  3U5O A;  3H7H A;  2CRW A;  3C6W A;  2VJE B;  4XI1 A;  4YAX A;  5LKT A;  2YHO A;  3QZV A;  5C13 A;  2VPE A;  3FM8 C;  4GB0 A;  5DIN A;  4X3G A;  2G6Q A;  3KV5 A;  2CKL A;  3FL2 A;  3GL6 A;  2CSZ A;  2D8S A;  3NG2 A;  1WEW A;  1WEV A;  2CRR A;  2YQM A;  2HDP A;  3M7K A;  4YC9 A;  1LDK C;  5LCW B;  2K16 A;  2KR4 A;  2FSA A;  2MKE A;  1F62 A;  3O36 A;  5D1M B;  1XWH A;  4O64 A;  5B77 A;  5TDR A;  3EB5 A;  2L0B A;  2KU3 A;  3O70 A;  1K2F A;  4WZ2 A;  4L58 A;  2YHN A;  3KV6 A;  4F1P A;  2QIZ A;  5D1L B;  3L1Z B;  2LGV A;  4FK5 A;  2DX8 A;  3PUR A;  4AP4 A;  3O35 A;  1WEQ A;  5D1K B;  5LKX A;  4I7B A;  5AIT A;  2M85 A;  2L7P A;  1WEN A;  5SVI A;  4LKA A;  2LAU A;  1VYX A;  2P57 A;  3RPG C;  2ECG A;  1FP0 A;  4R8P K;  2EGP A;  2L75 A;  4N4F A;  2AN6 A;  4FO9 A;  1MBM A;  1WEU A;  2RR4 A; 
#chains in the Genus database with same CATH homology
 2DJA A;  4QQ4 A;  3FM8 C;  2IQJ A;  2OWA A;  2CON A;  2FFW A;  2XOY A;  4H9D A;  4OGE A;  3T9K A;  3LVQ E;  2YVR A;  2D8U A;  5SVY A;  5SVI B;  3O47 A;  3FEH A;  2L7P A;  2E61 A;  2KKX A;  3E2D A;  3MDB C;  5SVI A;  3SUB A;  2YRE A;  2KKY A;  2XP0 A;  3DWD A;  2LAU A;  2XOZ A;  2CSV A;  2CRW A;  3H7H A;  2P57 A;  3Q1D A;  3JUE A;  3KDE C;  2CRR A;  2B0O E;  4F1P A;  1DCQ A;  3LJU X;  2JM3 A;  4OGC A;  3M7K A;  2JUN A;  3FJU B;  2EGM A;  5SVX A;  4Z0O A;  2M13 A;  2RR4 A;  3LDY A;  3PLW A;  3LVR E;  5K3Q A;  2XOC A;  4O62 A;  2FD4 A;  2MKE A;  2EXU A;  3DDT A;  4Z0R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...