2CKLA

Ring1b-bmi1 e3 catalytic domain structure
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
98
structure length
98
Chain Sequence
RIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POLYCOMB GROUP RING FINGER PROTEIN 4
publication title Structure and E3-Ligase Activity of the Ring-Ring Complex of Polycomb Proteins Bmi1 and Ring1B.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 30
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2006-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2cklA00
2KR4A 4GNFA 4O64A 1HYJA 3LQJA 4ZQLA 1JOCA 2HDPA 2UZGA 2KWNA 2Y1MA 4WZ3B 1DVPA 4BHWA 5KH3A 4CA1A 1WEEA 3ZYQA 3KQIA 4S3OC 3O36A 4UI9B 2MA6A 3SHBA 5B8DA 1ZBDB 2JRJA 3IHPA 2KE1A 2RI7A 2YU4A 4P5OB 2FSAA 3LRQA 2BAYA 4GNEA 1WEMA 2CSZA 3O37A 2F6NA 5J3XA 3KNVA 4AYCA 1G25A 3O33A 2L80A 2YSMA 3O35A 3RPGB 1WEPA 1XWHA 3HCTA 3ZVZB 5G05B 5D1LB 4I7CA 2LGVA 5KH7A 2VPDA 4LJNA 1Z6UA 2VJEB 4V3KC 3MHHA 2LV9A 4PTBA 2K1JA 4YABA 3ZPV1 2ECNA 2PNXA 2VP7A 5JG6A 2K16A 4AUQB 5B75A 3PURA 4GNDA 3DPLR 1FP0A 2L43A 2Y43A 2ECWA 4WZ2A 2G6QA 4A49A 3L1XA 4A4CA 2KWJA 4WZ0A 2VPBA 4IC3A 2M1RA 4ZDTA 4AYCB 5B79A 1V87A 3SOWA 1BORA 3N9QA 3O70A 1F62A 2XB1A 4CCGX 5TRBA 2M6MA 2MUMA 1RMDA 2LXPC 5TDWA 2I50A 2KU3A 3NG2A 1CHCA 5B77A 2VNFA 3C6WA 4AVXA 2DX8A 2YW8A 5G0FA 4WA6A 2ECVA 2RSDA 1WEQA 1IYMA 1HYIA 1T1HA 2EA6A 2NAAA 2LXHC 4FK5A 3VK6A 2FUIA 2G43A 2M85A 5FERA 4MSXA 4BBQA 2L5UA 1VFYA 1WGMA 2KREA 2M3HA 4GB0A 2L0BA 3QZVA 5LKUA 2OXQC 4AP4A 2JMJA 3ASLA 2LGKA 2YHNA 2F42A 3HCUA 3LQHA 4L7XA 2E6SA 2KWOA 4NN2A 3GL6A 2YQLA 2Y1NA 1WEVA 1U6GB 3N9LA 2ECJA 5DKAA 2KFTA 5B78A 2MD8C 3KV6A 5LKTA 2CKLB 1VYXA 3M62A 4FIPA 3ZPVE 2C2VS 2ZETC 2YHOA 4UP5A 2VJFA 4YADA 3PHDA 4L58A 3U5OA 4A0CD 2KIZA 1E4UA 3ZNIA 3MHSA 2E6RA 4V3LC 2LQ6A 4R7EA 5LKXA 2JMIA 3RPGC 4IC2A 3ZVYA 1WENA 3O7AA 1MM2A 2L75A 2LGGA 5LKZA 4S3OB 5H1VA 2LN0A 2ECTA 2YYRA 4ZUXU 4TKPB 2YREA 4A4BA 2G45A 1LDJB 5FB0A 2YURA 3O34A 3SOXA 2CKLA 4F52B 3L11A 2MA5A 2MNYA 2VJFB 4XI1A 5G04B 1VD4A 1K2FA 3DQVR 1Z2QA 3N9MA 2CT2A 2JMDA 2YQMA 2KGIA 2PUYA 5FB1A 3U5NA 1WIMA 3N9NA 2QIZA 4R8PK 3V43A 1X4JA 5D1MB 2MIQA 1WEOA 4PPEA 5B76A 4YC9A 1WE9A 4GNGA 2H0DB 2LDRA 3KV5A 5LCWB 3U5PA 2FUUA 2MNZA 3M63A 1JM7B 3GV4A 5I3LA 2HYED 3L1ZB 4FJCA 3PUQA 1WFKA 4QF3A 5H1UA 2YUCA 4R2YA 1MM3A 1X4UA 4X3GA 4LLBA 2LRIC 4FO9A 3LQIA 3T6RA 2QICA 3U5MA 2K17A 5AIUA 4N4FA 1Z60A 1LDKC 4LK9A 1WILA 2QJ0A 4I7DA 3ZTGA 2MT5A 5TDRA 3C5KA 2AN6A 2C2LA 4W4UA 3N9OA 3EB6A 2KYUA 4LADB 5TBNA 2K4DA 4YBTA 2D8SA 5EYAF 5FEYA 2F6JA 2CSYA 3HCSA 3FL2A 5AITA 4C9ZA 3N9PA 2XEUA 4I7BA 4YAXA 5C11A 5TABA 4MVTA 2YT5A 5KH9A 3T7LA 2H0DA 2ECGA 4YATA 1WESA 1WEUA 4QF2A 2VPGA 1JM7A 4B7YC 4LKAA 3RTRB 5H1TA 4N3WA 1X4IA 5C13A 4Q6FA 2MD7B 4YBSA 2VPEA 4YBMA 3EB5A 3M99A 5DINA 1FBVA 1N87A 3SOUA 2LGLA 2YSJA 2KWKA 2EGPA 3I2DA 2EODA 4UP0A 4B86C 5D1KB 2IDAA 2VJEA 1WEWA 2KGGA 2ECIA 5H9MA 3HTKC
chains in the Genus database with same CATH superfamily
5SVIB 2KR4A 4GNFA 3DDTA 4O64A 1HYJA 3LQJA 4ZQLA 1JOCA 2HDPA 2UZGA 2KWNA 2Y1MA 4WZ3B 1DVPA 4BHWA 5KH3A 4CA1A 1WEEA 3ZYQA 3KQIA 4S3OC 3O36A 4UI9B 2MA6A 3SHBA 5B8DA 1ZBDB 2JRJA 3IHPA 2KE1A 2RI7A 2YU4A 3FJUB 4P5OB 3MDBC 2FSAA 2JM3A 3LRQA 2BAYA 4GNEA 1WEMA 2CSZA 3O37A 2F6NA 5J3XA 3KNVA 4AYCA 1G25A 3O33A 2L80A 2YSMA 3O35A 3LVRE 3KDEC 3RPGB 1WEPA 1XWHA 3HCTA 3ZVZB 4QQ4A 5G05B 5D1LB 4I7CA 2LGVA 5KH7A 2VPDA 4LJNA 1Z6UA 2VJEB 4V3KC 2XP0A 3MHHA 2LV9A 4PTBA 2K1JA 4YABA 5SVIA 3ZPV1 2ECNA 2PNXA 2VP7A 5JG6A 2EXUA 2K16A 4AUQB 4OGEA 5B75A 3PURA 4GNDA 3DPLR 1FP0A 2L43A 2Y43A 2ECWA 4WZ2A 2G6QA 4A49A 3L1XA 4A4CA 3JUEA 2KWJA 4WZ0A 2VPBA 4IC3A 2M1RA 4ZDTA 1DCQA 4AYCB 5B79A 1V87A 1BORA 3SOWA 3N9QA 4F1PA 3O70A 1F62A 2LAUA 2XB1A 4CCGX 5TRBA 2M6MA 2MUMA 1RMDA 2LXPC 5TDWA 2I50A 2KU3A 3NG2A 1CHCA 5B77A 2VNFA 3C6WA 4AVXA 2DX8A 2YW8A 5G0FA 4WA6A 5SVXA 2ECVA 2RSDA 1WEQA 1IYMA 1HYIA 3E2DA 1T1HA 2EA6A 2NAAA 2LXHC 4FK5A 1MBMA 3VK6A 2FUIA 2G43A 3H7HA 2M85A 5FERA 4MSXA 4BBQA 2L5UA 1VFYA 1WGMA 3FM8C 2KREA 2M3HA 2CSVA 4GB0A 2L0BA 3QZVA 5LKUA 2OXQC 2RR4A 4AP4A 2DSMA 4Z0RA 2JMJA 3ASLA 3FANA 2LGKA 2YHNA 2F42A 3HCUA 3LQHA 2FD4A 2E6SA 4L7XA 2KWOA 4NN2A 3GL6A 2E61A 3O47A 2YQLA 2Y1NA 1WEVA 2P57A 1U6GB 3N9LA 2ECJA 4H9DA 5DKAA 3LVQE 2KFTA 5B78A 2MD8C 3KV6A 5LKTA 2CKLB 1VYXA 3M62A 4FIPA 3ZPVE 2C2VS 3FAOA 2ZETC 4O62A 2YHOA 4UP5A 3DWDA 2VJFA 3PHDA 4YADA 4L58A 2YVRA 3U5OA 4A0CD 2MKEA 2KIZA 3FEHA 1E4UA 2JUNA 3ZNIA 3MHSA 2E6RA 4V3LC 2LQ6A 4R7EA 4OGCA 5LKXA 2JMIA 3RPGC 4IC2A 3ZVYA 1WENA 3O7AA 1MM2A 2OWAA 2L75A 2LGGA 5LKZA 4S3OB 5H1VA 2LN0A 2ECTA 2YYRA 4ZUXU 4TKPB 2YREA 4A4BA 2G45A 3LDYA 1LDJB 5FB0A 2YURA 3O34A 3SOXA 2CKLA 4F52B 3L11A 2KKYA 2MA5A 2MNYA 2VJFB 4XI1A 5G04B 1VD4A 2B0OE 1K2FA 3DQVR 1Z2QA 3N9MA 2CT2A 2JMDA 2YQMA 2KGIA 2PUYA 2IQJA 2L7PA 5FB1A 3U5NA 1WIMA 3N9NA 2QIZA 4R8PK 3V43A 5SVYA 1X4JA 5D1MB 2MIQA 1WEOA 4PPEA 3T9KA 5B76A 4YC9A 3SUBA 2XOCA 3PLWA 1WE9A 4GNGA 2H0DB 2LDRA 3KV5A 5LCWB 3U5PA 2FUUA 2XOZA 2MNZA 3M63A 1JM7B 3GV4A 2FFWA 5I3LA 2HYED 3L1ZB 4FJCA 3PUQA 1WFKA 4QF3A 2M13A 5H1UA 2YUCA 4R2YA 1MM3A 1X4UA 4X3GA 4LLBA 2LRIC 3M7KA 4FO9A 3LQIA 3T6RA 2QICA 3U5MA 2CRWA 2K17A 5AIUA 4N4FA 1Z60A 1LDKC 4LK9A 1WILA 2CONA 2QJ0A 4I7DA 3ZTGA 2KKXA 2MT5A 5TDRA 3C5KA 2AN6A 2C2LA 4W4UA 3N9OA 3EB6A 2KYUA 4LADB 5TBNA 2CRRA 2K4DA 4YBTA 5K3QA 2D8SA 5EYAF 3LJUX 2F6JA 5FEYA 2CSYA 3HCSA 2D8UA 3FL2A 4Z0OA 5AITA 4C9ZA 2EGMA 3N9PA 2XEUA 4I7BA 4YAXA 5C11A 5TABA 4MVTA 2YT5A 5KH9A 3T7LA 2H0DA 2ECGA 4YATA 1WESA 1WEUA 4QF2A 2VPGA 2DJAA 1JM7A 4B7YC 4LKAA 3RTRB 5H1TA 4N3WA 1X4IA 5C13A 4Q6FA 2MD7B 4YBSA 2VPEA 4YBMA 3EB5A 3M99A 5DINA 1FBVA 1N87A 2XOYA 3SOUA 2LGLA 2YSJA 2KWKA 2EGPA 3I2DA 3Q1DA 2EODA 4UP0A 4B86C 5D1KB 2IDAA 2VJEA 1WEWA 2KGGA 2ECIA 5H9MA 3HTKC
chains in the Genus database with same CATH topology
2KR4A 4GNFA 4O64A 1HYJA 3LQJA 4ZQLA 1JOCA 2HDPA 2UZGA 2KWNA 2Y1MA 4WZ3B 1DVPA 4BHWA 5KH3A 4CA1A 1WEEA 3ZYQA 3KQIA 4S3OC 3O36A 4UI9B 2MA6A 3SHBA 5B8DA 1ZBDB 2JRJA 3IHPA 2KE1A 2RI7A 2YU4A 4P5OB 2FSAA 3LRQA 2BAYA 4GNEA 1WEMA 2CSZA 3O37A 2F6NA 5J3XA 3KNVA 4AYCA 1G25A 3O33A 2L80A 2YSMA 3O35A 3RPGB 1WEPA 1XWHA 3HCTA 3ZVZB 5G05B 5D1LB 4I7CA 2LGVA 5KH7A 2VPDA 4LJNA 1Z6UA 2VJEB 4V3KC 3MHHA 2LV9A 4PTBA 2K1JA 4YABA 3ZPV1 2ECNA 2PNXA 2VP7A 5JG6A 2K16A 4AUQB 5B75A 3PURA 4GNDA 3DPLR 1FP0A 2L43A 2Y43A 2ECWA 4WZ2A 2G6QA 4A49A 3L1XA 4A4CA 2KWJA 4WZ0A 2VPBA 4IC3A 2M1RA 4ZDTA 4AYCB 5B79A 1V87A 3SOWA 1BORA 3N9QA 3O70A 1F62A 2XB1A 4CCGX 5TRBA 2M6MA 2MUMA 1RMDA 2LXPC 5TDWA 2I50A 2KU3A 3NG2A 1CHCA 5B77A 2VNFA 3C6WA 4AVXA 2DX8A 2YW8A 5G0FA 4WA6A 2ECVA 2RSDA 1WEQA 1IYMA 1HYIA 1T1HA 2EA6A 2NAAA 2LXHC 4FK5A 3VK6A 2FUIA 2G43A 2M85A 5FERA 4MSXA 4BBQA 2L5UA 1VFYA 1WGMA 2KREA 2M3HA 4GB0A 2L0BA 3QZVA 5LKUA 2OXQC 4AP4A 2JMJA 3ASLA 2LGKA 2YHNA 2F42A 3HCUA 3LQHA 4L7XA 2E6SA 2KWOA 4NN2A 3GL6A 2YQLA 2Y1NA 1WEVA 1U6GB 3N9LA 2ECJA 5DKAA 2KFTA 5B78A 2MD8C 3KV6A 5LKTA 2CKLB 1VYXA 3M62A 4FIPA 3ZPVE 2C2VS 2ZETC 2YHOA 4UP5A 2VJFA 4YADA 3PHDA 4L58A 3U5OA 4A0CD 2KIZA 1E4UA 3ZNIA 3MHSA 2E6RA 4V3LC 2LQ6A 4R7EA 5LKXA 2JMIA 3RPGC 4IC2A 3ZVYA 1WENA 3O7AA 1MM2A 2L75A 2LGGA 5LKZA 4S3OB 5H1VA 2LN0A 2ECTA 2YYRA 4ZUXU 4TKPB 2YREA 4A4BA 2G45A 1LDJB 5FB0A 2YURA 3O34A 3SOXA 2CKLA 4F52B 3L11A 2MA5A 2MNYA 2VJFB 4XI1A 5G04B 1VD4A 1K2FA 3DQVR 1Z2QA 3N9MA 2CT2A 2JMDA 2YQMA 2KGIA 2PUYA 5FB1A 3U5NA 1WIMA 3N9NA 2QIZA 4R8PK 3V43A 1X4JA 5D1MB 2MIQA 1WEOA 4PPEA 5B76A 4YC9A 1WE9A 4GNGA 2H0DB 2LDRA 3KV5A 5LCWB 3U5PA 2FUUA 2MNZA 3M63A 1JM7B 3GV4A 5I3LA 2HYED 3L1ZB 4FJCA 3PUQA 1WFKA 4QF3A 5H1UA 2YUCA 4R2YA 1MM3A 1X4UA 4X3GA 4LLBA 2LRIC 4FO9A 3LQIA 3T6RA 2QICA 3U5MA 2K17A 5AIUA 4N4FA 1Z60A 1LDKC 4LK9A 1WILA 2QJ0A 4I7DA 3ZTGA 2MT5A 5TDRA 3C5KA 2AN6A 2C2LA 4W4UA 3N9OA 3EB6A 2KYUA 4LADB 5TBNA 2K4DA 4YBTA 2D8SA 5EYAF 5FEYA 2F6JA 2CSYA 3HCSA 3FL2A 5AITA 4C9ZA 3N9PA 2XEUA 4I7BA 4YAXA 5C11A 5TABA 4MVTA 2YT5A 5KH9A 3T7LA 2H0DA 2ECGA 4YATA 1WESA 1WEUA 4QF2A 2VPGA 1JM7A 4B7YC 4LKAA 3RTRB 5H1TA 4N3WA 1X4IA 5C13A 4Q6FA 2MD7B 4YBSA 2VPEA 4YBMA 3EB5A 3M99A 5DINA 1FBVA 1N87A 3SOUA 2LGLA 2YSJA 2KWKA 2EGPA 3I2DA 2EODA 4UP0A 4B86C 5D1KB 2IDAA 2VJEA 1WEWA 2KGGA 2ECIA 5H9MA 3HTKC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KR4 A;  4GNF A;  4O64 A;  1HYJ A;  3LQJ A;  4ZQL A;  1JOC A;  2HDP A;  2UZG A;  2KWN A;  2Y1M A;  4WZ3 B;  1DVP A;  4BHW A;  5KH3 A;  4CA1 A;  1WEE A;  3ZYQ A;  3KQI A;  4S3O C;  3O36 A;  4UI9 B;  2MA6 A;  3SHB A;  5B8D A;  1ZBD B;  2JRJ A;  3IHP A;  2KE1 A;  2RI7 A;  2YU4 A;  4P5O B;  2FSA A;  3LRQ A;  2BAY A;  4GNE A;  1WEM A;  2CSZ A;  3O37 A;  2F6N A;  5J3X A;  3KNV A;  4AYC A;  1G25 A;  3O33 A;  2L80 A;  2YSM A;  3O35 A;  3RPG B;  1WEP A;  1XWH A;  3HCT A;  3ZVZ B;  5G05 B;  5D1L B;  4I7C A;  2LGV A;  5KH7 A;  2VPD A;  4LJN A;  1Z6U A;  2VJE B;  4V3K C;  3MHH A;  2LV9 A;  4PTB A;  2K1J A;  4YAB A;  3ZPV 1;  2ECN A;  2PNX A;  2VP7 A;  5JG6 A;  2K16 A;  4AUQ B;  5B75 A;  3PUR A;  4GND A;  3DPL R;  1FP0 A;  2L43 A;  2Y43 A;  2ECW A;  4WZ2 A;  2G6Q A;  4A49 A;  3L1X A;  4A4C A;  2KWJ A;  4WZ0 A;  2VPB A;  4IC3 A;  2M1R A;  4ZDT A;  4AYC B;  5B79 A;  1V87 A;  3SOW A;  1BOR A;  3N9Q A;  3O70 A;  1F62 A;  2XB1 A;  4CCG X;  5TRB A;  2M6M A;  2MUM A;  1RMD A;  2LXP C;  5TDW A;  2I50 A;  2KU3 A;  3NG2 A;  1CHC A;  5B77 A;  2VNF A;  3C6W A;  4AVX A;  2DX8 A;  2YW8 A;  5G0F A;  4WA6 A;  2ECV A;  2RSD A;  1WEQ A;  1IYM A;  1HYI A;  1T1H A;  2EA6 A;  2NAA A;  2LXH C;  4FK5 A;  3VK6 A;  2FUI A;  2G43 A;  2M85 A;  5FER A;  4MSX A;  4BBQ A;  2L5U A;  1VFY A;  1WGM A;  2KRE A;  2M3H A;  4GB0 A;  2L0B A;  3QZV A;  5LKU A;  2OXQ C;  4AP4 A;  2JMJ A;  3ASL A;  2LGK A;  2YHN A;  2F42 A;  3HCU A;  3LQH A;  4L7X A;  2E6S A;  2KWO A;  4NN2 A;  3GL6 A;  2YQL A;  2Y1N A;  1WEV A;  1U6G B;  3N9L A;  2ECJ A;  5DKA A;  2KFT A;  5B78 A;  2MD8 C;  3KV6 A;  5LKT A;  2CKL B;  1VYX A;  3M62 A;  4FIP A;  3ZPV E;  2C2V S;  2ZET C;  2YHO A;  4UP5 A;  2VJF A;  4YAD A;  3PHD A;  4L58 A;  3U5O A;  4A0C D;  2KIZ A;  1E4U A;  3ZNI A;  3MHS A;  2E6R A;  4V3L C;  2LQ6 A;  4R7E A;  5LKX A;  2JMI A;  3RPG C;  4IC2 A;  3ZVY A;  1WEN A;  3O7A A;  1MM2 A;  2L75 A;  2LGG A;  5LKZ A;  4S3O B;  5H1V A;  2LN0 A;  2ECT A;  2YYR A;  4ZUX U;  4TKP B;  2YRE A;  4A4B A;  2G45 A;  1LDJ B;  5FB0 A;  2YUR A;  3O34 A;  3SOX A;  2CKL A;  4F52 B;  3L11 A;  2MA5 A;  2MNY A;  2VJF B;  4XI1 A;  5G04 B;  1VD4 A;  1K2F A;  3DQV R;  1Z2Q A;  3N9M A;  2CT2 A;  2JMD A;  2YQM A;  2KGI A;  2PUY A;  5FB1 A;  3U5N A;  1WIM A;  3N9N A;  2QIZ A;  4R8P K;  3V43 A;  1X4J A;  5D1M B;  2MIQ A;  1WEO A;  4PPE A;  5B76 A;  4YC9 A;  1WE9 A;  4GNG A;  2H0D B;  2LDR A;  3KV5 A;  5LCW B;  3U5P A;  2FUU A;  2MNZ A;  3M63 A;  1JM7 B;  3GV4 A;  5I3L A;  2HYE D;  3L1Z B;  4FJC A;  3PUQ A;  1WFK A;  4QF3 A;  5H1U A;  2YUC A;  4R2Y A;  1MM3 A;  1X4U A;  4X3G A;  4LLB A;  2LRI C;  4FO9 A;  3LQI A;  3T6R A;  2QIC A;  3U5M A;  2K17 A;  5AIU A;  4N4F A;  1Z60 A;  1LDK C;  4LK9 A;  1WIL A;  2QJ0 A;  4I7D A;  3ZTG A;  2MT5 A;  5TDR A;  3C5K A;  2AN6 A;  2C2L A;  4W4U A;  3N9O A;  3EB6 A;  2KYU A;  4LAD B;  5TBN A;  2K4D A;  4YBT A;  2D8S A;  5EYA F;  5FEY A;  2F6J A;  2CSY A;  3HCS A;  3FL2 A;  5AIT A;  4C9Z A;  3N9P A;  2XEU A;  4I7B A;  4YAX A;  5C11 A;  5TAB A;  4MVT A;  2YT5 A;  5KH9 A;  3T7L A;  2H0D A;  2ECG A;  4YAT A;  1WES A;  1WEU A;  4QF2 A;  2VPG A;  1JM7 A;  4B7Y C;  4LKA A;  3RTR B;  5H1T A;  4N3W A;  1X4I A;  5C13 A;  4Q6F A;  2MD7 B;  4YBS A;  2VPE A;  4YBM A;  3EB5 A;  3M99 A;  5DIN A;  1FBV A;  1N87 A;  3SOU A;  2LGL A;  2YSJ A;  2KWK A;  2EGP A;  3I2D A;  2EOD A;  4UP0 A;  4B86 C;  5D1K B;  2IDA A;  2VJE A;  1WEW A;  2KGG A;  2ECI A;  5H9M A;  3HTK C; 
#chains in the Genus database with same CATH topology
 5SVI B;  2KR4 A;  4GNF A;  3DDT A;  4O64 A;  1HYJ A;  3LQJ A;  4ZQL A;  1JOC A;  2HDP A;  2UZG A;  2KWN A;  2Y1M A;  4WZ3 B;  1DVP A;  4BHW A;  5KH3 A;  4CA1 A;  1WEE A;  3ZYQ A;  3KQI A;  4S3O C;  3O36 A;  4UI9 B;  2MA6 A;  3SHB A;  5B8D A;  1ZBD B;  2JRJ A;  3IHP A;  2KE1 A;  2RI7 A;  2YU4 A;  3FJU B;  4P5O B;  3MDB C;  2FSA A;  2JM3 A;  3LRQ A;  2BAY A;  4GNE A;  1WEM A;  2CSZ A;  3O37 A;  2F6N A;  5J3X A;  3KNV A;  4AYC A;  1G25 A;  3O33 A;  2L80 A;  2YSM A;  3O35 A;  3LVR E;  3KDE C;  3RPG B;  1WEP A;  1XWH A;  3HCT A;  3ZVZ B;  4QQ4 A;  5G05 B;  5D1L B;  4I7C A;  2LGV A;  5KH7 A;  2VPD A;  4LJN A;  1Z6U A;  2VJE B;  4V3K C;  2XP0 A;  3MHH A;  2LV9 A;  4PTB A;  2K1J A;  4YAB A;  5SVI A;  3ZPV 1;  2ECN A;  2PNX A;  2VP7 A;  5JG6 A;  2EXU A;  2K16 A;  4AUQ B;  4OGE A;  5B75 A;  3PUR A;  4GND A;  3DPL R;  1FP0 A;  2L43 A;  2Y43 A;  2ECW A;  4WZ2 A;  2G6Q A;  4A49 A;  3L1X A;  4A4C A;  3JUE A;  2KWJ A;  4WZ0 A;  2VPB A;  4IC3 A;  2M1R A;  4ZDT A;  1DCQ A;  4AYC B;  5B79 A;  1V87 A;  1BOR A;  3SOW A;  3N9Q A;  4F1P A;  3O70 A;  1F62 A;  2LAU A;  2XB1 A;  4CCG X;  5TRB A;  2M6M A;  2MUM A;  1RMD A;  2LXP C;  5TDW A;  2I50 A;  2KU3 A;  3NG2 A;  1CHC A;  5B77 A;  2VNF A;  3C6W A;  4AVX A;  2DX8 A;  2YW8 A;  5G0F A;  4WA6 A;  5SVX A;  2ECV A;  2RSD A;  1WEQ A;  1IYM A;  1HYI A;  3E2D A;  1T1H A;  2EA6 A;  2NAA A;  2LXH C;  4FK5 A;  1MBM A;  3VK6 A;  2FUI A;  2G43 A;  3H7H A;  2M85 A;  5FER A;  4MSX A;  4BBQ A;  2L5U A;  1VFY A;  1WGM A;  3FM8 C;  2KRE A;  2M3H A;  2CSV A;  4GB0 A;  2L0B A;  3QZV A;  5LKU A;  2OXQ C;  2RR4 A;  4AP4 A;  2DSM A;  4Z0R A;  2JMJ A;  3ASL A;  3FAN A;  2LGK A;  2YHN A;  2F42 A;  3HCU A;  3LQH A;  2FD4 A;  2E6S A;  4L7X A;  2KWO A;  4NN2 A;  3GL6 A;  2E61 A;  3O47 A;  2YQL A;  2Y1N A;  1WEV A;  2P57 A;  1U6G B;  3N9L A;  2ECJ A;  4H9D A;  5DKA A;  3LVQ E;  2KFT A;  5B78 A;  2MD8 C;  3KV6 A;  5LKT A;  2CKL B;  1VYX A;  3M62 A;  4FIP A;  3ZPV E;  2C2V S;  3FAO A;  2ZET C;  4O62 A;  2YHO A;  4UP5 A;  3DWD A;  2VJF A;  3PHD A;  4YAD A;  4L58 A;  2YVR A;  3U5O A;  4A0C D;  2MKE A;  2KIZ A;  3FEH A;  1E4U A;  2JUN A;  3ZNI A;  3MHS A;  2E6R A;  4V3L C;  2LQ6 A;  4R7E A;  4OGC A;  5LKX A;  2JMI A;  3RPG C;  4IC2 A;  3ZVY A;  1WEN A;  3O7A A;  1MM2 A;  2OWA A;  2L75 A;  2LGG A;  5LKZ A;  4S3O B;  5H1V A;  2LN0 A;  2ECT A;  2YYR A;  4ZUX U;  4TKP B;  2YRE A;  4A4B A;  2G45 A;  3LDY A;  1LDJ B;  5FB0 A;  2YUR A;  3O34 A;  3SOX A;  2CKL A;  4F52 B;  3L11 A;  2KKY A;  2MA5 A;  2MNY A;  2VJF B;  4XI1 A;  5G04 B;  1VD4 A;  2B0O E;  1K2F A;  3DQV R;  1Z2Q A;  3N9M A;  2CT2 A;  2JMD A;  2YQM A;  2KGI A;  2PUY A;  2IQJ A;  2L7P A;  5FB1 A;  3U5N A;  1WIM A;  3N9N A;  2QIZ A;  4R8P K;  3V43 A;  5SVY A;  1X4J A;  5D1M B;  2MIQ A;  1WEO A;  4PPE A;  3T9K A;  5B76 A;  4YC9 A;  3SUB A;  2XOC A;  3PLW A;  1WE9 A;  4GNG A;  2H0D B;  2LDR A;  3KV5 A;  5LCW B;  3U5P A;  2FUU A;  2XOZ A;  2MNZ A;  3M63 A;  1JM7 B;  3GV4 A;  2FFW A;  5I3L A;  2HYE D;  3L1Z B;  4FJC A;  3PUQ A;  1WFK A;  4QF3 A;  2M13 A;  5H1U A;  2YUC A;  4R2Y A;  1MM3 A;  1X4U A;  4X3G A;  4LLB A;  2LRI C;  3M7K A;  4FO9 A;  3LQI A;  3T6R A;  2QIC A;  3U5M A;  2CRW A;  2K17 A;  5AIU A;  4N4F A;  1Z60 A;  1LDK C;  4LK9 A;  1WIL A;  2CON A;  2QJ0 A;  4I7D A;  3ZTG A;  2KKX A;  2MT5 A;  5TDR A;  3C5K A;  2AN6 A;  2C2L A;  4W4U A;  3N9O A;  3EB6 A;  2KYU A;  4LAD B;  5TBN A;  2CRR A;  2K4D A;  4YBT A;  5K3Q A;  2D8S A;  5EYA F;  3LJU X;  2F6J A;  5FEY A;  2CSY A;  3HCS A;  2D8U A;  3FL2 A;  4Z0O A;  5AIT A;  4C9Z A;  2EGM A;  3N9P A;  2XEU A;  4I7B A;  4YAX A;  5C11 A;  5TAB A;  4MVT A;  2YT5 A;  5KH9 A;  3T7L A;  2H0D A;  2ECG A;  4YAT A;  1WES A;  1WEU A;  4QF2 A;  2VPG A;  2DJA A;  1JM7 A;  4B7Y C;  4LKA A;  3RTR B;  5H1T A;  4N3W A;  1X4I A;  5C13 A;  4Q6F A;  2MD7 B;  4YBS A;  2VPE A;  4YBM A;  3EB5 A;  3M99 A;  5DIN A;  1FBV A;  1N87 A;  2XOY A;  3SOU A;  2LGL A;  2YSJ A;  2KWK A;  2EGP A;  3I2D A;  3Q1D A;  2EOD A;  4UP0 A;  4B86 C;  5D1K B;  2IDA A;  2VJE A;  1WEW A;  2KGG A;  2ECI A;  5H9M A;  3HTK C; 
#chains in the Genus database with same CATH homology
 2KR4 A;  4GNF A;  4O64 A;  1HYJ A;  3LQJ A;  4ZQL A;  1JOC A;  2HDP A;  2UZG A;  2KWN A;  2Y1M A;  4WZ3 B;  1DVP A;  4BHW A;  5KH3 A;  4CA1 A;  1WEE A;  3ZYQ A;  3KQI A;  4S3O C;  3O36 A;  4UI9 B;  2MA6 A;  3SHB A;  5B8D A;  1ZBD B;  2JRJ A;  3IHP A;  2KE1 A;  2RI7 A;  2YU4 A;  4P5O B;  2FSA A;  3LRQ A;  2BAY A;  4GNE A;  1WEM A;  2CSZ A;  3O37 A;  2F6N A;  5J3X A;  3KNV A;  4AYC A;  1G25 A;  3O33 A;  2L80 A;  2YSM A;  3O35 A;  3RPG B;  1WEP A;  1XWH A;  3HCT A;  3ZVZ B;  5G05 B;  5D1L B;  4I7C A;  2LGV A;  5KH7 A;  2VPD A;  4LJN A;  1Z6U A;  2VJE B;  4V3K C;  3MHH A;  2LV9 A;  4PTB A;  2K1J A;  4YAB A;  3ZPV 1;  2ECN A;  2PNX A;  2VP7 A;  5JG6 A;  2K16 A;  4AUQ B;  5B75 A;  3PUR A;  4GND A;  3DPL R;  1FP0 A;  2L43 A;  2Y43 A;  2ECW A;  4WZ2 A;  2G6Q A;  4A49 A;  3L1X A;  4A4C A;  2KWJ A;  4WZ0 A;  2VPB A;  4IC3 A;  2M1R A;  4ZDT A;  4AYC B;  5B79 A;  1V87 A;  3SOW A;  1BOR A;  3N9Q A;  3O70 A;  1F62 A;  2XB1 A;  4CCG X;  5TRB A;  2M6M A;  2MUM A;  1RMD A;  2LXP C;  5TDW A;  2I50 A;  2KU3 A;  3NG2 A;  1CHC A;  5B77 A;  2VNF A;  3C6W A;  4AVX A;  2DX8 A;  2YW8 A;  5G0F A;  4WA6 A;  2ECV A;  2RSD A;  1WEQ A;  1IYM A;  1HYI A;  1T1H A;  2EA6 A;  2NAA A;  2LXH C;  4FK5 A;  3VK6 A;  2FUI A;  2G43 A;  2M85 A;  5FER A;  4MSX A;  4BBQ A;  2L5U A;  1VFY A;  1WGM A;  2KRE A;  2M3H A;  4GB0 A;  2L0B A;  3QZV A;  5LKU A;  2OXQ C;  4AP4 A;  2JMJ A;  3ASL A;  2LGK A;  2YHN A;  2F42 A;  3HCU A;  3LQH A;  4L7X A;  2E6S A;  2KWO A;  4NN2 A;  3GL6 A;  2YQL A;  2Y1N A;  1WEV A;  1U6G B;  3N9L A;  2ECJ A;  5DKA A;  2KFT A;  5B78 A;  2MD8 C;  3KV6 A;  5LKT A;  2CKL B;  1VYX A;  3M62 A;  4FIP A;  3ZPV E;  2C2V S;  2ZET C;  2YHO A;  4UP5 A;  2VJF A;  4YAD A;  3PHD A;  4L58 A;  3U5O A;  4A0C D;  2KIZ A;  1E4U A;  3ZNI A;  3MHS A;  2E6R A;  4V3L C;  2LQ6 A;  4R7E A;  5LKX A;  2JMI A;  3RPG C;  4IC2 A;  3ZVY A;  1WEN A;  3O7A A;  1MM2 A;  2L75 A;  2LGG A;  5LKZ A;  4S3O B;  5H1V A;  2LN0 A;  2ECT A;  2YYR A;  4ZUX U;  4TKP B;  2YRE A;  4A4B A;  2G45 A;  1LDJ B;  5FB0 A;  2YUR A;  3O34 A;  3SOX A;  2CKL A;  4F52 B;  3L11 A;  2MA5 A;  2MNY A;  2VJF B;  4XI1 A;  5G04 B;  1VD4 A;  1K2F A;  3DQV R;  1Z2Q A;  3N9M A;  2CT2 A;  2JMD A;  2YQM A;  2KGI A;  2PUY A;  5FB1 A;  3U5N A;  1WIM A;  3N9N A;  2QIZ A;  4R8P K;  3V43 A;  1X4J A;  5D1M B;  2MIQ A;  1WEO A;  4PPE A;  5B76 A;  4YC9 A;  1WE9 A;  4GNG A;  2H0D B;  2LDR A;  3KV5 A;  5LCW B;  3U5P A;  2FUU A;  2MNZ A;  3M63 A;  1JM7 B;  3GV4 A;  5I3L A;  2HYE D;  3L1Z B;  4FJC A;  3PUQ A;  1WFK A;  4QF3 A;  5H1U A;  2YUC A;  4R2Y A;  1MM3 A;  1X4U A;  4X3G A;  4LLB A;  2LRI C;  4FO9 A;  3LQI A;  3T6R A;  2QIC A;  3U5M A;  2K17 A;  5AIU A;  4N4F A;  1Z60 A;  1LDK C;  4LK9 A;  1WIL A;  2QJ0 A;  4I7D A;  3ZTG A;  2MT5 A;  5TDR A;  3C5K A;  2AN6 A;  2C2L A;  4W4U A;  3N9O A;  3EB6 A;  2KYU A;  4LAD B;  5TBN A;  2K4D A;  4YBT A;  2D8S A;  5EYA F;  5FEY A;  2F6J A;  2CSY A;  3HCS A;  3FL2 A;  5AIT A;  4C9Z A;  3N9P A;  2XEU A;  4I7B A;  4YAX A;  5C11 A;  5TAB A;  4MVT A;  2YT5 A;  5KH9 A;  3T7L A;  2H0D A;  2ECG A;  4YAT A;  1WES A;  1WEU A;  4QF2 A;  2VPG A;  1JM7 A;  4B7Y C;  4LKA A;  3RTR B;  5H1T A;  4N3W A;  1X4I A;  5C13 A;  4Q6F A;  2MD7 B;  4YBS A;  2VPE A;  4YBM A;  3EB5 A;  3M99 A;  5DIN A;  1FBV A;  1N87 A;  3SOU A;  2LGL A;  2YSJ A;  2KWK A;  2EGP A;  3I2D A;  2EOD A;  4UP0 A;  4B86 C;  5D1K B;  2IDA A;  2VJE A;  1WEW A;  2KGG A;  2ECI A;  5H9M A;  3HTK C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...