4A49A

Structure of phosphotyr371-c-cbl-ubch5b complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
77
structure length
76
Chain Sequence
DHIKVTQEQFELCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCRCEIKGTEPIVVDPFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for autoinhibition and phosphorylation-dependent activation of c-Cbl.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase CBL
total genus 20
structure length 76
sequence length 77
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14447 Prok-RING_4 Prokaryotic RING finger family 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4a49A00
2LXPC 2YQLA 4FIPA 2C2VS 1WEQA 5B79A 2IDAA 1VD4A 4PPEA 2YT5A 2LV9A 2MIQA 2PNXA 5FB1A 3ZYQA 2EGPA 3GV4A 2E6RA 1T1HA 4MSXA 4N3WA 3N9PA 1E4UA 2KR4A 3N9MA 1WEEA 4L7XA 4LLBA 2YURA 4A4BA 2VJFA 3I2DA 5TABA 5H1VA 4TKPB 2LN0A 2FSAA 2CT2A 2YW8A 2VPBA 2L0BA 3U5MA 2CKLA 1WEWA 3ASLA 4V3KC 2MA6A 4AYCB 2FUUA 2KYUA 2K4DA 3LQIA 4YAXA 5D1LB 2JRJA 1VYXA 2YQMA 3O37A 2ECIA 3O36A 2F6NA 5FB0A 4YBMA 1WIMA 3V43A 2Y1NA 3L1ZB 4L58A 4R7EA 4LJNA 3U5PA 2ECJA 2MD7B 1Z2QA 2HDPA 1XWHA 5B78A 2M1RA 4GNEA 4YBTA 1JM7A 2G43A 2QJ0A 5LKUA 2KIZA 3C6WA 4WZ0A 1IYMA 3SOUA 4BBQA 5D1MB 1WENA 3ZNIA 3LQJA 2QIZA 3RPGB 4UP0A 2D8SA 2JMJA 3O35A 5TBNA 2L80A 4QF2A 4V3LC 5DKAA 5TDRA 2MD8C 2K16A 2VJEB 2E6SA 2LXHC 4FK5A 4FJCA 4WA6A 2LGVA 1JM7B 5AITA 5LKTA 5H1UA 4N4FA 4LKAA 3PURA 2YU4A 2KWNA 5B8DA 4P5OB 1WGMA 4A49A 2YHNA 4W4UA 3SOWA 5TDWA 3EB6A 2FUIA 4XI1A 2G6QA 2ECTA 3HCTA 2KWOA 2HYED 4WZ3B 4GNFA 2Y1MA 3O34A 2YUCA 2VJEA 2YREA 3U5OA 2EA6A 2ECGA 3PHDA 2ECWA 4NN2A 2MNYA 5I3LA 3MHHA 4I7BA 2LGLA 1K2FA 3NG2A 3M62A 3FL2A 3O7AA 5G05B 3U5NA 2K17A 2YHOA 2F6JA 2OXQC 4WZ2A 1X4IA 1JOCA 2KREA 2M6MA 2PUYA 4FO9A 4C9ZA 4YADA 4YC9A 4UP5A 4Q6FA 5LKZA 2LGKA 2VPDA 5EYAF 4B86C 4LK9A 1FP0A 2YYRA 5C13A 4YATA 1RMDA 4ZUXU 3SHBA 5G04B 2VP7A 3N9OA 1WESA 1MM2A 2LDRA 5KH9A 1FBVA 2XEUA 3C5KA 3DQVR 1Z6UA 3RTRB 2ZETC 4GNDA 3L1XA 1WILA 3RPGC 4AVXA 4PTBA 2BAYA 4QF3A 5TRBA 5KH7A 5B76A 5H1TA 4GB0A 1WEOA 4I7DA 3EB5A 4LADB 4GNGA 4F52B 2YSJA 3O70A 2VPGA 5G0FA 3ZPV1 1WEMA 2CKLB 1VFYA 2RI7A 1LDJB 2MUMA 2F42A 1HYJA 1WEPA 2KU3A 2RSDA 2AN6A 4AYCA 5DINA 2KFTA 1LDKC 3N9LA 5B75A 2LQ6A 3GL6A 5KH3A 2KGIA 4R8PK 4I7CA 2M3HA 2DX8A 1BORA 3HCUA 4S3OB 2ECVA 2LGGA 3KNVA 3M99A 5D1KB 5C11A 2QICA 2KE1A 1WEUA 2Y43A 3ZVYA 2MA5A 2I50A 1WEVA 4UI9B 3KV6A 3T7LA 5AIUA 1ZBDB 2L5UA 2JMIA 2LRIC 4BHWA 2EODA 4O64A 3L11A 3HTKC 3QZVA 1F62A 5JG6A 5J3XA 1HYIA 4AP4A 4ZQLA 3HCSA 4R2YA 2KGGA 1U6GB 2VJFB 3LQHA 4AUQB 1MM3A 4MVTA 1X4UA 4YABA 1DVPA 3PUQA 2XB1A 2G45A 2UZGA 2NAAA 4CCGX 2ECNA 2K1JA 4CA1A 3KV5A 2KWJA 3KQIA 1X4JA 4B7YC 3N9NA 5FERA 4A4CA 2YSMA 3M63A 2VNFA 3N9QA 4A0CD 3DPLR 5FEYA 3VK6A 2MT5A 2C2LA 3LRQA 3ZPVE 2H0DA 4YBSA 4ZDTA 4IC2A 5LKXA 5H9MA 3IHPA 2KWKA 2CSYA 4IC3A 2L43A 1G25A 1N87A 1WE9A 3ZVZB 4S3OC 3O33A 3ZTGA 1CHCA 1WFKA 2MNZA 2H0DB 1V87A 2JMDA 5LCWB 2L75A 2CSZA 2VPEA 3MHSA 4X3GA 2M85A 3SOXA 5B77A 3T6RA 1Z60A
chains in the Genus database with same CATH superfamily
2LXPC 2YQLA 4FIPA 3PLWA 2C2VS 1WEQA 5B79A 2IDAA 2B0OE 5SVIA 1VD4A 4PPEA 2YT5A 2LV9A 2MIQA 2PNXA 3M7KA 5FB1A 5SVYA 2CONA 2XP0A 4H9DA 3ZYQA 2EGPA 3GV4A 2E6RA 1T1HA 4MSXA 4N3WA 3N9PA 1E4UA 2KR4A 3N9MA 1WEEA 4L7XA 4LLBA 5K3QA 2YURA 4A4BA 2VJFA 2XOCA 3I2DA 2FFWA 5TABA 2CRWA 5H1VA 2FD4A 4TKPB 2LN0A 2FSAA 2CT2A 2YW8A 2VPBA 2L0BA 4Z0RA 3U5MA 2CKLA 1WEWA 3ASLA 4V3KC 2MA6A 3E2DA 4AYCB 3SUBA 2FUUA 2KYUA 2K4DA 3LQIA 4YAXA 5D1LB 2JRJA 3H7HA 1VYXA 2YQMA 3O37A 2ECIA 3O36A 2F6NA 5FB0A 4YBMA 3O47A 1WIMA 3V43A 2Y1NA 3FM8C 3L1ZB 4L58A 4R7EA 4Z0OA 4LJNA 3U5PA 2ECJA 2MD7B 1Z2QA 2HDPA 1XWHA 5B78A 2M1RA 4GNEA 4YBTA 1JM7A 2G43A 3T9KA 2QJ0A 5LKUA 2KIZA 3C6WA 4WZ0A 1IYMA 3SOUA 4BBQA 5D1MB 1WENA 3ZNIA 3LQJA 2QIZA 3RPGB 4UP0A 2D8SA 2JMJA 3O35A 5SVIB 5TBNA 2L80A 3DDTA 4QF2A 4V3LC 5DKAA 5TDRA 2MD8C 2K16A 4OGEA 2VJEB 2E6SA 2LXHC 4FK5A 4FJCA 4WA6A 2LGVA 1JM7B 5AITA 5LKTA 2P57A 5H1UA 4N4FA 4LKAA 3PURA 2YU4A 2KWNA 5B8DA 4P5OB 1WGMA 4A49A 2YHNA 2MKEA 2CSVA 4W4UA 3SOWA 5TDWA 3EB6A 2FUIA 2JUNA 4XI1A 2G6QA 2ECTA 1Z60A 3HCTA 2JM3A 2KWOA 2RR4A 2HYED 4WZ3B 4GNFA 2Y1MA 3O34A 2YUCA 2VJEA 2YREA 3U5OA 2EA6A 1DCQA 2ECGA 3PHDA 2ECWA 4NN2A 2MNYA 5I3LA 3MHHA 3Q1DA 4I7BA 2LGLA 1K2FA 3NG2A 2KKYA 3M62A 3FL2A 3O7AA 5G05B 3U5NA 2K17A 2YHOA 2F6JA 2OXQC 4WZ2A 1X4IA 1JOCA 2KREA 2M6MA 2PUYA 4FO9A 4C9ZA 2LAUA 4YADA 4YC9A 4UP5A 4Q6FA 5LKZA 2LGKA 2VPDA 5EYAF 4B86C 4LK9A 1FP0A 2YYRA 5C13A 4YATA 1RMDA 4ZUXU 3SHBA 5G04B 2VP7A 3N9OA 3FAOA 1WESA 1MM2A 2LDRA 2L7PA 5KH9A 1FBVA 2XEUA 3C5KA 3DQVR 1Z6UA 3RTRB 3FEHA 3KDEC 2ZETC 4GNDA 3L1XA 1WILA 3RPGC 4AVXA 4PTBA 2BAYA 4QF3A 3LDYA 5TRBA 5KH7A 5B76A 5H1TA 4GB0A 1WEOA 3LJUX 4I7DA 3EB5A 4LADB 4GNGA 4F52B 2M13A 2YSJA 2VPGA 3O70A 5G0FA 3ZPV1 1WEMA 3MDBC 2CKLB 2D8UA 1VFYA 2RI7A 1LDJB 2MUMA 2F42A 1HYJA 1WEPA 3LVQE 2KU3A 2RSDA 2AN6A 4AYCA 4QQ4A 5DINA 2KFTA 1LDKC 3N9LA 4O62A 5B75A 2LQ6A 3GL6A 5KH3A 2KGIA 4R8PK 4I7CA 2M3HA 4OGCA 2DX8A 1BORA 3HCUA 4S3OB 3JUEA 2ECVA 2LGGA 3KNVA 3M99A 5D1KB 5C11A 2QICA 2KE1A 1WEUA 2Y43A 3ZVYA 3DWDA 2MA5A 2I50A 2KKXA 3LVRE 1WEVA 4UI9B 3KV6A 2DSMA 3T7LA 5AIUA 1ZBDB 2L5UA 2JMIA 2LRIC 4BHWA 2DJAA 2EODA 4O64A 3L11A 3HTKC 3QZVA 1F62A 5JG6A 5J3XA 1HYIA 3FJUB 4AP4A 2XOYA 4ZQLA 3HCSA 4R2YA 2KGGA 1U6GB 2VJFB 3LQHA 4AUQB 2EGMA 1MM3A 4MVTA 1X4UA 4YABA 1DVPA 3PUQA 2XB1A 2G45A 2UZGA 2NAAA 4CCGX 2ECNA 2K1JA 4CA1A 2CRRA 3KV5A 2KWJA 3KQIA 1X4JA 4B7YC 3N9NA 5FERA 4A4CA 2YSMA 3M63A 2VNFA 3N9QA 4A0CD 3DPLR 5FEYA 3VK6A 2MT5A 2C2LA 3LRQA 3ZPVE 2YVRA 2H0DA 4YBSA 4ZDTA 4IC2A 5LKXA 5H9MA 3IHPA 2KWKA 2CSYA 3FANA 4IC3A 2E61A 2L43A 1G25A 2OWAA 1N87A 2XOZA 1WE9A 3ZVZB 4S3OC 3O33A 3ZTGA 1CHCA 1WFKA 2MNZA 4F1PA 2H0DB 1V87A 2JMDA 5LCWB 2L75A 2EXUA 2CSZA 2VPEA 3MHSA 4X3GA 2M85A 5SVXA 3SOXA 1MBMA 5B77A 3T6RA 2IQJA
chains in the Genus database with same CATH topology
2LXPC 2YQLA 4FIPA 2C2VS 1WEQA 5B79A 2IDAA 1VD4A 4PPEA 2YT5A 2LV9A 2MIQA 2PNXA 5FB1A 3ZYQA 2EGPA 3GV4A 2E6RA 1T1HA 4MSXA 4N3WA 3N9PA 1E4UA 2KR4A 3N9MA 1WEEA 4L7XA 4LLBA 2YURA 4A4BA 2VJFA 3I2DA 5TABA 5H1VA 4TKPB 2LN0A 2FSAA 2CT2A 2YW8A 2VPBA 2L0BA 3U5MA 2CKLA 1WEWA 3ASLA 4V3KC 2MA6A 4AYCB 2FUUA 2KYUA 2K4DA 3LQIA 4YAXA 5D1LB 2JRJA 1VYXA 2YQMA 3O37A 2ECIA 3O36A 2F6NA 5FB0A 4YBMA 1WIMA 3V43A 2Y1NA 3L1ZB 4L58A 4R7EA 4LJNA 3U5PA 2ECJA 2MD7B 1Z2QA 2HDPA 1XWHA 5B78A 2M1RA 4GNEA 4YBTA 1JM7A 2G43A 2QJ0A 5LKUA 2KIZA 3C6WA 4WZ0A 1IYMA 3SOUA 4BBQA 5D1MB 1WENA 3ZNIA 3LQJA 2QIZA 3RPGB 4UP0A 2D8SA 2JMJA 3O35A 5TBNA 2L80A 4QF2A 4V3LC 5DKAA 5TDRA 2MD8C 2K16A 2VJEB 2E6SA 2LXHC 4FK5A 4FJCA 4WA6A 2LGVA 1JM7B 5AITA 5LKTA 5H1UA 4N4FA 4LKAA 3PURA 2YU4A 2KWNA 5B8DA 4P5OB 1WGMA 4A49A 2YHNA 4W4UA 3SOWA 5TDWA 3EB6A 2FUIA 4XI1A 2G6QA 2ECTA 3HCTA 2KWOA 2HYED 4WZ3B 4GNFA 2Y1MA 3O34A 2YUCA 2VJEA 2YREA 3U5OA 2EA6A 2ECGA 3PHDA 2ECWA 4NN2A 2MNYA 5I3LA 3MHHA 4I7BA 2LGLA 1K2FA 3NG2A 3M62A 3FL2A 3O7AA 5G05B 3U5NA 2K17A 2YHOA 2F6JA 2OXQC 4WZ2A 1X4IA 1JOCA 2KREA 2M6MA 2PUYA 4FO9A 4C9ZA 4YADA 4YC9A 4UP5A 4Q6FA 5LKZA 2LGKA 2VPDA 5EYAF 4B86C 4LK9A 1FP0A 2YYRA 5C13A 4YATA 1RMDA 4ZUXU 3SHBA 5G04B 2VP7A 3N9OA 1WESA 1MM2A 2LDRA 5KH9A 1FBVA 2XEUA 3C5KA 3DQVR 1Z6UA 3RTRB 2ZETC 4GNDA 3L1XA 1WILA 3RPGC 4AVXA 4PTBA 2BAYA 4QF3A 5TRBA 5KH7A 5B76A 5H1TA 4GB0A 1WEOA 4I7DA 3EB5A 4LADB 4GNGA 4F52B 2YSJA 3O70A 2VPGA 5G0FA 3ZPV1 1WEMA 2CKLB 1VFYA 2RI7A 1LDJB 2MUMA 2F42A 1HYJA 1WEPA 2KU3A 2RSDA 2AN6A 4AYCA 5DINA 2KFTA 1LDKC 3N9LA 5B75A 2LQ6A 3GL6A 5KH3A 2KGIA 4R8PK 4I7CA 2M3HA 2DX8A 1BORA 3HCUA 4S3OB 2ECVA 2LGGA 3KNVA 3M99A 5D1KB 5C11A 2QICA 2KE1A 1WEUA 2Y43A 3ZVYA 2MA5A 2I50A 1WEVA 4UI9B 3KV6A 3T7LA 5AIUA 1ZBDB 2L5UA 2JMIA 2LRIC 4BHWA 2EODA 4O64A 3L11A 3HTKC 3QZVA 1F62A 5JG6A 5J3XA 1HYIA 4AP4A 4ZQLA 3HCSA 4R2YA 2KGGA 1U6GB 2VJFB 3LQHA 4AUQB 1MM3A 4MVTA 1X4UA 4YABA 1DVPA 3PUQA 2XB1A 2G45A 2UZGA 2NAAA 4CCGX 2ECNA 2K1JA 4CA1A 3KV5A 2KWJA 3KQIA 1X4JA 4B7YC 3N9NA 5FERA 4A4CA 2YSMA 3M63A 2VNFA 3N9QA 4A0CD 3DPLR 5FEYA 3VK6A 2MT5A 2C2LA 3LRQA 3ZPVE 2H0DA 4YBSA 4ZDTA 4IC2A 5LKXA 5H9MA 3IHPA 2KWKA 2CSYA 4IC3A 2L43A 1G25A 1N87A 1WE9A 3ZVZB 4S3OC 3O33A 3ZTGA 1CHCA 1WFKA 2MNZA 2H0DB 1V87A 2JMDA 5LCWB 2L75A 2CSZA 2VPEA 3MHSA 4X3GA 2M85A 3SOXA 5B77A 3T6RA 1Z60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LXP C;  2YQL A;  4FIP A;  2C2V S;  1WEQ A;  5B79 A;  2IDA A;  1VD4 A;  4PPE A;  2YT5 A;  2LV9 A;  2MIQ A;  2PNX A;  5FB1 A;  3ZYQ A;  2EGP A;  3GV4 A;  2E6R A;  1T1H A;  4MSX A;  4N3W A;  3N9P A;  1E4U A;  2KR4 A;  3N9M A;  1WEE A;  4L7X A;  4LLB A;  2YUR A;  4A4B A;  2VJF A;  3I2D A;  5TAB A;  5H1V A;  4TKP B;  2LN0 A;  2FSA A;  2CT2 A;  2YW8 A;  2VPB A;  2L0B A;  3U5M A;  2CKL A;  1WEW A;  3ASL A;  4V3K C;  2MA6 A;  4AYC B;  2FUU A;  2KYU A;  2K4D A;  3LQI A;  4YAX A;  5D1L B;  2JRJ A;  1VYX A;  2YQM A;  3O37 A;  2ECI A;  3O36 A;  2F6N A;  5FB0 A;  4YBM A;  1WIM A;  3V43 A;  2Y1N A;  3L1Z B;  4L58 A;  4R7E A;  4LJN A;  3U5P A;  2ECJ A;  2MD7 B;  1Z2Q A;  2HDP A;  1XWH A;  5B78 A;  2M1R A;  4GNE A;  4YBT A;  1JM7 A;  2G43 A;  2QJ0 A;  5LKU A;  2KIZ A;  3C6W A;  4WZ0 A;  1IYM A;  3SOU A;  4BBQ A;  5D1M B;  1WEN A;  3ZNI A;  3LQJ A;  2QIZ A;  3RPG B;  4UP0 A;  2D8S A;  2JMJ A;  3O35 A;  5TBN A;  2L80 A;  4QF2 A;  4V3L C;  5DKA A;  5TDR A;  2MD8 C;  2K16 A;  2VJE B;  2E6S A;  2LXH C;  4FK5 A;  4FJC A;  4WA6 A;  2LGV A;  1JM7 B;  5AIT A;  5LKT A;  5H1U A;  4N4F A;  4LKA A;  3PUR A;  2YU4 A;  2KWN A;  5B8D A;  4P5O B;  1WGM A;  4A49 A;  2YHN A;  4W4U A;  3SOW A;  5TDW A;  3EB6 A;  2FUI A;  4XI1 A;  2G6Q A;  2ECT A;  3HCT A;  2KWO A;  2HYE D;  4WZ3 B;  4GNF A;  2Y1M A;  3O34 A;  2YUC A;  2VJE A;  2YRE A;  3U5O A;  2EA6 A;  2ECG A;  3PHD A;  2ECW A;  4NN2 A;  2MNY A;  5I3L A;  3MHH A;  4I7B A;  2LGL A;  1K2F A;  3NG2 A;  3M62 A;  3FL2 A;  3O7A A;  5G05 B;  3U5N A;  2K17 A;  2YHO A;  2F6J A;  2OXQ C;  4WZ2 A;  1X4I A;  1JOC A;  2KRE A;  2M6M A;  2PUY A;  4FO9 A;  4C9Z A;  4YAD A;  4YC9 A;  4UP5 A;  4Q6F A;  5LKZ A;  2LGK A;  2VPD A;  5EYA F;  4B86 C;  4LK9 A;  1FP0 A;  2YYR A;  5C13 A;  4YAT A;  1RMD A;  4ZUX U;  3SHB A;  5G04 B;  2VP7 A;  3N9O A;  1WES A;  1MM2 A;  2LDR A;  5KH9 A;  1FBV A;  2XEU A;  3C5K A;  3DQV R;  1Z6U A;  3RTR B;  2ZET C;  4GND A;  3L1X A;  1WIL A;  3RPG C;  4AVX A;  4PTB A;  2BAY A;  4QF3 A;  5TRB A;  5KH7 A;  5B76 A;  5H1T A;  4GB0 A;  1WEO A;  4I7D A;  3EB5 A;  4LAD B;  4GNG A;  4F52 B;  2YSJ A;  3O70 A;  2VPG A;  5G0F A;  3ZPV 1;  1WEM A;  2CKL B;  1VFY A;  2RI7 A;  1LDJ B;  2MUM A;  2F42 A;  1HYJ A;  1WEP A;  2KU3 A;  2RSD A;  2AN6 A;  4AYC A;  5DIN A;  2KFT A;  1LDK C;  3N9L A;  5B75 A;  2LQ6 A;  3GL6 A;  5KH3 A;  2KGI A;  4R8P K;  4I7C A;  2M3H A;  2DX8 A;  1BOR A;  3HCU A;  4S3O B;  2ECV A;  2LGG A;  3KNV A;  3M99 A;  5D1K B;  5C11 A;  2QIC A;  2KE1 A;  1WEU A;  2Y43 A;  3ZVY A;  2MA5 A;  2I50 A;  1WEV A;  4UI9 B;  3KV6 A;  3T7L A;  5AIU A;  1ZBD B;  2L5U A;  2JMI A;  2LRI C;  4BHW A;  2EOD A;  4O64 A;  3L11 A;  3HTK C;  3QZV A;  1F62 A;  5JG6 A;  5J3X A;  1HYI A;  4AP4 A;  4ZQL A;  3HCS A;  4R2Y A;  2KGG A;  1U6G B;  2VJF B;  3LQH A;  4AUQ B;  1MM3 A;  4MVT A;  1X4U A;  4YAB A;  1DVP A;  3PUQ A;  2XB1 A;  2G45 A;  2UZG A;  2NAA A;  4CCG X;  2ECN A;  2K1J A;  4CA1 A;  3KV5 A;  2KWJ A;  3KQI A;  1X4J A;  4B7Y C;  3N9N A;  5FER A;  4A4C A;  2YSM A;  3M63 A;  2VNF A;  3N9Q A;  4A0C D;  3DPL R;  5FEY A;  3VK6 A;  2MT5 A;  2C2L A;  3LRQ A;  3ZPV E;  2H0D A;  4YBS A;  4ZDT A;  4IC2 A;  5LKX A;  5H9M A;  3IHP A;  2KWK A;  2CSY A;  4IC3 A;  2L43 A;  1G25 A;  1N87 A;  1WE9 A;  3ZVZ B;  4S3O C;  3O33 A;  3ZTG A;  1CHC A;  1WFK A;  2MNZ A;  2H0D B;  1V87 A;  2JMD A;  5LCW B;  2L75 A;  2CSZ A;  2VPE A;  3MHS A;  4X3G A;  2M85 A;  3SOX A;  5B77 A;  3T6R A;  1Z60 A; 
#chains in the Genus database with same CATH topology
 2LXP C;  2YQL A;  4FIP A;  3PLW A;  2C2V S;  1WEQ A;  5B79 A;  2IDA A;  2B0O E;  5SVI A;  1VD4 A;  4PPE A;  2YT5 A;  2LV9 A;  2MIQ A;  2PNX A;  3M7K A;  5FB1 A;  5SVY A;  2CON A;  2XP0 A;  4H9D A;  3ZYQ A;  2EGP A;  3GV4 A;  2E6R A;  1T1H A;  4MSX A;  4N3W A;  3N9P A;  1E4U A;  2KR4 A;  3N9M A;  1WEE A;  4L7X A;  4LLB A;  5K3Q A;  2YUR A;  4A4B A;  2VJF A;  2XOC A;  3I2D A;  2FFW A;  5TAB A;  2CRW A;  5H1V A;  2FD4 A;  4TKP B;  2LN0 A;  2FSA A;  2CT2 A;  2YW8 A;  2VPB A;  2L0B A;  4Z0R A;  3U5M A;  2CKL A;  1WEW A;  3ASL A;  4V3K C;  2MA6 A;  3E2D A;  4AYC B;  3SUB A;  2FUU A;  2KYU A;  2K4D A;  3LQI A;  4YAX A;  5D1L B;  2JRJ A;  3H7H A;  1VYX A;  2YQM A;  3O37 A;  2ECI A;  3O36 A;  2F6N A;  5FB0 A;  4YBM A;  3O47 A;  1WIM A;  3V43 A;  2Y1N A;  3FM8 C;  3L1Z B;  4L58 A;  4R7E A;  4Z0O A;  4LJN A;  3U5P A;  2ECJ A;  2MD7 B;  1Z2Q A;  2HDP A;  1XWH A;  5B78 A;  2M1R A;  4GNE A;  4YBT A;  1JM7 A;  2G43 A;  3T9K A;  2QJ0 A;  5LKU A;  2KIZ A;  3C6W A;  4WZ0 A;  1IYM A;  3SOU A;  4BBQ A;  5D1M B;  1WEN A;  3ZNI A;  3LQJ A;  2QIZ A;  3RPG B;  4UP0 A;  2D8S A;  2JMJ A;  3O35 A;  5SVI B;  5TBN A;  2L80 A;  3DDT A;  4QF2 A;  4V3L C;  5DKA A;  5TDR A;  2MD8 C;  2K16 A;  4OGE A;  2VJE B;  2E6S A;  2LXH C;  4FK5 A;  4FJC A;  4WA6 A;  2LGV A;  1JM7 B;  5AIT A;  5LKT A;  2P57 A;  5H1U A;  4N4F A;  4LKA A;  3PUR A;  2YU4 A;  2KWN A;  5B8D A;  4P5O B;  1WGM A;  4A49 A;  2YHN A;  2MKE A;  2CSV A;  4W4U A;  3SOW A;  5TDW A;  3EB6 A;  2FUI A;  2JUN A;  4XI1 A;  2G6Q A;  2ECT A;  1Z60 A;  3HCT A;  2JM3 A;  2KWO A;  2RR4 A;  2HYE D;  4WZ3 B;  4GNF A;  2Y1M A;  3O34 A;  2YUC A;  2VJE A;  2YRE A;  3U5O A;  2EA6 A;  1DCQ A;  2ECG A;  3PHD A;  2ECW A;  4NN2 A;  2MNY A;  5I3L A;  3MHH A;  3Q1D A;  4I7B A;  2LGL A;  1K2F A;  3NG2 A;  2KKY A;  3M62 A;  3FL2 A;  3O7A A;  5G05 B;  3U5N A;  2K17 A;  2YHO A;  2F6J A;  2OXQ C;  4WZ2 A;  1X4I A;  1JOC A;  2KRE A;  2M6M A;  2PUY A;  4FO9 A;  4C9Z A;  2LAU A;  4YAD A;  4YC9 A;  4UP5 A;  4Q6F A;  5LKZ A;  2LGK A;  2VPD A;  5EYA F;  4B86 C;  4LK9 A;  1FP0 A;  2YYR A;  5C13 A;  4YAT A;  1RMD A;  4ZUX U;  3SHB A;  5G04 B;  2VP7 A;  3N9O A;  3FAO A;  1WES A;  1MM2 A;  2LDR A;  2L7P A;  5KH9 A;  1FBV A;  2XEU A;  3C5K A;  3DQV R;  1Z6U A;  3RTR B;  3FEH A;  3KDE C;  2ZET C;  4GND A;  3L1X A;  1WIL A;  3RPG C;  4AVX A;  4PTB A;  2BAY A;  4QF3 A;  3LDY A;  5TRB A;  5KH7 A;  5B76 A;  5H1T A;  4GB0 A;  1WEO A;  3LJU X;  4I7D A;  3EB5 A;  4LAD B;  4GNG A;  4F52 B;  2M13 A;  2YSJ A;  2VPG A;  3O70 A;  5G0F A;  3ZPV 1;  1WEM A;  3MDB C;  2CKL B;  2D8U A;  1VFY A;  2RI7 A;  1LDJ B;  2MUM A;  2F42 A;  1HYJ A;  1WEP A;  3LVQ E;  2KU3 A;  2RSD A;  2AN6 A;  4AYC A;  4QQ4 A;  5DIN A;  2KFT A;  1LDK C;  3N9L A;  4O62 A;  5B75 A;  2LQ6 A;  3GL6 A;  5KH3 A;  2KGI A;  4R8P K;  4I7C A;  2M3H A;  4OGC A;  2DX8 A;  1BOR A;  3HCU A;  4S3O B;  3JUE A;  2ECV A;  2LGG A;  3KNV A;  3M99 A;  5D1K B;  5C11 A;  2QIC A;  2KE1 A;  1WEU A;  2Y43 A;  3ZVY A;  3DWD A;  2MA5 A;  2I50 A;  2KKX A;  3LVR E;  1WEV A;  4UI9 B;  3KV6 A;  2DSM A;  3T7L A;  5AIU A;  1ZBD B;  2L5U A;  2JMI A;  2LRI C;  4BHW A;  2DJA A;  2EOD A;  4O64 A;  3L11 A;  3HTK C;  3QZV A;  1F62 A;  5JG6 A;  5J3X A;  1HYI A;  3FJU B;  4AP4 A;  2XOY A;  4ZQL A;  3HCS A;  4R2Y A;  2KGG A;  1U6G B;  2VJF B;  3LQH A;  4AUQ B;  2EGM A;  1MM3 A;  4MVT A;  1X4U A;  4YAB A;  1DVP A;  3PUQ A;  2XB1 A;  2G45 A;  2UZG A;  2NAA A;  4CCG X;  2ECN A;  2K1J A;  4CA1 A;  2CRR A;  3KV5 A;  2KWJ A;  3KQI A;  1X4J A;  4B7Y C;  3N9N A;  5FER A;  4A4C A;  2YSM A;  3M63 A;  2VNF A;  3N9Q A;  4A0C D;  3DPL R;  5FEY A;  3VK6 A;  2MT5 A;  2C2L A;  3LRQ A;  3ZPV E;  2YVR A;  2H0D A;  4YBS A;  4ZDT A;  4IC2 A;  5LKX A;  5H9M A;  3IHP A;  2KWK A;  2CSY A;  3FAN A;  4IC3 A;  2E61 A;  2L43 A;  1G25 A;  2OWA A;  1N87 A;  2XOZ A;  1WE9 A;  3ZVZ B;  4S3O C;  3O33 A;  3ZTG A;  1CHC A;  1WFK A;  2MNZ A;  4F1P A;  2H0D B;  1V87 A;  2JMD A;  5LCW B;  2L75 A;  2EXU A;  2CSZ A;  2VPE A;  3MHS A;  4X3G A;  2M85 A;  5SVX A;  3SOX A;  1MBM A;  5B77 A;  3T6R A;  2IQJ A; 
#chains in the Genus database with same CATH homology
 2LXP C;  2YQL A;  4FIP A;  2C2V S;  1WEQ A;  5B79 A;  2IDA A;  1VD4 A;  4PPE A;  2YT5 A;  2LV9 A;  2MIQ A;  2PNX A;  5FB1 A;  3ZYQ A;  2EGP A;  3GV4 A;  2E6R A;  1T1H A;  4MSX A;  4N3W A;  3N9P A;  1E4U A;  2KR4 A;  3N9M A;  1WEE A;  4L7X A;  4LLB A;  2YUR A;  4A4B A;  2VJF A;  3I2D A;  5TAB A;  5H1V A;  4TKP B;  2LN0 A;  2FSA A;  2CT2 A;  2YW8 A;  2VPB A;  2L0B A;  3U5M A;  2CKL A;  1WEW A;  3ASL A;  4V3K C;  2MA6 A;  4AYC B;  2FUU A;  2KYU A;  2K4D A;  3LQI A;  4YAX A;  5D1L B;  2JRJ A;  1VYX A;  2YQM A;  3O37 A;  2ECI A;  3O36 A;  2F6N A;  5FB0 A;  4YBM A;  1WIM A;  3V43 A;  2Y1N A;  3L1Z B;  4L58 A;  4R7E A;  4LJN A;  3U5P A;  2ECJ A;  2MD7 B;  1Z2Q A;  2HDP A;  1XWH A;  5B78 A;  2M1R A;  4GNE A;  4YBT A;  1JM7 A;  2G43 A;  2QJ0 A;  5LKU A;  2KIZ A;  3C6W A;  4WZ0 A;  1IYM A;  3SOU A;  4BBQ A;  5D1M B;  1WEN A;  3ZNI A;  3LQJ A;  2QIZ A;  3RPG B;  4UP0 A;  2D8S A;  2JMJ A;  3O35 A;  5TBN A;  2L80 A;  4QF2 A;  4V3L C;  5DKA A;  5TDR A;  2MD8 C;  2K16 A;  2VJE B;  2E6S A;  2LXH C;  4FK5 A;  4FJC A;  4WA6 A;  2LGV A;  1JM7 B;  5AIT A;  5LKT A;  5H1U A;  4N4F A;  4LKA A;  3PUR A;  2YU4 A;  2KWN A;  5B8D A;  4P5O B;  1WGM A;  4A49 A;  2YHN A;  4W4U A;  3SOW A;  5TDW A;  3EB6 A;  2FUI A;  4XI1 A;  2G6Q A;  2ECT A;  3HCT A;  2KWO A;  2HYE D;  4WZ3 B;  4GNF A;  2Y1M A;  3O34 A;  2YUC A;  2VJE A;  2YRE A;  3U5O A;  2EA6 A;  2ECG A;  3PHD A;  2ECW A;  4NN2 A;  2MNY A;  5I3L A;  3MHH A;  4I7B A;  2LGL A;  1K2F A;  3NG2 A;  3M62 A;  3FL2 A;  3O7A A;  5G05 B;  3U5N A;  2K17 A;  2YHO A;  2F6J A;  2OXQ C;  4WZ2 A;  1X4I A;  1JOC A;  2KRE A;  2M6M A;  2PUY A;  4FO9 A;  4C9Z A;  4YAD A;  4YC9 A;  4UP5 A;  4Q6F A;  5LKZ A;  2LGK A;  2VPD A;  5EYA F;  4B86 C;  4LK9 A;  1FP0 A;  2YYR A;  5C13 A;  4YAT A;  1RMD A;  4ZUX U;  3SHB A;  5G04 B;  2VP7 A;  3N9O A;  1WES A;  1MM2 A;  2LDR A;  5KH9 A;  1FBV A;  2XEU A;  3C5K A;  3DQV R;  1Z6U A;  3RTR B;  2ZET C;  4GND A;  3L1X A;  1WIL A;  3RPG C;  4AVX A;  4PTB A;  2BAY A;  4QF3 A;  5TRB A;  5KH7 A;  5B76 A;  5H1T A;  4GB0 A;  1WEO A;  4I7D A;  3EB5 A;  4LAD B;  4GNG A;  4F52 B;  2YSJ A;  3O70 A;  2VPG A;  5G0F A;  3ZPV 1;  1WEM A;  2CKL B;  1VFY A;  2RI7 A;  1LDJ B;  2MUM A;  2F42 A;  1HYJ A;  1WEP A;  2KU3 A;  2RSD A;  2AN6 A;  4AYC A;  5DIN A;  2KFT A;  1LDK C;  3N9L A;  5B75 A;  2LQ6 A;  3GL6 A;  5KH3 A;  2KGI A;  4R8P K;  4I7C A;  2M3H A;  2DX8 A;  1BOR A;  3HCU A;  4S3O B;  2ECV A;  2LGG A;  3KNV A;  3M99 A;  5D1K B;  5C11 A;  2QIC A;  2KE1 A;  1WEU A;  2Y43 A;  3ZVY A;  2MA5 A;  2I50 A;  1WEV A;  4UI9 B;  3KV6 A;  3T7L A;  5AIU A;  1ZBD B;  2L5U A;  2JMI A;  2LRI C;  4BHW A;  2EOD A;  4O64 A;  3L11 A;  3HTK C;  3QZV A;  1F62 A;  5JG6 A;  5J3X A;  1HYI A;  4AP4 A;  4ZQL A;  3HCS A;  4R2Y A;  2KGG A;  1U6G B;  2VJF B;  3LQH A;  4AUQ B;  1MM3 A;  4MVT A;  1X4U A;  4YAB A;  1DVP A;  3PUQ A;  2XB1 A;  2G45 A;  2UZG A;  2NAA A;  4CCG X;  2ECN A;  2K1J A;  4CA1 A;  3KV5 A;  2KWJ A;  3KQI A;  1X4J A;  4B7Y C;  3N9N A;  5FER A;  4A4C A;  2YSM A;  3M63 A;  2VNF A;  3N9Q A;  4A0C D;  3DPL R;  5FEY A;  3VK6 A;  2MT5 A;  2C2L A;  3LRQ A;  3ZPV E;  2H0D A;  4YBS A;  4ZDT A;  4IC2 A;  5LKX A;  5H9M A;  3IHP A;  2KWK A;  2CSY A;  4IC3 A;  2L43 A;  1G25 A;  1N87 A;  1WE9 A;  3ZVZ B;  4S3O C;  3O33 A;  3ZTG A;  1CHC A;  1WFK A;  2MNZ A;  2H0D B;  1V87 A;  2JMD A;  5LCW B;  2L75 A;  2CSZ A;  2VPE A;  3MHS A;  4X3G A;  2M85 A;  3SOX A;  5B77 A;  3T6R A;  1Z60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...