2CKLA

Ring1b-bmi1 e3 catalytic domain structure
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
98
structure length
98
Chain Sequence
RIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords POLYCOMB GROUP RING FINGER PROTEIN 4
publication title Structure and E3-Ligase Activity of the Ring-Ring Complex of Polycomb Proteins Bmi1 and Ring1B.
pubmed doi rcsb
source organism Mus musculus
total genus 30
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2006-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2cklA00
2L75A 4YC9A 4ZUXU 1JM7A 2MNZA 3V43A 4FIPA 3M99A 2ECGA 2YQMA 5LKZA 1WEVA 4ZQLA 3DPLR 1Z6UA 1HYIA 2KWKA 4UP0A 2KWJA 2YHNA 4N4FA 2M3HA 1WEWA 1G25A 2VJEA 4PTBA 4MVTA 4A0CD 2YSMA 1F62A 4L7XA 1WEUA 3DQVR 3LQHA 2D8SA 4C9ZA 2MUMA 2MD7B 4QF2A 2MNYA 5H1VA 1V87A 3N9NA 1RMDA 2JMIA 1VFYA 3SOXA 3SOUA 4YABA 2YYRA 3O33A 5H9MA 5TABA 3O7AA 2M85A 3L11A 2CT2A 4A4CA 1MM2A 1JOCA 2Y43A 2LXPC 5FEYA 3O35A 3HCSA 5TDWA 2YSJA 2ECIA 2OXQC 1VD4A 4TKPB 3U5MA 3M63A 1WEMA 5LKUA 1WEOA 1T1HA 2LQ6A 2G43A 2G6QA 3T6RA 4LKAA 1Z60A 5H1TA 4N3WA 2KU3A 5B76A 2H0DB 2LDRA 1HYJA 2YREA 3KV5A 4B7YC 4A4BA 3O34A 3GV4A 2HDPA 1WIMA 2XEUA 3HTKC 4YBMA 2YU4A 3N9LA 2AN6A 3KQIA 2L80A 1N87A 4F52B 2FUIA 3N9MA 1CHCA 3NG2A 4FO9A 2VPEA 4XI1A 5G04B 2VP7A 2VJEB 3QZVA 2C2VS 2QIZA 1E4UA 4W4UA 4UI9B 3MHSA 5H1UA 1MM3A 3PUQA 2CSYA 1LDJB 3M62A 5I3LA 4CCGX 5DINA 2VPGA 5LCWB 2LGGA 4IC3A 2YUCA 2MIQA 2QJ0A 2C2LA 2MA6A 2ECTA 2KWOA 2JRJA 3EB6A 1X4IA 1X4UA 2LGLA 3N9PA 1WEPA 2KGGA 2M1RA 3C6WA 3N9OA 4AYCB 2CKLA 4I7BA 2VNFA 3C5KA 1DVPA 3GL6A 4LK9A 2HYED 2M6MA 4I7DA 4I7CA 5EYAF 2KWNA 4YBSA 5D1KB 4PPEA 4R7EA 4WZ3B 5AITA 5FB0A 4BHWA 3LQIA 3KV6A 4GNFA 2LRIC 3L1ZB 3ZPVE 2EA6A 2FUUA 4ZDTA 2ZETC 2K17A 2MT5A 3RPGC 2VJFB 3FL2A 5G0FA 4LADB 4LLBA 3RTRB 4V3KC 3ZTGA 4FJCA 3ZVZB 4WZ0A 5AIUA 4YADA 5B77A 5KH7A 5KH9A 2RSDA 3KNVA 3LQJA 1XWHA 2I50A 2JMDA 2F6JA 3ZNIA 1JM7B 3ZVYA 5LKTA 3L1XA 1VYXA 2XB1A 2PNXA 5FERA 3HCTA 3ZPV1 5D1MB 5D1LB 4S3OC 4AVXA 2K1JA 2Y1MA 4YATA 4WA6A 1WGMA 4YAXA 5TDRA 1IYMA 4V3LC 4IC2A 2Y1NA 2H0DA 2YQLA 2ECVA 2CKLB 4YBTA 2F42A 2YHOA 2E6RA 4O64A 1WE9A 3ZYQA 3IHPA 4R2YA 3PHDA 4QF3A 2KREA 2ECWA 1K2FA 2KYUA 4P5OB 3VK6A 4LJNA 2KR4A 2QICA 3U5PA 2YW8A 3RPGB 2E6SA 3O70A 3I2DA 3U5OA 5JG6A 5B78A 2RI7A 4FK5A 4BBQA 5B79A 4B86C 2LGVA 4A49A 2K16A 1WENA 5DKAA 4AP4A 2L5UA 2UZGA 4AUQB 4MSXA 2JMJA 2FSAA 1LDKC 2YURA 2MD8C 4UP5A 2L43A 2VPBA 3PURA 3SHBA 1ZBDB 3HCUA 1FBVA 3U5NA 2ECNA 1BORA 3ASLA 2G45A 4GNEA 1WEQA 1WFKA 2EODA 1WESA 4S3OB 1WEEA 4WZ2A 5B75A 4AYCA 3N9QA 2VPDA 2IDAA 2KFTA 2KGIA 2MA5A 2CSZA 3O37A 4L58A 5J3XA 1X4JA 2K4DA 4GNDA 3MHHA 2LGKA 2EGPA 2LN0A 2ECJA 4NN2A 2KIZA 3O36A 5B8DA 4CA1A 3LRQA 5G05B 1WILA 2PUYA 5FB1A 5C11A 2LV9A 2NAAA 2KE1A 4GNGA 3SOWA 2VJFA 5TBNA 4R8PK 5LKXA 2BAYA 1FP0A 2LXHC 5C13A 3EB5A 1Z2QA 4GB0A 2F6NA 2DX8A 5TRBA 3T7LA 2L0BA 4X3GA 2YT5A 5KH3A 1U6GB 4Q6FA
chains in the Genus database with same CATH superfamily
2L75A 4YC9A 4ZUXU 1JM7A 2MNZA 3V43A 4FIPA 3M99A 2ECGA 2YQMA 5LKZA 1WEVA 3DDTA 4QQ4A 4ZQLA 3DPLR 1Z6UA 1HYIA 2KWKA 4UP0A 2RR4A 2KWJA 2YHNA 3MDBC 4N4FA 2M3HA 1WEWA 1G25A 2VJEA 4PTBA 4O62A 4MVTA 4A0CD 2YSMA 1F62A 4L7XA 1WEUA 3DQVR 3LQHA 2D8SA 4C9ZA 2MUMA 2MD7B 4QF2A 2MNYA 2FD4A 5H1VA 1V87A 3N9NA 1RMDA 2JMIA 1VFYA 3SOXA 3SOUA 4YABA 2YYRA 3O33A 5H9MA 5K3QA 2CONA 5TABA 3O7AA 2M85A 3L11A 2CT2A 4A4CA 1MM2A 1JOCA 2Y43A 3H7HA 2LXPC 2B0OE 5FEYA 3O35A 3HCSA 5TDWA 3O47A 2YSJA 2ECIA 2OXQC 1VD4A 4TKPB 3U5MA 2LAUA 2EGMA 3M63A 4Z0RA 1WEMA 4OGEA 5LKUA 1WEOA 1T1HA 2LQ6A 3FEHA 2G43A 2G6QA 3T6RA 3SUBA 2CSVA 4LKAA 1Z60A 5H1TA 4N3WA 2CRWA 2KU3A 5B76A 2H0DB 2LDRA 1HYJA 2YREA 3KV5A 4B7YC 4A4BA 3LVRE 3O34A 3GV4A 2HDPA 1WIMA 2XEUA 3HTKC 4YBMA 2YU4A 3N9LA 2AN6A 3KQIA 3LJUX 2L80A 1N87A 4F52B 2FUIA 3N9MA 1CHCA 3NG2A 4FO9A 2VPEA 4XI1A 5G04B 2XOCA 2VP7A 2FFWA 2P57A 2XOYA 2VJEB 3FAOA 3QZVA 2C2VS 2QIZA 1E4UA 4W4UA 2JM3A 4UI9B 3LDYA 3MHSA 5H1UA 1MM3A 3PUQA 2CSYA 1LDJB 3M62A 5I3LA 4CCGX 5DINA 5SVIA 2VPGA 5LCWB 2LGGA 4IC3A 2KKXA 2YUCA 2MIQA 2QJ0A 2C2LA 2MA6A 2ECTA 2KWOA 2JRJA 3EB6A 1X4IA 1X4UA 2LGLA 3N9PA 1WEPA 2KGGA 2M1RA 3C6WA 3JUEA 3N9OA 4AYCB 2M13A 2CKLA 4I7BA 2VNFA 2JUNA 3C5KA 1DVPA 3GL6A 4LK9A 2HYED 2M6MA 2MKEA 4I7DA 4I7CA 5EYAF 2KWNA 4YBSA 5D1KB 2L7PA 4R7EA 4PPEA 4WZ3B 5AITA 5FB0A 4BHWA 3LQIA 3KV6A 4Z0OA 4GNFA 2LRIC 3L1ZB 2EXUA 3ZPVE 2EA6A 2FUUA 4ZDTA 2ZETC 5SVYA 2K17A 2MT5A 3RPGC 3T9KA 2VJFB 3FL2A 5G0FA 4LADB 4LLBA 3RTRB 3M7KA 4H9DA 4V3KC 3KDEC 3ZTGA 4FJCA 3ZVZB 4WZ0A 5AIUA 4YADA 5B77A 5KH7A 5KH9A 2RSDA 3KNVA 3FJUB 3LQJA 1XWHA 2I50A 2JMDA 2F6JA 3ZNIA 1JM7B 3ZVYA 5LKTA 3L1XA 1VYXA 2XB1A 2PNXA 5FERA 3HCTA 3ZPV1 5D1MB 5D1LB 4S3OC 4AVXA 1MBMA 2K1JA 2Y1MA 4YATA 5SVIB 4WA6A 1WGMA 4YAXA 5TDRA 1IYMA 4V3LC 4IC2A 2Y1NA 2DSMA 2H0DA 2YQLA 2ECVA 2CKLB 4YBTA 2F42A 2YHOA 2E6RA 3PLWA 4O64A 1WE9A 3ZYQA 3IHPA 4R2YA 3PHDA 4QF3A 2KREA 2ECWA 1K2FA 2KYUA 4P5OB 3VK6A 4LJNA 2KR4A 2QICA 2YVRA 3U5PA 2YW8A 3RPGB 2E6SA 3O70A 3I2DA 3U5OA 5JG6A 5B78A 2RI7A 4FK5A 4BBQA 2IQJA 5B79A 4B86C 2LGVA 4A49A 2K16A 4OGCA 1WENA 5DKAA 4AP4A 2L5UA 2UZGA 4AUQB 4MSXA 2JMJA 2FSAA 1LDKC 3Q1DA 2YURA 2MD8C 4UP5A 2L43A 2VPBA 3PURA 3SHBA 1ZBDB 3HCUA 1FBVA 3U5NA 2ECNA 1BORA 1DCQA 3ASLA 2G45A 4GNEA 1WEQA 1WFKA 2EODA 1WESA 4S3OB 2XOZA 1WEEA 4WZ2A 5B75A 4AYCA 3N9QA 2VPDA 2IDAA 2XP0A 3FANA 2KFTA 2KGIA 2MA5A 2CSZA 3O37A 4L58A 5J3XA 1X4JA 2K4DA 4GNDA 3MHHA 2LGKA 2EGPA 2E61A 2LN0A 2ECJA 4NN2A 2KIZA 3O36A 5B8DA 5SVXA 4CA1A 3LRQA 3DWDA 5G05B 1WILA 2PUYA 5FB1A 5C11A 2LV9A 2NAAA 2KE1A 4GNGA 3SOWA 2VJFA 2KKYA 5TBNA 4R8PK 5LKXA 2BAYA 1FP0A 2LXHC 5C13A 2CRRA 3EB5A 1Z2QA 4GB0A 2F6NA 2D8UA 2DJAA 2DX8A 3FM8C 3E2DA 5TRBA 3LVQE 3T7LA 2L0BA 4F1PA 4X3GA 2YT5A 5KH3A 1U6GB 4Q6FA 2OWAA
chains in the Genus database with same CATH topology
2L75A 4YC9A 4ZUXU 1JM7A 2MNZA 3V43A 4FIPA 3M99A 2ECGA 2YQMA 5LKZA 1WEVA 4ZQLA 3DPLR 1Z6UA 1HYIA 2KWKA 4UP0A 2KWJA 2YHNA 4N4FA 2M3HA 1WEWA 1G25A 2VJEA 4PTBA 4MVTA 4A0CD 2YSMA 1F62A 4L7XA 1WEUA 3DQVR 3LQHA 2D8SA 4C9ZA 2MUMA 2MD7B 4QF2A 2MNYA 5H1VA 1V87A 3N9NA 1RMDA 2JMIA 1VFYA 3SOXA 3SOUA 4YABA 2YYRA 3O33A 5H9MA 5TABA 3O7AA 2M85A 3L11A 2CT2A 4A4CA 1MM2A 1JOCA 2Y43A 2LXPC 5FEYA 3O35A 3HCSA 5TDWA 2YSJA 2ECIA 2OXQC 1VD4A 4TKPB 3U5MA 3M63A 1WEMA 5LKUA 1WEOA 1T1HA 2LQ6A 2G43A 2G6QA 3T6RA 4LKAA 1Z60A 5H1TA 4N3WA 2KU3A 5B76A 2H0DB 2LDRA 1HYJA 2YREA 3KV5A 4B7YC 4A4BA 3O34A 3GV4A 2HDPA 1WIMA 2XEUA 3HTKC 4YBMA 2YU4A 3N9LA 2AN6A 3KQIA 2L80A 1N87A 4F52B 2FUIA 3N9MA 1CHCA 3NG2A 4FO9A 2VPEA 4XI1A 5G04B 2VP7A 2VJEB 3QZVA 2C2VS 2QIZA 1E4UA 4W4UA 4UI9B 3MHSA 5H1UA 1MM3A 3PUQA 2CSYA 1LDJB 3M62A 5I3LA 4CCGX 5DINA 2VPGA 5LCWB 2LGGA 4IC3A 2YUCA 2MIQA 2QJ0A 2C2LA 2MA6A 2ECTA 2KWOA 2JRJA 3EB6A 1X4IA 1X4UA 2LGLA 3N9PA 1WEPA 2KGGA 2M1RA 3C6WA 3N9OA 4AYCB 2CKLA 4I7BA 2VNFA 3C5KA 1DVPA 3GL6A 4LK9A 2HYED 2M6MA 4I7DA 4I7CA 5EYAF 2KWNA 4YBSA 5D1KB 4PPEA 4R7EA 4WZ3B 5AITA 5FB0A 4BHWA 3LQIA 3KV6A 4GNFA 2LRIC 3L1ZB 3ZPVE 2EA6A 2FUUA 4ZDTA 2ZETC 2K17A 2MT5A 3RPGC 2VJFB 3FL2A 5G0FA 4LADB 4LLBA 3RTRB 4V3KC 3ZTGA 4FJCA 3ZVZB 4WZ0A 5AIUA 4YADA 5B77A 5KH7A 5KH9A 2RSDA 3KNVA 3LQJA 1XWHA 2I50A 2JMDA 2F6JA 3ZNIA 1JM7B 3ZVYA 5LKTA 3L1XA 1VYXA 2XB1A 2PNXA 5FERA 3HCTA 3ZPV1 5D1MB 5D1LB 4S3OC 4AVXA 2K1JA 2Y1MA 4YATA 4WA6A 1WGMA 4YAXA 5TDRA 1IYMA 4V3LC 4IC2A 2Y1NA 2H0DA 2YQLA 2ECVA 2CKLB 4YBTA 2F42A 2YHOA 2E6RA 4O64A 1WE9A 3ZYQA 3IHPA 4R2YA 3PHDA 4QF3A 2KREA 2ECWA 1K2FA 2KYUA 4P5OB 3VK6A 4LJNA 2KR4A 2QICA 3U5PA 2YW8A 3RPGB 2E6SA 3O70A 3I2DA 3U5OA 5JG6A 5B78A 2RI7A 4FK5A 4BBQA 5B79A 4B86C 2LGVA 4A49A 2K16A 1WENA 5DKAA 4AP4A 2L5UA 2UZGA 4AUQB 4MSXA 2JMJA 2FSAA 1LDKC 2YURA 2MD8C 4UP5A 2L43A 2VPBA 3PURA 3SHBA 1ZBDB 3HCUA 1FBVA 3U5NA 2ECNA 1BORA 3ASLA 2G45A 4GNEA 1WEQA 1WFKA 2EODA 1WESA 4S3OB 1WEEA 4WZ2A 5B75A 4AYCA 3N9QA 2VPDA 2IDAA 2KFTA 2KGIA 2MA5A 2CSZA 3O37A 4L58A 5J3XA 1X4JA 2K4DA 4GNDA 3MHHA 2LGKA 2EGPA 2LN0A 2ECJA 4NN2A 2KIZA 3O36A 5B8DA 4CA1A 3LRQA 5G05B 1WILA 2PUYA 5FB1A 5C11A 2LV9A 2NAAA 2KE1A 4GNGA 3SOWA 2VJFA 5TBNA 4R8PK 5LKXA 2BAYA 1FP0A 2LXHC 5C13A 3EB5A 1Z2QA 4GB0A 2F6NA 2DX8A 5TRBA 3T7LA 2L0BA 4X3GA 2YT5A 5KH3A 1U6GB 4Q6FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L75 A;  4YC9 A;  4ZUX U;  1JM7 A;  2MNZ A;  3V43 A;  4FIP A;  3M99 A;  2ECG A;  2YQM A;  5LKZ A;  1WEV A;  4ZQL A;  3DPL R;  1Z6U A;  1HYI A;  2KWK A;  4UP0 A;  2KWJ A;  2YHN A;  4N4F A;  2M3H A;  1WEW A;  1G25 A;  2VJE A;  4PTB A;  4MVT A;  4A0C D;  2YSM A;  1F62 A;  4L7X A;  1WEU A;  3DQV R;  3LQH A;  2D8S A;  4C9Z A;  2MUM A;  2MD7 B;  4QF2 A;  2MNY A;  5H1V A;  1V87 A;  3N9N A;  1RMD A;  2JMI A;  1VFY A;  3SOX A;  3SOU A;  4YAB A;  2YYR A;  3O33 A;  5H9M A;  5TAB A;  3O7A A;  2M85 A;  3L11 A;  2CT2 A;  4A4C A;  1MM2 A;  1JOC A;  2Y43 A;  2LXP C;  5FEY A;  3O35 A;  3HCS A;  5TDW A;  2YSJ A;  2ECI A;  2OXQ C;  1VD4 A;  4TKP B;  3U5M A;  3M63 A;  1WEM A;  5LKU A;  1WEO A;  1T1H A;  2LQ6 A;  2G43 A;  2G6Q A;  3T6R A;  4LKA A;  1Z60 A;  5H1T A;  4N3W A;  2KU3 A;  5B76 A;  2H0D B;  2LDR A;  1HYJ A;  2YRE A;  3KV5 A;  4B7Y C;  4A4B A;  3O34 A;  3GV4 A;  2HDP A;  1WIM A;  2XEU A;  3HTK C;  4YBM A;  2YU4 A;  3N9L A;  2AN6 A;  3KQI A;  2L80 A;  1N87 A;  4F52 B;  2FUI A;  3N9M A;  1CHC A;  3NG2 A;  4FO9 A;  2VPE A;  4XI1 A;  5G04 B;  2VP7 A;  2VJE B;  3QZV A;  2C2V S;  2QIZ A;  1E4U A;  4W4U A;  4UI9 B;  3MHS A;  5H1U A;  1MM3 A;  3PUQ A;  2CSY A;  1LDJ B;  3M62 A;  5I3L A;  4CCG X;  5DIN A;  2VPG A;  5LCW B;  2LGG A;  4IC3 A;  2YUC A;  2MIQ A;  2QJ0 A;  2C2L A;  2MA6 A;  2ECT A;  2KWO A;  2JRJ A;  3EB6 A;  1X4I A;  1X4U A;  2LGL A;  3N9P A;  1WEP A;  2KGG A;  2M1R A;  3C6W A;  3N9O A;  4AYC B;  2CKL A;  4I7B A;  2VNF A;  3C5K A;  1DVP A;  3GL6 A;  4LK9 A;  2HYE D;  2M6M A;  4I7D A;  4I7C A;  5EYA F;  2KWN A;  4YBS A;  5D1K B;  4PPE A;  4R7E A;  4WZ3 B;  5AIT A;  5FB0 A;  4BHW A;  3LQI A;  3KV6 A;  4GNF A;  2LRI C;  3L1Z B;  3ZPV E;  2EA6 A;  2FUU A;  4ZDT A;  2ZET C;  2K17 A;  2MT5 A;  3RPG C;  2VJF B;  3FL2 A;  5G0F A;  4LAD B;  4LLB A;  3RTR B;  4V3K C;  3ZTG A;  4FJC A;  3ZVZ B;  4WZ0 A;  5AIU A;  4YAD A;  5B77 A;  5KH7 A;  5KH9 A;  2RSD A;  3KNV A;  3LQJ A;  1XWH A;  2I50 A;  2JMD A;  2F6J A;  3ZNI A;  1JM7 B;  3ZVY A;  5LKT A;  3L1X A;  1VYX A;  2XB1 A;  2PNX A;  5FER A;  3HCT A;  3ZPV 1;  5D1M B;  5D1L B;  4S3O C;  4AVX A;  2K1J A;  2Y1M A;  4YAT A;  4WA6 A;  1WGM A;  4YAX A;  5TDR A;  1IYM A;  4V3L C;  4IC2 A;  2Y1N A;  2H0D A;  2YQL A;  2ECV A;  2CKL B;  4YBT A;  2F42 A;  2YHO A;  2E6R A;  4O64 A;  1WE9 A;  3ZYQ A;  3IHP A;  4R2Y A;  3PHD A;  4QF3 A;  2KRE A;  2ECW A;  1K2F A;  2KYU A;  4P5O B;  3VK6 A;  4LJN A;  2KR4 A;  2QIC A;  3U5P A;  2YW8 A;  3RPG B;  2E6S A;  3O70 A;  3I2D A;  3U5O A;  5JG6 A;  5B78 A;  2RI7 A;  4FK5 A;  4BBQ A;  5B79 A;  4B86 C;  2LGV A;  4A49 A;  2K16 A;  1WEN A;  5DKA A;  4AP4 A;  2L5U A;  2UZG A;  4AUQ B;  4MSX A;  2JMJ A;  2FSA A;  1LDK C;  2YUR A;  2MD8 C;  4UP5 A;  2L43 A;  2VPB A;  3PUR A;  3SHB A;  1ZBD B;  3HCU A;  1FBV A;  3U5N A;  2ECN A;  1BOR A;  3ASL A;  2G45 A;  4GNE A;  1WEQ A;  1WFK A;  2EOD A;  1WES A;  4S3O B;  1WEE A;  4WZ2 A;  5B75 A;  4AYC A;  3N9Q A;  2VPD A;  2IDA A;  2KFT A;  2KGI A;  2MA5 A;  2CSZ A;  3O37 A;  4L58 A;  5J3X A;  1X4J A;  2K4D A;  4GND A;  3MHH A;  2LGK A;  2EGP A;  2LN0 A;  2ECJ A;  4NN2 A;  2KIZ A;  3O36 A;  5B8D A;  4CA1 A;  3LRQ A;  5G05 B;  1WIL A;  2PUY A;  5FB1 A;  5C11 A;  2LV9 A;  2NAA A;  2KE1 A;  4GNG A;  3SOW A;  2VJF A;  5TBN A;  4R8P K;  5LKX A;  2BAY A;  1FP0 A;  2LXH C;  5C13 A;  3EB5 A;  1Z2Q A;  4GB0 A;  2F6N A;  2DX8 A;  5TRB A;  3T7L A;  2L0B A;  4X3G A;  2YT5 A;  5KH3 A;  1U6G B;  4Q6F A; 
#chains in the Genus database with same CATH topology
 2L75 A;  4YC9 A;  4ZUX U;  1JM7 A;  2MNZ A;  3V43 A;  4FIP A;  3M99 A;  2ECG A;  2YQM A;  5LKZ A;  1WEV A;  3DDT A;  4QQ4 A;  4ZQL A;  3DPL R;  1Z6U A;  1HYI A;  2KWK A;  4UP0 A;  2RR4 A;  2KWJ A;  2YHN A;  3MDB C;  4N4F A;  2M3H A;  1WEW A;  1G25 A;  2VJE A;  4PTB A;  4O62 A;  4MVT A;  4A0C D;  2YSM A;  1F62 A;  4L7X A;  1WEU A;  3DQV R;  3LQH A;  2D8S A;  4C9Z A;  2MUM A;  2MD7 B;  4QF2 A;  2MNY A;  2FD4 A;  5H1V A;  1V87 A;  3N9N A;  1RMD A;  2JMI A;  1VFY A;  3SOX A;  3SOU A;  4YAB A;  2YYR A;  3O33 A;  5H9M A;  5K3Q A;  2CON A;  5TAB A;  3O7A A;  2M85 A;  3L11 A;  2CT2 A;  4A4C A;  1MM2 A;  1JOC A;  2Y43 A;  3H7H A;  2LXP C;  2B0O E;  5FEY A;  3O35 A;  3HCS A;  5TDW A;  3O47 A;  2YSJ A;  2ECI A;  2OXQ C;  1VD4 A;  4TKP B;  3U5M A;  2LAU A;  2EGM A;  3M63 A;  4Z0R A;  1WEM A;  4OGE A;  5LKU A;  1WEO A;  1T1H A;  2LQ6 A;  3FEH A;  2G43 A;  2G6Q A;  3T6R A;  3SUB A;  2CSV A;  4LKA A;  1Z60 A;  5H1T A;  4N3W A;  2CRW A;  2KU3 A;  5B76 A;  2H0D B;  2LDR A;  1HYJ A;  2YRE A;  3KV5 A;  4B7Y C;  4A4B A;  3LVR E;  3O34 A;  3GV4 A;  2HDP A;  1WIM A;  2XEU A;  3HTK C;  4YBM A;  2YU4 A;  3N9L A;  2AN6 A;  3KQI A;  3LJU X;  2L80 A;  1N87 A;  4F52 B;  2FUI A;  3N9M A;  1CHC A;  3NG2 A;  4FO9 A;  2VPE A;  4XI1 A;  5G04 B;  2XOC A;  2VP7 A;  2FFW A;  2P57 A;  2XOY A;  2VJE B;  3FAO A;  3QZV A;  2C2V S;  2QIZ A;  1E4U A;  4W4U A;  2JM3 A;  4UI9 B;  3LDY A;  3MHS A;  5H1U A;  1MM3 A;  3PUQ A;  2CSY A;  1LDJ B;  3M62 A;  5I3L A;  4CCG X;  5DIN A;  5SVI A;  2VPG A;  5LCW B;  2LGG A;  4IC3 A;  2KKX A;  2YUC A;  2MIQ A;  2QJ0 A;  2C2L A;  2MA6 A;  2ECT A;  2KWO A;  2JRJ A;  3EB6 A;  1X4I A;  1X4U A;  2LGL A;  3N9P A;  1WEP A;  2KGG A;  2M1R A;  3C6W A;  3JUE A;  3N9O A;  4AYC B;  2M13 A;  2CKL A;  4I7B A;  2VNF A;  2JUN A;  3C5K A;  1DVP A;  3GL6 A;  4LK9 A;  2HYE D;  2M6M A;  2MKE A;  4I7D A;  4I7C A;  5EYA F;  2KWN A;  4YBS A;  5D1K B;  2L7P A;  4R7E A;  4PPE A;  4WZ3 B;  5AIT A;  5FB0 A;  4BHW A;  3LQI A;  3KV6 A;  4Z0O A;  4GNF A;  2LRI C;  3L1Z B;  2EXU A;  3ZPV E;  2EA6 A;  2FUU A;  4ZDT A;  2ZET C;  5SVY A;  2K17 A;  2MT5 A;  3RPG C;  3T9K A;  2VJF B;  3FL2 A;  5G0F A;  4LAD B;  4LLB A;  3RTR B;  3M7K A;  4H9D A;  4V3K C;  3KDE C;  3ZTG A;  4FJC A;  3ZVZ B;  4WZ0 A;  5AIU A;  4YAD A;  5B77 A;  5KH7 A;  5KH9 A;  2RSD A;  3KNV A;  3FJU B;  3LQJ A;  1XWH A;  2I50 A;  2JMD A;  2F6J A;  3ZNI A;  1JM7 B;  3ZVY A;  5LKT A;  3L1X A;  1VYX A;  2XB1 A;  2PNX A;  5FER A;  3HCT A;  3ZPV 1;  5D1M B;  5D1L B;  4S3O C;  4AVX A;  1MBM A;  2K1J A;  2Y1M A;  4YAT A;  5SVI B;  4WA6 A;  1WGM A;  4YAX A;  5TDR A;  1IYM A;  4V3L C;  4IC2 A;  2Y1N A;  2DSM A;  2H0D A;  2YQL A;  2ECV A;  2CKL B;  4YBT A;  2F42 A;  2YHO A;  2E6R A;  3PLW A;  4O64 A;  1WE9 A;  3ZYQ A;  3IHP A;  4R2Y A;  3PHD A;  4QF3 A;  2KRE A;  2ECW A;  1K2F A;  2KYU A;  4P5O B;  3VK6 A;  4LJN A;  2KR4 A;  2QIC A;  2YVR A;  3U5P A;  2YW8 A;  3RPG B;  2E6S A;  3O70 A;  3I2D A;  3U5O A;  5JG6 A;  5B78 A;  2RI7 A;  4FK5 A;  4BBQ A;  2IQJ A;  5B79 A;  4B86 C;  2LGV A;  4A49 A;  2K16 A;  4OGC A;  1WEN A;  5DKA A;  4AP4 A;  2L5U A;  2UZG A;  4AUQ B;  4MSX A;  2JMJ A;  2FSA A;  1LDK C;  3Q1D A;  2YUR A;  2MD8 C;  4UP5 A;  2L43 A;  2VPB A;  3PUR A;  3SHB A;  1ZBD B;  3HCU A;  1FBV A;  3U5N A;  2ECN A;  1BOR A;  1DCQ A;  3ASL A;  2G45 A;  4GNE A;  1WEQ A;  1WFK A;  2EOD A;  1WES A;  4S3O B;  2XOZ A;  1WEE A;  4WZ2 A;  5B75 A;  4AYC A;  3N9Q A;  2VPD A;  2IDA A;  2XP0 A;  3FAN A;  2KFT A;  2KGI A;  2MA5 A;  2CSZ A;  3O37 A;  4L58 A;  5J3X A;  1X4J A;  2K4D A;  4GND A;  3MHH A;  2LGK A;  2EGP A;  2E61 A;  2LN0 A;  2ECJ A;  4NN2 A;  2KIZ A;  3O36 A;  5B8D A;  5SVX A;  4CA1 A;  3LRQ A;  3DWD A;  5G05 B;  1WIL A;  2PUY A;  5FB1 A;  5C11 A;  2LV9 A;  2NAA A;  2KE1 A;  4GNG A;  3SOW A;  2VJF A;  2KKY A;  5TBN A;  4R8P K;  5LKX A;  2BAY A;  1FP0 A;  2LXH C;  5C13 A;  2CRR A;  3EB5 A;  1Z2Q A;  4GB0 A;  2F6N A;  2D8U A;  2DJA A;  2DX8 A;  3FM8 C;  3E2D A;  5TRB A;  3LVQ E;  3T7L A;  2L0B A;  4F1P A;  4X3G A;  2YT5 A;  5KH3 A;  1U6G B;  4Q6F A;  2OWA A; 
#chains in the Genus database with same CATH homology
 2L75 A;  4YC9 A;  4ZUX U;  1JM7 A;  2MNZ A;  3V43 A;  4FIP A;  3M99 A;  2ECG A;  2YQM A;  5LKZ A;  1WEV A;  4ZQL A;  3DPL R;  1Z6U A;  1HYI A;  2KWK A;  4UP0 A;  2KWJ A;  2YHN A;  4N4F A;  2M3H A;  1WEW A;  1G25 A;  2VJE A;  4PTB A;  4MVT A;  4A0C D;  2YSM A;  1F62 A;  4L7X A;  1WEU A;  3DQV R;  3LQH A;  2D8S A;  4C9Z A;  2MUM A;  2MD7 B;  4QF2 A;  2MNY A;  5H1V A;  1V87 A;  3N9N A;  1RMD A;  2JMI A;  1VFY A;  3SOX A;  3SOU A;  4YAB A;  2YYR A;  3O33 A;  5H9M A;  5TAB A;  3O7A A;  2M85 A;  3L11 A;  2CT2 A;  4A4C A;  1MM2 A;  1JOC A;  2Y43 A;  2LXP C;  5FEY A;  3O35 A;  3HCS A;  5TDW A;  2YSJ A;  2ECI A;  2OXQ C;  1VD4 A;  4TKP B;  3U5M A;  3M63 A;  1WEM A;  5LKU A;  1WEO A;  1T1H A;  2LQ6 A;  2G43 A;  2G6Q A;  3T6R A;  4LKA A;  1Z60 A;  5H1T A;  4N3W A;  2KU3 A;  5B76 A;  2H0D B;  2LDR A;  1HYJ A;  2YRE A;  3KV5 A;  4B7Y C;  4A4B A;  3O34 A;  3GV4 A;  2HDP A;  1WIM A;  2XEU A;  3HTK C;  4YBM A;  2YU4 A;  3N9L A;  2AN6 A;  3KQI A;  2L80 A;  1N87 A;  4F52 B;  2FUI A;  3N9M A;  1CHC A;  3NG2 A;  4FO9 A;  2VPE A;  4XI1 A;  5G04 B;  2VP7 A;  2VJE B;  3QZV A;  2C2V S;  2QIZ A;  1E4U A;  4W4U A;  4UI9 B;  3MHS A;  5H1U A;  1MM3 A;  3PUQ A;  2CSY A;  1LDJ B;  3M62 A;  5I3L A;  4CCG X;  5DIN A;  2VPG A;  5LCW B;  2LGG A;  4IC3 A;  2YUC A;  2MIQ A;  2QJ0 A;  2C2L A;  2MA6 A;  2ECT A;  2KWO A;  2JRJ A;  3EB6 A;  1X4I A;  1X4U A;  2LGL A;  3N9P A;  1WEP A;  2KGG A;  2M1R A;  3C6W A;  3N9O A;  4AYC B;  2CKL A;  4I7B A;  2VNF A;  3C5K A;  1DVP A;  3GL6 A;  4LK9 A;  2HYE D;  2M6M A;  4I7D A;  4I7C A;  5EYA F;  2KWN A;  4YBS A;  5D1K B;  4PPE A;  4R7E A;  4WZ3 B;  5AIT A;  5FB0 A;  4BHW A;  3LQI A;  3KV6 A;  4GNF A;  2LRI C;  3L1Z B;  3ZPV E;  2EA6 A;  2FUU A;  4ZDT A;  2ZET C;  2K17 A;  2MT5 A;  3RPG C;  2VJF B;  3FL2 A;  5G0F A;  4LAD B;  4LLB A;  3RTR B;  4V3K C;  3ZTG A;  4FJC A;  3ZVZ B;  4WZ0 A;  5AIU A;  4YAD A;  5B77 A;  5KH7 A;  5KH9 A;  2RSD A;  3KNV A;  3LQJ A;  1XWH A;  2I50 A;  2JMD A;  2F6J A;  3ZNI A;  1JM7 B;  3ZVY A;  5LKT A;  3L1X A;  1VYX A;  2XB1 A;  2PNX A;  5FER A;  3HCT A;  3ZPV 1;  5D1M B;  5D1L B;  4S3O C;  4AVX A;  2K1J A;  2Y1M A;  4YAT A;  4WA6 A;  1WGM A;  4YAX A;  5TDR A;  1IYM A;  4V3L C;  4IC2 A;  2Y1N A;  2H0D A;  2YQL A;  2ECV A;  2CKL B;  4YBT A;  2F42 A;  2YHO A;  2E6R A;  4O64 A;  1WE9 A;  3ZYQ A;  3IHP A;  4R2Y A;  3PHD A;  4QF3 A;  2KRE A;  2ECW A;  1K2F A;  2KYU A;  4P5O B;  3VK6 A;  4LJN A;  2KR4 A;  2QIC A;  3U5P A;  2YW8 A;  3RPG B;  2E6S A;  3O70 A;  3I2D A;  3U5O A;  5JG6 A;  5B78 A;  2RI7 A;  4FK5 A;  4BBQ A;  5B79 A;  4B86 C;  2LGV A;  4A49 A;  2K16 A;  1WEN A;  5DKA A;  4AP4 A;  2L5U A;  2UZG A;  4AUQ B;  4MSX A;  2JMJ A;  2FSA A;  1LDK C;  2YUR A;  2MD8 C;  4UP5 A;  2L43 A;  2VPB A;  3PUR A;  3SHB A;  1ZBD B;  3HCU A;  1FBV A;  3U5N A;  2ECN A;  1BOR A;  3ASL A;  2G45 A;  4GNE A;  1WEQ A;  1WFK A;  2EOD A;  1WES A;  4S3O B;  1WEE A;  4WZ2 A;  5B75 A;  4AYC A;  3N9Q A;  2VPD A;  2IDA A;  2KFT A;  2KGI A;  2MA5 A;  2CSZ A;  3O37 A;  4L58 A;  5J3X A;  1X4J A;  2K4D A;  4GND A;  3MHH A;  2LGK A;  2EGP A;  2LN0 A;  2ECJ A;  4NN2 A;  2KIZ A;  3O36 A;  5B8D A;  4CA1 A;  3LRQ A;  5G05 B;  1WIL A;  2PUY A;  5FB1 A;  5C11 A;  2LV9 A;  2NAA A;  2KE1 A;  4GNG A;  3SOW A;  2VJF A;  5TBN A;  4R8P K;  5LKX A;  2BAY A;  1FP0 A;  2LXH C;  5C13 A;  3EB5 A;  1Z2Q A;  4GB0 A;  2F6N A;  2DX8 A;  5TRB A;  3T7L A;  2L0B A;  4X3G A;  2YT5 A;  5KH3 A;  1U6G B;  4Q6F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...