2CKLA

Ring1b-bmi1 e3 catalytic domain structure
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
98
structure length
98
Chain Sequence
b'RIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POLYCOMB GROUP RING FINGER PROTEIN 4
publication title Structure and E3-Ligase Activity of the Ring-Ring Complex of Polycomb Proteins Bmi1 and Ring1B.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 30
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2006-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2cklA00
5H1TA 2L75A 2PUYA 4O64A 5J3XA 5TRBA 4TKPB 1MM3A 2LGVA 2RI7A 1N87A 1WIMA 4S3OC 2LRIC 1HYJA 3T6RA 2VJEA 5TDRA 2VP7A 5H1UA 1CHCA 3ZTGA 2M6MA 4C9ZA 3C5KA 4WZ0A 5FB0A 2NAAA 5B75A 2YREA 2ECVA 2CKLA 2AN6A 1Z60A 2KFTA 3VK6A 2VJFB 2KWOA 2UZGA 5LCWB 3O35A 1FBVA 3HCUA 5B8DA 1X4IA 1LDKC 3QZVA 5G05B 3N9LA 4S3OB 2L0BA 4BHWA 2FUUA 4WZ2A 2HDPA 2BAYA 2YSJA 3RPGC 4FIPA 1RMDA 2KR4A 2VJFA 3PURA 2C2LA 5KH7A 2VPBA 4YC9A 2IDAA 1JM7A 3SOWA 2LGKA 3O34A 3C6WA 2D8SA 1Z2QA 5JG6A 2Y1NA 3O37A 4L7XA 3M63A 2L80A 3EB5A 5D1LB 2DX8A 5G04B 5FERA 4UP5A 3IHPA 4GNEA 2KWKA 4CCGX 2ECJA 2ECIA 3RPGB 4I7BA 2VPEA 2JMDA 3ZYQA 4AP4A 5KH9A 2LDRA 2YU4A 4MSXA 3M99A 3LQJA 5LKXA 2KREA 5H1VA 5FEYA 2Y1MA 2EGPA 1FP0A 2M85A 3DQVR 5I3LA 2M1RA 2ECTA 2YSMA 2YQLA 3ZVYA 5EYAF 4B86C 4FJCA 4FO9A 1G25A 2MD8C 4QF2A 5KH3A 3SOUA 4X3GA 4AVXA 3KNVA 5B76A 3L1XA 4V3LC 1WEOA 3LQHA 2KWJA 2G45A 2K17A 3KQIA 4IC2A 3LRQA 4YAXA 1BORA 1X4UA 4WZ3B 5AITA 2YW8A 4YATA 2Y43A 5H9MA 2QJ0A 1WE9A 2K4DA 2MA5A 2XB1A 5TABA 4PTBA 1WEUA 2H0DB 3SOXA 4NN2A 2YT5A 4AYCB 4N3WA 2KIZA 2YURA 4UP0A 2C2VS 4CA1A 2XEUA 1DVPA 3MHSA 5FB1A 1LDJB 2K1JA 1WEVA 1Z6UA 2CT2A 5C11A 2L5UA 1F62A 3KV5A 1MM2A 3U5NA 4WA6A 1WEMA 1U6GB 2EODA 2G6QA 1WEQA 4FK5A 4AUQB 1K2FA 3GL6A 2MUMA 1WENA 2CSZA 5B78A 4ZQLA 1ZBDB 3U5MA 4UI9B 2YQMA 2VNFA 5B77A 4PPEA 3N9NA 2G43A 3MHHA 1WFKA 2JMJA 3HTKC 2YHOA 1WESA 1JOCA 1T1HA 1V87A 4ZUXU 3NG2A 2ECWA 4MVTA 2VPDA 3U5OA 5G0FA 5AIUA 1WEWA 3O70A 3U5PA 4I7CA 2VJEB 4F52B 2ECNA 2OXQC 4A4BA 3M62A 2JMIA 2MIQA 4GNGA 4A4CA 4B7YC 4YABA 2FUIA 2MD7B 2QICA 3V43A 1VD4A 3L1ZB 1WILA 2CKLB 3HCSA 2ECGA 5LKZA 4LJNA 2YUCA 5B79A 2QIZA 1WEPA 2CSYA 4LK9A 3ZVZB 2LQ6A 3ASLA 3HCTA 3ZPVE 3N9OA 2FSAA 2RSDA 2MT5A 3O7AA 4LADB 1VFYA 4LLBA 4I7DA 2K16A 3O36A 2MA6A 4GB0A 2EA6A 3ZNIA 3L11A 1HYIA 1E4UA 4Q6FA 4R8PK 2KE1A 5D1KB 2YHNA 4R7EA 1JM7B 2M3HA 3RTRB 2LXHC 2F6NA 2LV9A 4LKAA 4YBSA 5DKAA 3LQIA 3PHDA 2MNYA 4R2YA 2H0DA 3T7LA 4BBQA 4L58A 4XI1A 2LXPC 4P5OB 3N9QA 2I50A 4AYCA 3FL2A 4YADA 4GNFA 2ZETC 2PNXA 2VPGA 4ZDTA 2KU3A 2LGGA 5D1MB 2KGIA 5TDWA 5DINA 4W4UA 3EB6A 4GNDA 1WEEA 2LN0A 2KWNA 1VYXA 2KYUA 3I2DA 4YBTA 4YBMA 3SHBA 5LKTA 1XWHA 5LKUA 2L43A 1WGMA 3N9PA 4V3KC 4IC3A 2F42A 5TBNA 1X4JA 2KGGA 4A49A 3KV6A 4A0CD 2E6RA 3O33A 3PUQA 2LGLA 3ZPV1 2E6SA 3GV4A 4QF3A 5C13A 2YYRA 2JRJA 2HYED 3DPLR 2MNZA 1IYMA 2F6JA 3N9MA 4N4FA
chains in the Genus database with same CATH superfamily
5H1TA 2L75A 2PUYA 4O64A 5J3XA 5TRBA 4TKPB 1MM3A 2LGVA 2RI7A 1N87A 1WIMA 3Q1DA 4F1PA 4S3OC 2LRIC 1HYJA 3T6RA 2VJEA 5TDRA 2VP7A 2XOCA 5H1UA 1CHCA 3ZTGA 3LJUX 4Z0OA 2M6MA 4OGCA 4C9ZA 2M13A 3C5KA 2CRRA 3FEHA 4WZ0A 5FB0A 3MDBC 2NAAA 5B75A 2YREA 2CRWA 2ECVA 2CKLA 2AN6A 1Z60A 2KFTA 3VK6A 2VJFB 2DSMA 2KWOA 2UZGA 5LCWB 3O35A 1FBVA 3HCUA 5B8DA 1X4IA 1LDKC 3QZVA 5G05B 3N9LA 4S3OB 2L0BA 4BHWA 2RR4A 2FUUA 4WZ2A 2HDPA 3LDYA 2BAYA 2YSJA 3RPGC 4FIPA 1RMDA 2KR4A 2VJFA 3PURA 2C2LA 3LVQE 5KH7A 2VPBA 4YC9A 2IDAA 2IQJA 1JM7A 3SOWA 2LGKA 3O34A 3KDEC 3C6WA 2D8SA 1Z2QA 5JG6A 2Y1NA 3O37A 4L7XA 3M63A 2L80A 3EB5A 3JUEA 4OGEA 2DX8A 5D1LB 5G04B 5FERA 4UP5A 3IHPA 4GNEA 2KWKA 4CCGX 2ECJA 2ECIA 2DJAA 3RPGB 5SVIB 4I7BA 2VPEA 2JMDA 3ZYQA 2EGMA 4AP4A 5KH9A 2LDRA 2YU4A 2KKXA 4MSXA 3M99A 3LQJA 5LKXA 2KREA 5H1VA 5FEYA 2Y1MA 2EGPA 2D8UA 2JUNA 1FP0A 2M85A 3DQVR 3FM8C 3H7HA 5I3LA 2M1RA 2ECTA 3T9KA 2P57A 2YSMA 2YQLA 3ZVYA 1MBMA 5EYAF 4B86C 4FJCA 4FO9A 1G25A 2MD8C 4QF2A 5KH3A 3SOUA 4X3GA 4AVXA 3KNVA 5B76A 2XOYA 3FJUB 3L1XA 4V3LC 1WEOA 3LQHA 2FFWA 3DDTA 2OWAA 3M7KA 2KWJA 2G45A 2K17A 3KQIA 4IC2A 3E2DA 3DWDA 3LRQA 4YAXA 1BORA 1X4UA 4WZ3B 2CSVA 5AITA 2E61A 2YW8A 4YATA 2XOZA 3PLWA 2Y43A 5H9MA 2QJ0A 1WE9A 2K4DA 2MA5A 2XB1A 5TABA 4PTBA 1WEUA 2H0DB 3SOXA 4NN2A 2YT5A 4AYCB 4N3WA 2KIZA 2YURA 4UP0A 2C2VS 4CA1A 2XEUA 1DVPA 3MHSA 5FB1A 1LDJB 2K1JA 1WEVA 1Z6UA 2CT2A 5C11A 2L5UA 1F62A 4QQ4A 3KV5A 1MM2A 3U5NA 4WA6A 5SVYA 1WEMA 1U6GB 2EODA 2G6QA 1WEQA 4FK5A 4AUQB 1K2FA 3GL6A 2MUMA 1WENA 2CSZA 5B78A 4ZQLA 2MKEA 1ZBDB 3U5MA 4UI9B 2YQMA 2VNFA 5B77A 4Z0RA 4PPEA 3N9NA 2G43A 3MHHA 1WFKA 2JMJA 3HTKC 2YHOA 1WESA 1JOCA 2B0OE 1T1HA 1V87A 4ZUXU 3NG2A 2ECWA 2FD4A 4MVTA 2VPDA 3U5OA 5G0FA 5AIUA 3SUBA 1WEWA 3O70A 3U5PA 4I7CA 2VJEB 4F52B 2ECNA 2OXQC 2CONA 4A4BA 3M62A 2JMIA 2MIQA 4GNGA 4A4CA 4B7YC 4YABA 2FUIA 2L7PA 2MD7B 2QICA 5SVIA 3O47A 3V43A 1VD4A 3L1ZB 1WILA 2CKLB 3HCSA 2ECGA 5LKZA 4LJNA 2YUCA 5B79A 2KKYA 2QIZA 1WEPA 2CSYA 4LK9A 3ZVZB 2LQ6A 3ASLA 3HCTA 3ZPVE 3N9OA 2FSAA 2RSDA 2MT5A 3O7AA 4LADB 1VFYA 4LLBA 4I7DA 2K16A 3O36A 2MA6A 4GB0A 2EA6A 2JM3A 3ZNIA 3FANA 3L11A 1HYIA 1E4UA 1DCQA 4Q6FA 4R8PK 2KE1A 5D1KB 2YHNA 4R7EA 1JM7B 2M3HA 3RTRB 2LXHC 2F6NA 2LV9A 4LKAA 4YBSA 5DKAA 3LQIA 3PHDA 2MNYA 4R2YA 2H0DA 3T7LA 4BBQA 4L58A 4XI1A 2LXPC 4P5OB 3N9QA 2I50A 4AYCA 3FL2A 4YADA 4GNFA 2ZETC 2PNXA 2VPGA 4ZDTA 2KU3A 2LGGA 5D1MB 2KGIA 5TDWA 5DINA 4W4UA 3EB6A 4GNDA 1WEEA 2LN0A 4H9DA 2KWNA 1VYXA 2KYUA 3I2DA 4YBTA 4YBMA 3SHBA 5LKTA 3LVRE 4O62A 2XP0A 5K3QA 2LAUA 1XWHA 5LKUA 2L43A 1WGMA 3N9PA 4V3KC 4IC3A 2F42A 5TBNA 1X4JA 2KGGA 2EXUA 2YVRA 4A49A 3KV6A 4A0CD 2E6RA 3O33A 3PUQA 2LGLA 3ZPV1 2E6SA 3GV4A 4QF3A 5C13A 5SVXA 2YYRA 2JRJA 2HYED 3DPLR 3FAOA 2MNZA 1IYMA 2F6JA 3N9MA 4N4FA
chains in the Genus database with same CATH topology
5H1TA 2L75A 2PUYA 4O64A 5J3XA 5TRBA 4TKPB 1MM3A 2LGVA 2RI7A 1N87A 1WIMA 4S3OC 2LRIC 1HYJA 3T6RA 2VJEA 5TDRA 2VP7A 5H1UA 1CHCA 3ZTGA 2M6MA 4C9ZA 3C5KA 4WZ0A 5FB0A 2NAAA 5B75A 2YREA 2ECVA 2CKLA 2AN6A 1Z60A 2KFTA 3VK6A 2VJFB 2KWOA 2UZGA 5LCWB 3O35A 1FBVA 3HCUA 5B8DA 1X4IA 1LDKC 3QZVA 5G05B 3N9LA 4S3OB 2L0BA 4BHWA 2FUUA 4WZ2A 2HDPA 2BAYA 2YSJA 3RPGC 4FIPA 1RMDA 2KR4A 2VJFA 3PURA 2C2LA 5KH7A 2VPBA 4YC9A 2IDAA 1JM7A 3SOWA 2LGKA 3O34A 3C6WA 2D8SA 1Z2QA 5JG6A 2Y1NA 3O37A 4L7XA 3M63A 2L80A 3EB5A 5D1LB 2DX8A 5G04B 5FERA 4UP5A 3IHPA 4GNEA 2KWKA 4CCGX 2ECJA 2ECIA 3RPGB 4I7BA 2VPEA 2JMDA 3ZYQA 4AP4A 5KH9A 2LDRA 2YU4A 4MSXA 3M99A 3LQJA 5LKXA 2KREA 5H1VA 5FEYA 2Y1MA 2EGPA 1FP0A 2M85A 3DQVR 5I3LA 2M1RA 2ECTA 2YSMA 2YQLA 3ZVYA 5EYAF 4B86C 4FJCA 4FO9A 1G25A 2MD8C 4QF2A 5KH3A 3SOUA 4X3GA 4AVXA 3KNVA 5B76A 3L1XA 4V3LC 1WEOA 3LQHA 2KWJA 2G45A 2K17A 3KQIA 4IC2A 3LRQA 4YAXA 1BORA 1X4UA 4WZ3B 5AITA 2YW8A 4YATA 2Y43A 5H9MA 2QJ0A 1WE9A 2K4DA 2MA5A 2XB1A 5TABA 4PTBA 1WEUA 2H0DB 3SOXA 4NN2A 2YT5A 4AYCB 4N3WA 2KIZA 2YURA 4UP0A 2C2VS 4CA1A 2XEUA 1DVPA 3MHSA 5FB1A 1LDJB 2K1JA 1WEVA 1Z6UA 2CT2A 5C11A 2L5UA 1F62A 3KV5A 1MM2A 3U5NA 4WA6A 1WEMA 1U6GB 2EODA 2G6QA 1WEQA 4FK5A 4AUQB 1K2FA 3GL6A 2MUMA 1WENA 2CSZA 5B78A 4ZQLA 1ZBDB 3U5MA 4UI9B 2YQMA 2VNFA 5B77A 4PPEA 3N9NA 2G43A 3MHHA 1WFKA 2JMJA 3HTKC 2YHOA 1WESA 1JOCA 1T1HA 1V87A 4ZUXU 3NG2A 2ECWA 4MVTA 2VPDA 3U5OA 5G0FA 5AIUA 1WEWA 3O70A 3U5PA 4I7CA 2VJEB 4F52B 2ECNA 2OXQC 4A4BA 3M62A 2JMIA 2MIQA 4GNGA 4A4CA 4B7YC 4YABA 2FUIA 2MD7B 2QICA 3V43A 1VD4A 3L1ZB 1WILA 2CKLB 3HCSA 2ECGA 5LKZA 4LJNA 2YUCA 5B79A 2QIZA 1WEPA 2CSYA 4LK9A 3ZVZB 2LQ6A 3ASLA 3HCTA 3ZPVE 3N9OA 2FSAA 2RSDA 2MT5A 3O7AA 4LADB 1VFYA 4LLBA 4I7DA 2K16A 3O36A 2MA6A 4GB0A 2EA6A 3ZNIA 3L11A 1HYIA 1E4UA 4Q6FA 4R8PK 2KE1A 5D1KB 2YHNA 4R7EA 1JM7B 2M3HA 3RTRB 2LXHC 2F6NA 2LV9A 4LKAA 4YBSA 5DKAA 3LQIA 3PHDA 2MNYA 4R2YA 2H0DA 3T7LA 4BBQA 4L58A 4XI1A 2LXPC 4P5OB 3N9QA 2I50A 4AYCA 3FL2A 4YADA 4GNFA 2ZETC 2PNXA 2VPGA 4ZDTA 2KU3A 2LGGA 5D1MB 2KGIA 5TDWA 5DINA 4W4UA 3EB6A 4GNDA 1WEEA 2LN0A 2KWNA 1VYXA 2KYUA 3I2DA 4YBTA 4YBMA 3SHBA 5LKTA 1XWHA 5LKUA 2L43A 1WGMA 3N9PA 4V3KC 4IC3A 2F42A 5TBNA 1X4JA 2KGGA 4A49A 3KV6A 4A0CD 2E6RA 3O33A 3PUQA 2LGLA 3ZPV1 2E6SA 3GV4A 4QF3A 5C13A 2YYRA 2JRJA 2HYED 3DPLR 2MNZA 1IYMA 2F6JA 3N9MA 4N4FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H1T A;  2L75 A;  2PUY A;  4O64 A;  5J3X A;  5TRB A;  4TKP B;  1MM3 A;  2LGV A;  2RI7 A;  1N87 A;  1WIM A;  4S3O C;  2LRI C;  1HYJ A;  3T6R A;  2VJE A;  5TDR A;  2VP7 A;  5H1U A;  1CHC A;  3ZTG A;  2M6M A;  4C9Z A;  3C5K A;  4WZ0 A;  5FB0 A;  2NAA A;  5B75 A;  2YRE A;  2ECV A;  2CKL A;  2AN6 A;  1Z60 A;  2KFT A;  3VK6 A;  2VJF B;  2KWO A;  2UZG A;  5LCW B;  3O35 A;  1FBV A;  3HCU A;  5B8D A;  1X4I A;  1LDK C;  3QZV A;  5G05 B;  3N9L A;  4S3O B;  2L0B A;  4BHW A;  2FUU A;  4WZ2 A;  2HDP A;  2BAY A;  2YSJ A;  3RPG C;  4FIP A;  1RMD A;  2KR4 A;  2VJF A;  3PUR A;  2C2L A;  5KH7 A;  2VPB A;  4YC9 A;  2IDA A;  1JM7 A;  3SOW A;  2LGK A;  3O34 A;  3C6W A;  2D8S A;  1Z2Q A;  5JG6 A;  2Y1N A;  3O37 A;  4L7X A;  3M63 A;  2L80 A;  3EB5 A;  5D1L B;  2DX8 A;  5G04 B;  5FER A;  4UP5 A;  3IHP A;  4GNE A;  2KWK A;  4CCG X;  2ECJ A;  2ECI A;  3RPG B;  4I7B A;  2VPE A;  2JMD A;  3ZYQ A;  4AP4 A;  5KH9 A;  2LDR A;  2YU4 A;  4MSX A;  3M99 A;  3LQJ A;  5LKX A;  2KRE A;  5H1V A;  5FEY A;  2Y1M A;  2EGP A;  1FP0 A;  2M85 A;  3DQV R;  5I3L A;  2M1R A;  2ECT A;  2YSM A;  2YQL A;  3ZVY A;  5EYA F;  4B86 C;  4FJC A;  4FO9 A;  1G25 A;  2MD8 C;  4QF2 A;  5KH3 A;  3SOU A;  4X3G A;  4AVX A;  3KNV A;  5B76 A;  3L1X A;  4V3L C;  1WEO A;  3LQH A;  2KWJ A;  2G45 A;  2K17 A;  3KQI A;  4IC2 A;  3LRQ A;  4YAX A;  1BOR A;  1X4U A;  4WZ3 B;  5AIT A;  2YW8 A;  4YAT A;  2Y43 A;  5H9M A;  2QJ0 A;  1WE9 A;  2K4D A;  2MA5 A;  2XB1 A;  5TAB A;  4PTB A;  1WEU A;  2H0D B;  3SOX A;  4NN2 A;  2YT5 A;  4AYC B;  4N3W A;  2KIZ A;  2YUR A;  4UP0 A;  2C2V S;  4CA1 A;  2XEU A;  1DVP A;  3MHS A;  5FB1 A;  1LDJ B;  2K1J A;  1WEV A;  1Z6U A;  2CT2 A;  5C11 A;  2L5U A;  1F62 A;  3KV5 A;  1MM2 A;  3U5N A;  4WA6 A;  1WEM A;  1U6G B;  2EOD A;  2G6Q A;  1WEQ A;  4FK5 A;  4AUQ B;  1K2F A;  3GL6 A;  2MUM A;  1WEN A;  2CSZ A;  5B78 A;  4ZQL A;  1ZBD B;  3U5M A;  4UI9 B;  2YQM A;  2VNF A;  5B77 A;  4PPE A;  3N9N A;  2G43 A;  3MHH A;  1WFK A;  2JMJ A;  3HTK C;  2YHO A;  1WES A;  1JOC A;  1T1H A;  1V87 A;  4ZUX U;  3NG2 A;  2ECW A;  4MVT A;  2VPD A;  3U5O A;  5G0F A;  5AIU A;  1WEW A;  3O70 A;  3U5P A;  4I7C A;  2VJE B;  4F52 B;  2ECN A;  2OXQ C;  4A4B A;  3M62 A;  2JMI A;  2MIQ A;  4GNG A;  4A4C A;  4B7Y C;  4YAB A;  2FUI A;  2MD7 B;  2QIC A;  3V43 A;  1VD4 A;  3L1Z B;  1WIL A;  2CKL B;  3HCS A;  2ECG A;  5LKZ A;  4LJN A;  2YUC A;  5B79 A;  2QIZ A;  1WEP A;  2CSY A;  4LK9 A;  3ZVZ B;  2LQ6 A;  3ASL A;  3HCT A;  3ZPV E;  3N9O A;  2FSA A;  2RSD A;  2MT5 A;  3O7A A;  4LAD B;  1VFY A;  4LLB A;  4I7D A;  2K16 A;  3O36 A;  2MA6 A;  4GB0 A;  2EA6 A;  3ZNI A;  3L11 A;  1HYI A;  1E4U A;  4Q6F A;  4R8P K;  2KE1 A;  5D1K B;  2YHN A;  4R7E A;  1JM7 B;  2M3H A;  3RTR B;  2LXH C;  2F6N A;  2LV9 A;  4LKA A;  4YBS A;  5DKA A;  3LQI A;  3PHD A;  2MNY A;  4R2Y A;  2H0D A;  3T7L A;  4BBQ A;  4L58 A;  4XI1 A;  2LXP C;  4P5O B;  3N9Q A;  2I50 A;  4AYC A;  3FL2 A;  4YAD A;  4GNF A;  2ZET C;  2PNX A;  2VPG A;  4ZDT A;  2KU3 A;  2LGG A;  5D1M B;  2KGI A;  5TDW A;  5DIN A;  4W4U A;  3EB6 A;  4GND A;  1WEE A;  2LN0 A;  2KWN A;  1VYX A;  2KYU A;  3I2D A;  4YBT A;  4YBM A;  3SHB A;  5LKT A;  1XWH A;  5LKU A;  2L43 A;  1WGM A;  3N9P A;  4V3K C;  4IC3 A;  2F42 A;  5TBN A;  1X4J A;  2KGG A;  4A49 A;  3KV6 A;  4A0C D;  2E6R A;  3O33 A;  3PUQ A;  2LGL A;  3ZPV 1;  2E6S A;  3GV4 A;  4QF3 A;  5C13 A;  2YYR A;  2JRJ A;  2HYE D;  3DPL R;  2MNZ A;  1IYM A;  2F6J A;  3N9M A;  4N4F A; 
#chains in the Genus database with same CATH topology
 5H1T A;  2L75 A;  2PUY A;  4O64 A;  5J3X A;  5TRB A;  4TKP B;  1MM3 A;  2LGV A;  2RI7 A;  1N87 A;  1WIM A;  3Q1D A;  4F1P A;  4S3O C;  2LRI C;  1HYJ A;  3T6R A;  2VJE A;  5TDR A;  2VP7 A;  2XOC A;  5H1U A;  1CHC A;  3ZTG A;  3LJU X;  4Z0O A;  2M6M A;  4OGC A;  4C9Z A;  2M13 A;  3C5K A;  2CRR A;  3FEH A;  4WZ0 A;  5FB0 A;  3MDB C;  2NAA A;  5B75 A;  2YRE A;  2CRW A;  2ECV A;  2CKL A;  2AN6 A;  1Z60 A;  2KFT A;  3VK6 A;  2VJF B;  2DSM A;  2KWO A;  2UZG A;  5LCW B;  3O35 A;  1FBV A;  3HCU A;  5B8D A;  1X4I A;  1LDK C;  3QZV A;  5G05 B;  3N9L A;  4S3O B;  2L0B A;  4BHW A;  2RR4 A;  2FUU A;  4WZ2 A;  2HDP A;  3LDY A;  2BAY A;  2YSJ A;  3RPG C;  4FIP A;  1RMD A;  2KR4 A;  2VJF A;  3PUR A;  2C2L A;  3LVQ E;  5KH7 A;  2VPB A;  4YC9 A;  2IDA A;  2IQJ A;  1JM7 A;  3SOW A;  2LGK A;  3O34 A;  3KDE C;  3C6W A;  2D8S A;  1Z2Q A;  5JG6 A;  2Y1N A;  3O37 A;  4L7X A;  3M63 A;  2L80 A;  3EB5 A;  3JUE A;  4OGE A;  2DX8 A;  5D1L B;  5G04 B;  5FER A;  4UP5 A;  3IHP A;  4GNE A;  2KWK A;  4CCG X;  2ECJ A;  2ECI A;  2DJA A;  3RPG B;  5SVI B;  4I7B A;  2VPE A;  2JMD A;  3ZYQ A;  2EGM A;  4AP4 A;  5KH9 A;  2LDR A;  2YU4 A;  2KKX A;  4MSX A;  3M99 A;  3LQJ A;  5LKX A;  2KRE A;  5H1V A;  5FEY A;  2Y1M A;  2EGP A;  2D8U A;  2JUN A;  1FP0 A;  2M85 A;  3DQV R;  3FM8 C;  3H7H A;  5I3L A;  2M1R A;  2ECT A;  3T9K A;  2P57 A;  2YSM A;  2YQL A;  3ZVY A;  1MBM A;  5EYA F;  4B86 C;  4FJC A;  4FO9 A;  1G25 A;  2MD8 C;  4QF2 A;  5KH3 A;  3SOU A;  4X3G A;  4AVX A;  3KNV A;  5B76 A;  2XOY A;  3FJU B;  3L1X A;  4V3L C;  1WEO A;  3LQH A;  2FFW A;  3DDT A;  2OWA A;  3M7K A;  2KWJ A;  2G45 A;  2K17 A;  3KQI A;  4IC2 A;  3E2D A;  3DWD A;  3LRQ A;  4YAX A;  1BOR A;  1X4U A;  4WZ3 B;  2CSV A;  5AIT A;  2E61 A;  2YW8 A;  4YAT A;  2XOZ A;  3PLW A;  2Y43 A;  5H9M A;  2QJ0 A;  1WE9 A;  2K4D A;  2MA5 A;  2XB1 A;  5TAB A;  4PTB A;  1WEU A;  2H0D B;  3SOX A;  4NN2 A;  2YT5 A;  4AYC B;  4N3W A;  2KIZ A;  2YUR A;  4UP0 A;  2C2V S;  4CA1 A;  2XEU A;  1DVP A;  3MHS A;  5FB1 A;  1LDJ B;  2K1J A;  1WEV A;  1Z6U A;  2CT2 A;  5C11 A;  2L5U A;  1F62 A;  4QQ4 A;  3KV5 A;  1MM2 A;  3U5N A;  4WA6 A;  5SVY A;  1WEM A;  1U6G B;  2EOD A;  2G6Q A;  1WEQ A;  4FK5 A;  4AUQ B;  1K2F A;  3GL6 A;  2MUM A;  1WEN A;  2CSZ A;  5B78 A;  4ZQL A;  2MKE A;  1ZBD B;  3U5M A;  4UI9 B;  2YQM A;  2VNF A;  5B77 A;  4Z0R A;  4PPE A;  3N9N A;  2G43 A;  3MHH A;  1WFK A;  2JMJ A;  3HTK C;  2YHO A;  1WES A;  1JOC A;  2B0O E;  1T1H A;  1V87 A;  4ZUX U;  3NG2 A;  2ECW A;  2FD4 A;  4MVT A;  2VPD A;  3U5O A;  5G0F A;  5AIU A;  3SUB A;  1WEW A;  3O70 A;  3U5P A;  4I7C A;  2VJE B;  4F52 B;  2ECN A;  2OXQ C;  2CON A;  4A4B A;  3M62 A;  2JMI A;  2MIQ A;  4GNG A;  4A4C A;  4B7Y C;  4YAB A;  2FUI A;  2L7P A;  2MD7 B;  2QIC A;  5SVI A;  3O47 A;  3V43 A;  1VD4 A;  3L1Z B;  1WIL A;  2CKL B;  3HCS A;  2ECG A;  5LKZ A;  4LJN A;  2YUC A;  5B79 A;  2KKY A;  2QIZ A;  1WEP A;  2CSY A;  4LK9 A;  3ZVZ B;  2LQ6 A;  3ASL A;  3HCT A;  3ZPV E;  3N9O A;  2FSA A;  2RSD A;  2MT5 A;  3O7A A;  4LAD B;  1VFY A;  4LLB A;  4I7D A;  2K16 A;  3O36 A;  2MA6 A;  4GB0 A;  2EA6 A;  2JM3 A;  3ZNI A;  3FAN A;  3L11 A;  1HYI A;  1E4U A;  1DCQ A;  4Q6F A;  4R8P K;  2KE1 A;  5D1K B;  2YHN A;  4R7E A;  1JM7 B;  2M3H A;  3RTR B;  2LXH C;  2F6N A;  2LV9 A;  4LKA A;  4YBS A;  5DKA A;  3LQI A;  3PHD A;  2MNY A;  4R2Y A;  2H0D A;  3T7L A;  4BBQ A;  4L58 A;  4XI1 A;  2LXP C;  4P5O B;  3N9Q A;  2I50 A;  4AYC A;  3FL2 A;  4YAD A;  4GNF A;  2ZET C;  2PNX A;  2VPG A;  4ZDT A;  2KU3 A;  2LGG A;  5D1M B;  2KGI A;  5TDW A;  5DIN A;  4W4U A;  3EB6 A;  4GND A;  1WEE A;  2LN0 A;  4H9D A;  2KWN A;  1VYX A;  2KYU A;  3I2D A;  4YBT A;  4YBM A;  3SHB A;  5LKT A;  3LVR E;  4O62 A;  2XP0 A;  5K3Q A;  2LAU A;  1XWH A;  5LKU A;  2L43 A;  1WGM A;  3N9P A;  4V3K C;  4IC3 A;  2F42 A;  5TBN A;  1X4J A;  2KGG A;  2EXU A;  2YVR A;  4A49 A;  3KV6 A;  4A0C D;  2E6R A;  3O33 A;  3PUQ A;  2LGL A;  3ZPV 1;  2E6S A;  3GV4 A;  4QF3 A;  5C13 A;  5SVX A;  2YYR A;  2JRJ A;  2HYE D;  3DPL R;  3FAO A;  2MNZ A;  1IYM A;  2F6J A;  3N9M A;  4N4F A; 
#chains in the Genus database with same CATH homology
 5H1T A;  2L75 A;  2PUY A;  4O64 A;  5J3X A;  5TRB A;  4TKP B;  1MM3 A;  2LGV A;  2RI7 A;  1N87 A;  1WIM A;  4S3O C;  2LRI C;  1HYJ A;  3T6R A;  2VJE A;  5TDR A;  2VP7 A;  5H1U A;  1CHC A;  3ZTG A;  2M6M A;  4C9Z A;  3C5K A;  4WZ0 A;  5FB0 A;  2NAA A;  5B75 A;  2YRE A;  2ECV A;  2CKL A;  2AN6 A;  1Z60 A;  2KFT A;  3VK6 A;  2VJF B;  2KWO A;  2UZG A;  5LCW B;  3O35 A;  1FBV A;  3HCU A;  5B8D A;  1X4I A;  1LDK C;  3QZV A;  5G05 B;  3N9L A;  4S3O B;  2L0B A;  4BHW A;  2FUU A;  4WZ2 A;  2HDP A;  2BAY A;  2YSJ A;  3RPG C;  4FIP A;  1RMD A;  2KR4 A;  2VJF A;  3PUR A;  2C2L A;  5KH7 A;  2VPB A;  4YC9 A;  2IDA A;  1JM7 A;  3SOW A;  2LGK A;  3O34 A;  3C6W A;  2D8S A;  1Z2Q A;  5JG6 A;  2Y1N A;  3O37 A;  4L7X A;  3M63 A;  2L80 A;  3EB5 A;  5D1L B;  2DX8 A;  5G04 B;  5FER A;  4UP5 A;  3IHP A;  4GNE A;  2KWK A;  4CCG X;  2ECJ A;  2ECI A;  3RPG B;  4I7B A;  2VPE A;  2JMD A;  3ZYQ A;  4AP4 A;  5KH9 A;  2LDR A;  2YU4 A;  4MSX A;  3M99 A;  3LQJ A;  5LKX A;  2KRE A;  5H1V A;  5FEY A;  2Y1M A;  2EGP A;  1FP0 A;  2M85 A;  3DQV R;  5I3L A;  2M1R A;  2ECT A;  2YSM A;  2YQL A;  3ZVY A;  5EYA F;  4B86 C;  4FJC A;  4FO9 A;  1G25 A;  2MD8 C;  4QF2 A;  5KH3 A;  3SOU A;  4X3G A;  4AVX A;  3KNV A;  5B76 A;  3L1X A;  4V3L C;  1WEO A;  3LQH A;  2KWJ A;  2G45 A;  2K17 A;  3KQI A;  4IC2 A;  3LRQ A;  4YAX A;  1BOR A;  1X4U A;  4WZ3 B;  5AIT A;  2YW8 A;  4YAT A;  2Y43 A;  5H9M A;  2QJ0 A;  1WE9 A;  2K4D A;  2MA5 A;  2XB1 A;  5TAB A;  4PTB A;  1WEU A;  2H0D B;  3SOX A;  4NN2 A;  2YT5 A;  4AYC B;  4N3W A;  2KIZ A;  2YUR A;  4UP0 A;  2C2V S;  4CA1 A;  2XEU A;  1DVP A;  3MHS A;  5FB1 A;  1LDJ B;  2K1J A;  1WEV A;  1Z6U A;  2CT2 A;  5C11 A;  2L5U A;  1F62 A;  3KV5 A;  1MM2 A;  3U5N A;  4WA6 A;  1WEM A;  1U6G B;  2EOD A;  2G6Q A;  1WEQ A;  4FK5 A;  4AUQ B;  1K2F A;  3GL6 A;  2MUM A;  1WEN A;  2CSZ A;  5B78 A;  4ZQL A;  1ZBD B;  3U5M A;  4UI9 B;  2YQM A;  2VNF A;  5B77 A;  4PPE A;  3N9N A;  2G43 A;  3MHH A;  1WFK A;  2JMJ A;  3HTK C;  2YHO A;  1WES A;  1JOC A;  1T1H A;  1V87 A;  4ZUX U;  3NG2 A;  2ECW A;  4MVT A;  2VPD A;  3U5O A;  5G0F A;  5AIU A;  1WEW A;  3O70 A;  3U5P A;  4I7C A;  2VJE B;  4F52 B;  2ECN A;  2OXQ C;  4A4B A;  3M62 A;  2JMI A;  2MIQ A;  4GNG A;  4A4C A;  4B7Y C;  4YAB A;  2FUI A;  2MD7 B;  2QIC A;  3V43 A;  1VD4 A;  3L1Z B;  1WIL A;  2CKL B;  3HCS A;  2ECG A;  5LKZ A;  4LJN A;  2YUC A;  5B79 A;  2QIZ A;  1WEP A;  2CSY A;  4LK9 A;  3ZVZ B;  2LQ6 A;  3ASL A;  3HCT A;  3ZPV E;  3N9O A;  2FSA A;  2RSD A;  2MT5 A;  3O7A A;  4LAD B;  1VFY A;  4LLB A;  4I7D A;  2K16 A;  3O36 A;  2MA6 A;  4GB0 A;  2EA6 A;  3ZNI A;  3L11 A;  1HYI A;  1E4U A;  4Q6F A;  4R8P K;  2KE1 A;  5D1K B;  2YHN A;  4R7E A;  1JM7 B;  2M3H A;  3RTR B;  2LXH C;  2F6N A;  2LV9 A;  4LKA A;  4YBS A;  5DKA A;  3LQI A;  3PHD A;  2MNY A;  4R2Y A;  2H0D A;  3T7L A;  4BBQ A;  4L58 A;  4XI1 A;  2LXP C;  4P5O B;  3N9Q A;  2I50 A;  4AYC A;  3FL2 A;  4YAD A;  4GNF A;  2ZET C;  2PNX A;  2VPG A;  4ZDT A;  2KU3 A;  2LGG A;  5D1M B;  2KGI A;  5TDW A;  5DIN A;  4W4U A;  3EB6 A;  4GND A;  1WEE A;  2LN0 A;  2KWN A;  1VYX A;  2KYU A;  3I2D A;  4YBT A;  4YBM A;  3SHB A;  5LKT A;  1XWH A;  5LKU A;  2L43 A;  1WGM A;  3N9P A;  4V3K C;  4IC3 A;  2F42 A;  5TBN A;  1X4J A;  2KGG A;  4A49 A;  3KV6 A;  4A0C D;  2E6R A;  3O33 A;  3PUQ A;  2LGL A;  3ZPV 1;  2E6S A;  3GV4 A;  4QF3 A;  5C13 A;  2YYR A;  2JRJ A;  2HYE D;  3DPL R;  2MNZ A;  1IYM A;  2F6J A;  3N9M A;  4N4F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...