4A49A

Structure of phosphotyr371-c-cbl-ubch5b complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
77
structure length
76
Chain Sequence
b'DHIKVTQEQFELCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCRCEIKGTEPIVVDPFD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase CBL
publication title Structural basis for autoinhibition and phosphorylation-dependent activation of c-Cbl.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 20
structure length 76
sequence length 77
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14447 Prok-RING_4 Prokaryotic RING finger family 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4a49A00
4V3LC 2Y1NA 4YBMA 3QZVA 4ZDTA 2VJEB 1VFYA 2L80A 2KWKA 2EGPA 4NN2A 5H1VA 2L5UA 2YSJA 3N9LA 3N9PA 2CT2A 5B76A 4WZ2A 2ECVA 1RMDA 3KV6A 1F62A 2AN6A 5D1MB 2VP7A 5TDRA 4GB0A 2CKLA 3I2DA 3LQIA 2H0DB 3O33A 4FK5A 1V87A 2QIZA 2LRIC 4PTBA 1Z2QA 3O36A 3RTRB 3KNVA 4CCGX 4C9ZA 4S3OB 3U5OA 3HCSA 2KWOA 2VPBA 2K17A 2YHOA 1WEQA 2L0BA 2MA6A 2Y43A 3M99A 2ECTA 1T1HA 2C2LA 5C11A 2LGKA 3GV4A 2EODA 4WZ0A 5LKXA 2YQLA 5KH9A 1WEEA 5B75A 5LKZA 4XI1A 2XEUA 2JRJA 5B8DA 1XWHA 4L58A 2YUCA 2G6QA 3ZYQA 2M85A 2LQ6A 3ZPVE 3N9QA 2MUMA 3VK6A 2G45A 2NAAA 4YAXA 3IHPA 5TRBA 3N9OA 4TKPB 2CKLB 2KFTA 4I7CA 1HYIA 1JM7A 1WEVA 2KU3A 1WEUA 2YW8A 3M63A 4YBSA 5DINA 5LKUA 4LJNA 4FJCA 2QJ0A 2ZETC 1VD4A 1U6GB 1WESA 1G25A 1K2FA 2UZGA 2ECIA 4L7XA 3HTKC 4P5OB 3SHBA 2K4DA 2MNZA 4I7BA 5H9MA 4B86C 2VJFA 2VPEA 2MA5A 1WEOA 2RSDA 2YSMA 2CSZA 4LKAA 2YQMA 4GNFA 3ZPV1 1Z6UA 5C13A 3RPGC 4UI9B 2JMIA 4AVXA 3PHDA 4ZUXU 3N9MA 1LDKC 2K1JA 2LXPC 2KREA 5D1KB 1JM7B 3U5MA 2LGVA 2HDPA 2JMJA 2CSYA 5DKAA 4FIPA 2L43A 5H1UA 1WE9A 3T6RA 1BORA 2KIZA 2YT5A 4FO9A 3O34A 3SOXA 2M3HA 2PUYA 4X3GA 2E6RA 3PURA 4BBQA 3O37A 4BHWA 2VJFB 5AIUA 2YURA 3NG2A 4GNDA 4YATA 4W4UA 2KWJA 5JG6A 2F42A 4I7DA 2LGLA 2Y1MA 2F6NA 4O64A 3L1XA 4AYCA 3LRQA 2KE1A 4QF3A 4R2YA 4YBTA 2F6JA 3FL2A 2FUUA 4IC3A 4N4FA 5G05B 2ECJA 2G43A 2KR4A 3M62A 1N87A 2LN0A 5B77A 1WENA 1Z60A 2FUIA 1DVPA 4Q6FA 3LQHA 2PNXA 3U5PA 4CA1A 3O7AA 2LXHC 2ECGA 2MD8C 3DQVR 2KGGA 2YYRA 4B7YC 1HYJA 5D1LB 3V43A 4YADA 5G04B 4WA6A 2MD7B 4ZQLA 1LDJB 5TABA 3DPLR 2ECNA 2MIQA 3HCTA 4F52B 3MHSA 4R8PK 3ZVYA 4QF2A 3PUQA 3ZVZB 4UP0A 2I50A 2MNYA 2C2VS 4YABA 4GNEA 2IDAA 5B78A 3T7LA 3RPGB 3ASLA 1WIMA 4AYCB 4AUQB 4AP4A 2E6SA 1WEPA 3O70A 2OXQC 3LQJA 3MHHA 4LLBA 5H1TA 3KV5A 2YU4A 3N9NA 5EYAF 3C5KA 5TDWA 2K16A 4A4CA 3SOWA 4V3KC 2KGIA 3L1ZB 3HCUA 4WZ3B 3EB5A 1ZBDB 2EA6A 2VNFA 3L11A 2QICA 4PPEA 3KQIA 5J3XA 4S3OC 2L75A 4R7EA 5G0FA 1MM2A 3U5NA 2VPDA 3O35A 1WEMA 4GNGA 1VYXA 1WEWA 2M1RA 2XB1A 5LKTA 1WGMA 5FEYA 1WILA 5FB1A 5KH7A 1FP0A 4A4BA 3C6WA 4YC9A 2BAYA 3GL6A 2VJEA 5I3LA 1X4IA 2LV9A 5B79A 2KWNA 4UP5A 1E4UA 2H0DA 4N3WA 5TBNA 2MT5A 2YHNA 3EB6A 3ZNIA 1MM3A 2FSAA 1WFKA 2YREA 1X4UA 1X4JA 5LCWB 2LDRA 1CHCA 2D8SA 2HYED 4MVTA 1JOCA 2DX8A 5FB0A 2RI7A 2JMDA 2LGGA 2ECWA 4MSXA 4LK9A 2M6MA 5AITA 2VPGA 5FERA 5KH3A 1FBVA 3ZTGA 1IYMA 4A49A 4LADB 2KYUA 4IC2A 4A0CD 3SOUA
chains in the Genus database with same CATH superfamily
2DSMA 4V3LC 2Y1NA 4YBMA 3QZVA 4ZDTA 2VJEB 1VFYA 2L80A 2KWKA 2EGPA 3LDYA 4NN2A 2L5UA 2RR4A 2YSJA 3N9LA 5H1VA 3N9PA 2CT2A 2YVRA 5B76A 4WZ2A 2ECVA 1RMDA 3KV6A 1F62A 2AN6A 5D1MB 4H9DA 2VP7A 5TDRA 4GB0A 2CKLA 3I2DA 3LQIA 2H0DB 3O33A 4FK5A 1V87A 2CONA 2QIZA 2LRIC 4PTBA 1Z2QA 3O36A 3RTRB 3KNVA 4CCGX 4C9ZA 4Z0OA 4S3OB 3U5OA 3T9KA 3HCSA 2KWOA 5SVIB 2VPBA 2K17A 2YHOA 1WEQA 2L0BA 2MA6A 2Y43A 3M99A 2ECTA 1T1HA 2C2LA 5C11A 2LGKA 3GV4A 2EODA 2XOZA 2L7PA 4WZ0A 5LKXA 2YQLA 5KH9A 1WEEA 5B75A 5LKZA 4XI1A 2XEUA 2JRJA 5B8DA 1XWHA 4L58A 2YUCA 4O62A 2G6QA 3ZYQA 2M85A 2LQ6A 2IQJA 2M13A 3ZPVE 2FD4A 3N9QA 2MUMA 3VK6A 2G45A 2NAAA 4YAXA 3IHPA 5TRBA 3N9OA 4TKPB 3FJUB 2CKLB 4F1PA 2KFTA 4I7CA 1HYIA 1JM7A 1WEVA 2KU3A 1WEUA 2YW8A 3M63A 4YBSA 5K3QA 1DCQA 5DINA 5LKUA 4LJNA 4FJCA 2QJ0A 2ZETC 4QQ4A 3FM8C 3LVRE 1VD4A 2CSVA 1U6GB 1WESA 1G25A 1K2FA 2UZGA 2ECIA 2XP0A 3HTKC 4L7XA 4P5OB 3SHBA 2K4DA 2MNZA 4I7BA 5H9MA 4B86C 2VJFA 2VPEA 2MA5A 1WEOA 2RSDA 2YSMA 2CSZA 4LKAA 2E61A 2YQMA 4GNFA 3ZPV1 1Z6UA 5C13A 3RPGC 3MDBC 3FANA 2OWAA 2CRRA 4UI9B 2JMIA 4AVXA 3PHDA 4ZUXU 3N9MA 1LDKC 2K1JA 2LXPC 2KREA 5D1KB 1JM7B 3U5MA 2LGVA 2HDPA 2JMJA 2FFWA 2CSYA 5DKAA 4FIPA 2L43A 5H1UA 1WE9A 3T6RA 1BORA 2KIZA 2YT5A 4FO9A 3O34A 2EGMA 3SOXA 3M7KA 2M3HA 2PUYA 4X3GA 3PLWA 2E6RA 3PURA 2JM3A 4BBQA 3O37A 4BHWA 2VJFB 5AIUA 2YURA 2MKEA 3NG2A 4GNDA 4YATA 4W4UA 2KWJA 2XOCA 5JG6A 2F42A 4I7DA 2LGLA 2Y1MA 2F6NA 4O64A 3L1XA 4AYCA 2XOYA 3LRQA 2KE1A 4QF3A 4R2YA 4YBTA 2F6JA 3FL2A 2FUUA 4IC3A 4N4FA 5G05B 2ECJA 2G43A 5SVXA 3Q1DA 2KR4A 3M62A 1N87A 2LN0A 5B77A 1WENA 1Z60A 2FUIA 1DVPA 4Q6FA 3LQHA 2PNXA 3U5PA 4CA1A 3O7AA 2LXHC 2ECGA 2MD8C 3DQVR 2KGGA 2YYRA 4B7YC 1HYJA 5D1LB 3V43A 4YADA 5G04B 4WA6A 2MD7B 4ZQLA 3H7HA 1LDJB 2D8UA 2P57A 5TABA 3DPLR 2ECNA 2MIQA 3HCTA 4F52B 2DJAA 3MHSA 4R8PK 3ZVYA 4QF2A 3PUQA 3ZVZB 4UP0A 2I50A 3FEHA 2MNYA 2C2VS 4Z0RA 4YABA 4GNEA 2IDAA 5B78A 3T7LA 3RPGB 2LAUA 3ASLA 1WIMA 4AYCB 4AUQB 4AP4A 2E6SA 1WEPA 3O70A 2OXQC 3FAOA 3LQJA 3MHHA 4LLBA 5H1TA 3KV5A 2YU4A 3N9NA 5EYAF 3C5KA 5TDWA 2K16A 4A4CA 3SOWA 4V3KC 2KGIA 3DDTA 3L1ZB 3HCUA 4WZ3B 3EB5A 1ZBDB 2EA6A 2VNFA 3L11A 2QICA 1MBMA 3KQIA 4PPEA 5J3XA 4S3OC 2L75A 2JUNA 4R7EA 5G0FA 1MM2A 3U5NA 2VPDA 3O35A 1WEMA 4GNGA 1VYXA 1WEWA 2M1RA 2XB1A 5LKTA 1WGMA 5FEYA 1WILA 4OGEA 5FB1A 5KH7A 3JUEA 1FP0A 4A4BA 3C6WA 4YC9A 2BAYA 3GL6A 2EXUA 3LVQE 2VJEA 2CRWA 3E2DA 5I3LA 1X4IA 3LJUX 2LV9A 3DWDA 2KWNA 4UP5A 5B79A 2B0OE 4OGCA 1E4UA 2H0DA 4N3WA 5TBNA 2MT5A 2YHNA 3EB6A 3ZNIA 1MM3A 2FSAA 1WFKA 2YREA 1X4UA 1X4JA 5LCWB 2KKYA 2LDRA 1CHCA 2D8SA 2HYED 4MVTA 1JOCA 3KDEC 2DX8A 5FB0A 3SUBA 2RI7A 2JMDA 2LGGA 2ECWA 4MSXA 4LK9A 2M6MA 5AITA 2VPGA 5SVIA 5FERA 5KH3A 1FBVA 3ZTGA 5SVYA 1IYMA 4A49A 4LADB 2KYUA 4IC2A 4A0CD 3O47A 2KKXA 3SOUA
chains in the Genus database with same CATH topology
4V3LC 2Y1NA 4YBMA 3QZVA 4ZDTA 2VJEB 1VFYA 2L80A 2KWKA 2EGPA 4NN2A 5H1VA 2L5UA 2YSJA 3N9LA 3N9PA 2CT2A 5B76A 4WZ2A 2ECVA 1RMDA 3KV6A 1F62A 2AN6A 5D1MB 2VP7A 5TDRA 4GB0A 2CKLA 3I2DA 3LQIA 2H0DB 3O33A 4FK5A 1V87A 2QIZA 2LRIC 4PTBA 1Z2QA 3O36A 3RTRB 3KNVA 4CCGX 4C9ZA 4S3OB 3U5OA 3HCSA 2KWOA 2VPBA 2K17A 2YHOA 1WEQA 2L0BA 2MA6A 2Y43A 3M99A 2ECTA 1T1HA 2C2LA 5C11A 2LGKA 3GV4A 2EODA 4WZ0A 5LKXA 2YQLA 5KH9A 1WEEA 5B75A 5LKZA 4XI1A 2XEUA 2JRJA 5B8DA 1XWHA 4L58A 2YUCA 2G6QA 3ZYQA 2M85A 2LQ6A 3ZPVE 3N9QA 2MUMA 3VK6A 2G45A 2NAAA 4YAXA 3IHPA 5TRBA 3N9OA 4TKPB 2CKLB 2KFTA 4I7CA 1HYIA 1JM7A 1WEVA 2KU3A 1WEUA 2YW8A 3M63A 4YBSA 5DINA 5LKUA 4LJNA 4FJCA 2QJ0A 2ZETC 1VD4A 1U6GB 1WESA 1G25A 1K2FA 2UZGA 2ECIA 4L7XA 3HTKC 4P5OB 3SHBA 2K4DA 2MNZA 4I7BA 5H9MA 4B86C 2VJFA 2VPEA 2MA5A 1WEOA 2RSDA 2YSMA 2CSZA 4LKAA 2YQMA 4GNFA 3ZPV1 1Z6UA 5C13A 3RPGC 4UI9B 2JMIA 4AVXA 3PHDA 4ZUXU 3N9MA 1LDKC 2K1JA 2LXPC 2KREA 5D1KB 1JM7B 3U5MA 2LGVA 2HDPA 2JMJA 2CSYA 5DKAA 4FIPA 2L43A 5H1UA 1WE9A 3T6RA 1BORA 2KIZA 2YT5A 4FO9A 3O34A 3SOXA 2M3HA 2PUYA 4X3GA 2E6RA 3PURA 4BBQA 3O37A 4BHWA 2VJFB 5AIUA 2YURA 3NG2A 4GNDA 4YATA 4W4UA 2KWJA 5JG6A 2F42A 4I7DA 2LGLA 2Y1MA 2F6NA 4O64A 3L1XA 4AYCA 3LRQA 2KE1A 4QF3A 4R2YA 4YBTA 2F6JA 3FL2A 2FUUA 4IC3A 4N4FA 5G05B 2ECJA 2G43A 2KR4A 3M62A 1N87A 2LN0A 5B77A 1WENA 1Z60A 2FUIA 1DVPA 4Q6FA 3LQHA 2PNXA 3U5PA 4CA1A 3O7AA 2LXHC 2ECGA 2MD8C 3DQVR 2KGGA 2YYRA 4B7YC 1HYJA 5D1LB 3V43A 4YADA 5G04B 4WA6A 2MD7B 4ZQLA 1LDJB 5TABA 3DPLR 2ECNA 2MIQA 3HCTA 4F52B 3MHSA 4R8PK 3ZVYA 4QF2A 3PUQA 3ZVZB 4UP0A 2I50A 2MNYA 2C2VS 4YABA 4GNEA 2IDAA 5B78A 3T7LA 3RPGB 3ASLA 1WIMA 4AYCB 4AUQB 4AP4A 2E6SA 1WEPA 3O70A 2OXQC 3LQJA 3MHHA 4LLBA 5H1TA 3KV5A 2YU4A 3N9NA 5EYAF 3C5KA 5TDWA 2K16A 4A4CA 3SOWA 4V3KC 2KGIA 3L1ZB 3HCUA 4WZ3B 3EB5A 1ZBDB 2EA6A 2VNFA 3L11A 2QICA 4PPEA 3KQIA 5J3XA 4S3OC 2L75A 4R7EA 5G0FA 1MM2A 3U5NA 2VPDA 3O35A 1WEMA 4GNGA 1VYXA 1WEWA 2M1RA 2XB1A 5LKTA 1WGMA 5FEYA 1WILA 5FB1A 5KH7A 1FP0A 4A4BA 3C6WA 4YC9A 2BAYA 3GL6A 2VJEA 5I3LA 1X4IA 2LV9A 5B79A 2KWNA 4UP5A 1E4UA 2H0DA 4N3WA 5TBNA 2MT5A 2YHNA 3EB6A 3ZNIA 1MM3A 2FSAA 1WFKA 2YREA 1X4UA 1X4JA 5LCWB 2LDRA 1CHCA 2D8SA 2HYED 4MVTA 1JOCA 2DX8A 5FB0A 2RI7A 2JMDA 2LGGA 2ECWA 4MSXA 4LK9A 2M6MA 5AITA 2VPGA 5FERA 5KH3A 1FBVA 3ZTGA 1IYMA 4A49A 4LADB 2KYUA 4IC2A 4A0CD 3SOUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4V3L C;  2Y1N A;  4YBM A;  3QZV A;  4ZDT A;  2VJE B;  1VFY A;  2L80 A;  2KWK A;  2EGP A;  4NN2 A;  5H1V A;  2L5U A;  2YSJ A;  3N9L A;  3N9P A;  2CT2 A;  5B76 A;  4WZ2 A;  2ECV A;  1RMD A;  3KV6 A;  1F62 A;  2AN6 A;  5D1M B;  2VP7 A;  5TDR A;  4GB0 A;  2CKL A;  3I2D A;  3LQI A;  2H0D B;  3O33 A;  4FK5 A;  1V87 A;  2QIZ A;  2LRI C;  4PTB A;  1Z2Q A;  3O36 A;  3RTR B;  3KNV A;  4CCG X;  4C9Z A;  4S3O B;  3U5O A;  3HCS A;  2KWO A;  2VPB A;  2K17 A;  2YHO A;  1WEQ A;  2L0B A;  2MA6 A;  2Y43 A;  3M99 A;  2ECT A;  1T1H A;  2C2L A;  5C11 A;  2LGK A;  3GV4 A;  2EOD A;  4WZ0 A;  5LKX A;  2YQL A;  5KH9 A;  1WEE A;  5B75 A;  5LKZ A;  4XI1 A;  2XEU A;  2JRJ A;  5B8D A;  1XWH A;  4L58 A;  2YUC A;  2G6Q A;  3ZYQ A;  2M85 A;  2LQ6 A;  3ZPV E;  3N9Q A;  2MUM A;  3VK6 A;  2G45 A;  2NAA A;  4YAX A;  3IHP A;  5TRB A;  3N9O A;  4TKP B;  2CKL B;  2KFT A;  4I7C A;  1HYI A;  1JM7 A;  1WEV A;  2KU3 A;  1WEU A;  2YW8 A;  3M63 A;  4YBS A;  5DIN A;  5LKU A;  4LJN A;  4FJC A;  2QJ0 A;  2ZET C;  1VD4 A;  1U6G B;  1WES A;  1G25 A;  1K2F A;  2UZG A;  2ECI A;  4L7X A;  3HTK C;  4P5O B;  3SHB A;  2K4D A;  2MNZ A;  4I7B A;  5H9M A;  4B86 C;  2VJF A;  2VPE A;  2MA5 A;  1WEO A;  2RSD A;  2YSM A;  2CSZ A;  4LKA A;  2YQM A;  4GNF A;  3ZPV 1;  1Z6U A;  5C13 A;  3RPG C;  4UI9 B;  2JMI A;  4AVX A;  3PHD A;  4ZUX U;  3N9M A;  1LDK C;  2K1J A;  2LXP C;  2KRE A;  5D1K B;  1JM7 B;  3U5M A;  2LGV A;  2HDP A;  2JMJ A;  2CSY A;  5DKA A;  4FIP A;  2L43 A;  5H1U A;  1WE9 A;  3T6R A;  1BOR A;  2KIZ A;  2YT5 A;  4FO9 A;  3O34 A;  3SOX A;  2M3H A;  2PUY A;  4X3G A;  2E6R A;  3PUR A;  4BBQ A;  3O37 A;  4BHW A;  2VJF B;  5AIU A;  2YUR A;  3NG2 A;  4GND A;  4YAT A;  4W4U A;  2KWJ A;  5JG6 A;  2F42 A;  4I7D A;  2LGL A;  2Y1M A;  2F6N A;  4O64 A;  3L1X A;  4AYC A;  3LRQ A;  2KE1 A;  4QF3 A;  4R2Y A;  4YBT A;  2F6J A;  3FL2 A;  2FUU A;  4IC3 A;  4N4F A;  5G05 B;  2ECJ A;  2G43 A;  2KR4 A;  3M62 A;  1N87 A;  2LN0 A;  5B77 A;  1WEN A;  1Z60 A;  2FUI A;  1DVP A;  4Q6F A;  3LQH A;  2PNX A;  3U5P A;  4CA1 A;  3O7A A;  2LXH C;  2ECG A;  2MD8 C;  3DQV R;  2KGG A;  2YYR A;  4B7Y C;  1HYJ A;  5D1L B;  3V43 A;  4YAD A;  5G04 B;  4WA6 A;  2MD7 B;  4ZQL A;  1LDJ B;  5TAB A;  3DPL R;  2ECN A;  2MIQ A;  3HCT A;  4F52 B;  3MHS A;  4R8P K;  3ZVY A;  4QF2 A;  3PUQ A;  3ZVZ B;  4UP0 A;  2I50 A;  2MNY A;  2C2V S;  4YAB A;  4GNE A;  2IDA A;  5B78 A;  3T7L A;  3RPG B;  3ASL A;  1WIM A;  4AYC B;  4AUQ B;  4AP4 A;  2E6S A;  1WEP A;  3O70 A;  2OXQ C;  3LQJ A;  3MHH A;  4LLB A;  5H1T A;  3KV5 A;  2YU4 A;  3N9N A;  5EYA F;  3C5K A;  5TDW A;  2K16 A;  4A4C A;  3SOW A;  4V3K C;  2KGI A;  3L1Z B;  3HCU A;  4WZ3 B;  3EB5 A;  1ZBD B;  2EA6 A;  2VNF A;  3L11 A;  2QIC A;  4PPE A;  3KQI A;  5J3X A;  4S3O C;  2L75 A;  4R7E A;  5G0F A;  1MM2 A;  3U5N A;  2VPD A;  3O35 A;  1WEM A;  4GNG A;  1VYX A;  1WEW A;  2M1R A;  2XB1 A;  5LKT A;  1WGM A;  5FEY A;  1WIL A;  5FB1 A;  5KH7 A;  1FP0 A;  4A4B A;  3C6W A;  4YC9 A;  2BAY A;  3GL6 A;  2VJE A;  5I3L A;  1X4I A;  2LV9 A;  5B79 A;  2KWN A;  4UP5 A;  1E4U A;  2H0D A;  4N3W A;  5TBN A;  2MT5 A;  2YHN A;  3EB6 A;  3ZNI A;  1MM3 A;  2FSA A;  1WFK A;  2YRE A;  1X4U A;  1X4J A;  5LCW B;  2LDR A;  1CHC A;  2D8S A;  2HYE D;  4MVT A;  1JOC A;  2DX8 A;  5FB0 A;  2RI7 A;  2JMD A;  2LGG A;  2ECW A;  4MSX A;  4LK9 A;  2M6M A;  5AIT A;  2VPG A;  5FER A;  5KH3 A;  1FBV A;  3ZTG A;  1IYM A;  4A49 A;  4LAD B;  2KYU A;  4IC2 A;  4A0C D;  3SOU A; 
#chains in the Genus database with same CATH topology
 2DSM A;  4V3L C;  2Y1N A;  4YBM A;  3QZV A;  4ZDT A;  2VJE B;  1VFY A;  2L80 A;  2KWK A;  2EGP A;  3LDY A;  4NN2 A;  2L5U A;  2RR4 A;  2YSJ A;  3N9L A;  5H1V A;  3N9P A;  2CT2 A;  2YVR A;  5B76 A;  4WZ2 A;  2ECV A;  1RMD A;  3KV6 A;  1F62 A;  2AN6 A;  5D1M B;  4H9D A;  2VP7 A;  5TDR A;  4GB0 A;  2CKL A;  3I2D A;  3LQI A;  2H0D B;  3O33 A;  4FK5 A;  1V87 A;  2CON A;  2QIZ A;  2LRI C;  4PTB A;  1Z2Q A;  3O36 A;  3RTR B;  3KNV A;  4CCG X;  4C9Z A;  4Z0O A;  4S3O B;  3U5O A;  3T9K A;  3HCS A;  2KWO A;  5SVI B;  2VPB A;  2K17 A;  2YHO A;  1WEQ A;  2L0B A;  2MA6 A;  2Y43 A;  3M99 A;  2ECT A;  1T1H A;  2C2L A;  5C11 A;  2LGK A;  3GV4 A;  2EOD A;  2XOZ A;  2L7P A;  4WZ0 A;  5LKX A;  2YQL A;  5KH9 A;  1WEE A;  5B75 A;  5LKZ A;  4XI1 A;  2XEU A;  2JRJ A;  5B8D A;  1XWH A;  4L58 A;  2YUC A;  4O62 A;  2G6Q A;  3ZYQ A;  2M85 A;  2LQ6 A;  2IQJ A;  2M13 A;  3ZPV E;  2FD4 A;  3N9Q A;  2MUM A;  3VK6 A;  2G45 A;  2NAA A;  4YAX A;  3IHP A;  5TRB A;  3N9O A;  4TKP B;  3FJU B;  2CKL B;  4F1P A;  2KFT A;  4I7C A;  1HYI A;  1JM7 A;  1WEV A;  2KU3 A;  1WEU A;  2YW8 A;  3M63 A;  4YBS A;  5K3Q A;  1DCQ A;  5DIN A;  5LKU A;  4LJN A;  4FJC A;  2QJ0 A;  2ZET C;  4QQ4 A;  3FM8 C;  3LVR E;  1VD4 A;  2CSV A;  1U6G B;  1WES A;  1G25 A;  1K2F A;  2UZG A;  2ECI A;  2XP0 A;  3HTK C;  4L7X A;  4P5O B;  3SHB A;  2K4D A;  2MNZ A;  4I7B A;  5H9M A;  4B86 C;  2VJF A;  2VPE A;  2MA5 A;  1WEO A;  2RSD A;  2YSM A;  2CSZ A;  4LKA A;  2E61 A;  2YQM A;  4GNF A;  3ZPV 1;  1Z6U A;  5C13 A;  3RPG C;  3MDB C;  3FAN A;  2OWA A;  2CRR A;  4UI9 B;  2JMI A;  4AVX A;  3PHD A;  4ZUX U;  3N9M A;  1LDK C;  2K1J A;  2LXP C;  2KRE A;  5D1K B;  1JM7 B;  3U5M A;  2LGV A;  2HDP A;  2JMJ A;  2FFW A;  2CSY A;  5DKA A;  4FIP A;  2L43 A;  5H1U A;  1WE9 A;  3T6R A;  1BOR A;  2KIZ A;  2YT5 A;  4FO9 A;  3O34 A;  2EGM A;  3SOX A;  3M7K A;  2M3H A;  2PUY A;  4X3G A;  3PLW A;  2E6R A;  3PUR A;  2JM3 A;  4BBQ A;  3O37 A;  4BHW A;  2VJF B;  5AIU A;  2YUR A;  2MKE A;  3NG2 A;  4GND A;  4YAT A;  4W4U A;  2KWJ A;  2XOC A;  5JG6 A;  2F42 A;  4I7D A;  2LGL A;  2Y1M A;  2F6N A;  4O64 A;  3L1X A;  4AYC A;  2XOY A;  3LRQ A;  2KE1 A;  4QF3 A;  4R2Y A;  4YBT A;  2F6J A;  3FL2 A;  2FUU A;  4IC3 A;  4N4F A;  5G05 B;  2ECJ A;  2G43 A;  5SVX A;  3Q1D A;  2KR4 A;  3M62 A;  1N87 A;  2LN0 A;  5B77 A;  1WEN A;  1Z60 A;  2FUI A;  1DVP A;  4Q6F A;  3LQH A;  2PNX A;  3U5P A;  4CA1 A;  3O7A A;  2LXH C;  2ECG A;  2MD8 C;  3DQV R;  2KGG A;  2YYR A;  4B7Y C;  1HYJ A;  5D1L B;  3V43 A;  4YAD A;  5G04 B;  4WA6 A;  2MD7 B;  4ZQL A;  3H7H A;  1LDJ B;  2D8U A;  2P57 A;  5TAB A;  3DPL R;  2ECN A;  2MIQ A;  3HCT A;  4F52 B;  2DJA A;  3MHS A;  4R8P K;  3ZVY A;  4QF2 A;  3PUQ A;  3ZVZ B;  4UP0 A;  2I50 A;  3FEH A;  2MNY A;  2C2V S;  4Z0R A;  4YAB A;  4GNE A;  2IDA A;  5B78 A;  3T7L A;  3RPG B;  2LAU A;  3ASL A;  1WIM A;  4AYC B;  4AUQ B;  4AP4 A;  2E6S A;  1WEP A;  3O70 A;  2OXQ C;  3FAO A;  3LQJ A;  3MHH A;  4LLB A;  5H1T A;  3KV5 A;  2YU4 A;  3N9N A;  5EYA F;  3C5K A;  5TDW A;  2K16 A;  4A4C A;  3SOW A;  4V3K C;  2KGI A;  3DDT A;  3L1Z B;  3HCU A;  4WZ3 B;  3EB5 A;  1ZBD B;  2EA6 A;  2VNF A;  3L11 A;  2QIC A;  1MBM A;  3KQI A;  4PPE A;  5J3X A;  4S3O C;  2L75 A;  2JUN A;  4R7E A;  5G0F A;  1MM2 A;  3U5N A;  2VPD A;  3O35 A;  1WEM A;  4GNG A;  1VYX A;  1WEW A;  2M1R A;  2XB1 A;  5LKT A;  1WGM A;  5FEY A;  1WIL A;  4OGE A;  5FB1 A;  5KH7 A;  3JUE A;  1FP0 A;  4A4B A;  3C6W A;  4YC9 A;  2BAY A;  3GL6 A;  2EXU A;  3LVQ E;  2VJE A;  2CRW A;  3E2D A;  5I3L A;  1X4I A;  3LJU X;  2LV9 A;  3DWD A;  2KWN A;  4UP5 A;  5B79 A;  2B0O E;  4OGC A;  1E4U A;  2H0D A;  4N3W A;  5TBN A;  2MT5 A;  2YHN A;  3EB6 A;  3ZNI A;  1MM3 A;  2FSA A;  1WFK A;  2YRE A;  1X4U A;  1X4J A;  5LCW B;  2KKY A;  2LDR A;  1CHC A;  2D8S A;  2HYE D;  4MVT A;  1JOC A;  3KDE C;  2DX8 A;  5FB0 A;  3SUB A;  2RI7 A;  2JMD A;  2LGG A;  2ECW A;  4MSX A;  4LK9 A;  2M6M A;  5AIT A;  2VPG A;  5SVI A;  5FER A;  5KH3 A;  1FBV A;  3ZTG A;  5SVY A;  1IYM A;  4A49 A;  4LAD B;  2KYU A;  4IC2 A;  4A0C D;  3O47 A;  2KKX A;  3SOU A; 
#chains in the Genus database with same CATH homology
 4V3L C;  2Y1N A;  4YBM A;  3QZV A;  4ZDT A;  2VJE B;  1VFY A;  2L80 A;  2KWK A;  2EGP A;  4NN2 A;  5H1V A;  2L5U A;  2YSJ A;  3N9L A;  3N9P A;  2CT2 A;  5B76 A;  4WZ2 A;  2ECV A;  1RMD A;  3KV6 A;  1F62 A;  2AN6 A;  5D1M B;  2VP7 A;  5TDR A;  4GB0 A;  2CKL A;  3I2D A;  3LQI A;  2H0D B;  3O33 A;  4FK5 A;  1V87 A;  2QIZ A;  2LRI C;  4PTB A;  1Z2Q A;  3O36 A;  3RTR B;  3KNV A;  4CCG X;  4C9Z A;  4S3O B;  3U5O A;  3HCS A;  2KWO A;  2VPB A;  2K17 A;  2YHO A;  1WEQ A;  2L0B A;  2MA6 A;  2Y43 A;  3M99 A;  2ECT A;  1T1H A;  2C2L A;  5C11 A;  2LGK A;  3GV4 A;  2EOD A;  4WZ0 A;  5LKX A;  2YQL A;  5KH9 A;  1WEE A;  5B75 A;  5LKZ A;  4XI1 A;  2XEU A;  2JRJ A;  5B8D A;  1XWH A;  4L58 A;  2YUC A;  2G6Q A;  3ZYQ A;  2M85 A;  2LQ6 A;  3ZPV E;  3N9Q A;  2MUM A;  3VK6 A;  2G45 A;  2NAA A;  4YAX A;  3IHP A;  5TRB A;  3N9O A;  4TKP B;  2CKL B;  2KFT A;  4I7C A;  1HYI A;  1JM7 A;  1WEV A;  2KU3 A;  1WEU A;  2YW8 A;  3M63 A;  4YBS A;  5DIN A;  5LKU A;  4LJN A;  4FJC A;  2QJ0 A;  2ZET C;  1VD4 A;  1U6G B;  1WES A;  1G25 A;  1K2F A;  2UZG A;  2ECI A;  4L7X A;  3HTK C;  4P5O B;  3SHB A;  2K4D A;  2MNZ A;  4I7B A;  5H9M A;  4B86 C;  2VJF A;  2VPE A;  2MA5 A;  1WEO A;  2RSD A;  2YSM A;  2CSZ A;  4LKA A;  2YQM A;  4GNF A;  3ZPV 1;  1Z6U A;  5C13 A;  3RPG C;  4UI9 B;  2JMI A;  4AVX A;  3PHD A;  4ZUX U;  3N9M A;  1LDK C;  2K1J A;  2LXP C;  2KRE A;  5D1K B;  1JM7 B;  3U5M A;  2LGV A;  2HDP A;  2JMJ A;  2CSY A;  5DKA A;  4FIP A;  2L43 A;  5H1U A;  1WE9 A;  3T6R A;  1BOR A;  2KIZ A;  2YT5 A;  4FO9 A;  3O34 A;  3SOX A;  2M3H A;  2PUY A;  4X3G A;  2E6R A;  3PUR A;  4BBQ A;  3O37 A;  4BHW A;  2VJF B;  5AIU A;  2YUR A;  3NG2 A;  4GND A;  4YAT A;  4W4U A;  2KWJ A;  5JG6 A;  2F42 A;  4I7D A;  2LGL A;  2Y1M A;  2F6N A;  4O64 A;  3L1X A;  4AYC A;  3LRQ A;  2KE1 A;  4QF3 A;  4R2Y A;  4YBT A;  2F6J A;  3FL2 A;  2FUU A;  4IC3 A;  4N4F A;  5G05 B;  2ECJ A;  2G43 A;  2KR4 A;  3M62 A;  1N87 A;  2LN0 A;  5B77 A;  1WEN A;  1Z60 A;  2FUI A;  1DVP A;  4Q6F A;  3LQH A;  2PNX A;  3U5P A;  4CA1 A;  3O7A A;  2LXH C;  2ECG A;  2MD8 C;  3DQV R;  2KGG A;  2YYR A;  4B7Y C;  1HYJ A;  5D1L B;  3V43 A;  4YAD A;  5G04 B;  4WA6 A;  2MD7 B;  4ZQL A;  1LDJ B;  5TAB A;  3DPL R;  2ECN A;  2MIQ A;  3HCT A;  4F52 B;  3MHS A;  4R8P K;  3ZVY A;  4QF2 A;  3PUQ A;  3ZVZ B;  4UP0 A;  2I50 A;  2MNY A;  2C2V S;  4YAB A;  4GNE A;  2IDA A;  5B78 A;  3T7L A;  3RPG B;  3ASL A;  1WIM A;  4AYC B;  4AUQ B;  4AP4 A;  2E6S A;  1WEP A;  3O70 A;  2OXQ C;  3LQJ A;  3MHH A;  4LLB A;  5H1T A;  3KV5 A;  2YU4 A;  3N9N A;  5EYA F;  3C5K A;  5TDW A;  2K16 A;  4A4C A;  3SOW A;  4V3K C;  2KGI A;  3L1Z B;  3HCU A;  4WZ3 B;  3EB5 A;  1ZBD B;  2EA6 A;  2VNF A;  3L11 A;  2QIC A;  4PPE A;  3KQI A;  5J3X A;  4S3O C;  2L75 A;  4R7E A;  5G0F A;  1MM2 A;  3U5N A;  2VPD A;  3O35 A;  1WEM A;  4GNG A;  1VYX A;  1WEW A;  2M1R A;  2XB1 A;  5LKT A;  1WGM A;  5FEY A;  1WIL A;  5FB1 A;  5KH7 A;  1FP0 A;  4A4B A;  3C6W A;  4YC9 A;  2BAY A;  3GL6 A;  2VJE A;  5I3L A;  1X4I A;  2LV9 A;  5B79 A;  2KWN A;  4UP5 A;  1E4U A;  2H0D A;  4N3W A;  5TBN A;  2MT5 A;  2YHN A;  3EB6 A;  3ZNI A;  1MM3 A;  2FSA A;  1WFK A;  2YRE A;  1X4U A;  1X4J A;  5LCW B;  2LDR A;  1CHC A;  2D8S A;  2HYE D;  4MVT A;  1JOC A;  2DX8 A;  5FB0 A;  2RI7 A;  2JMD A;  2LGG A;  2ECW A;  4MSX A;  4LK9 A;  2M6M A;  5AIT A;  2VPG A;  5FER A;  5KH3 A;  1FBV A;  3ZTG A;  1IYM A;  4A49 A;  4LAD B;  2KYU A;  4IC2 A;  4A0C D;  3SOU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...