2CKLA

Ring1b-bmi1 e3 catalytic domain structure
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
98
structure length
98
Chain Sequence
RIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and E3-Ligase Activity of the Ring-Ring Complex of Polycomb Proteins Bmi1 and Ring1B.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
molecule keywords POLYCOMB GROUP RING FINGER PROTEIN 4
total genus 30
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2006-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2cklA00
3N9PA 1JM7B 3LRQA 4YBSA 2RSDA 2YURA 3C5KA 5B75A 1V87A 5AITA 3L1ZB 2ECGA 4YC9A 4AYCB 3ZNIA 4A0CD 4GNFA 2KREA 4YAXA 3SOXA 1WE9A 3SHBA 5FEYA 4LKAA 4YBMA 4UP0A 3O7AA 2VJFB 5H1TA 3GL6A 2CSYA 4R2YA 3ZVZB 3U5OA 2KYUA 2F6NA 5B78A 3M63A 2YUCA 4V3LC 4XI1A 2UZGA 3EB5A 2L80A 5TRBA 2MUMA 4A49A 2HDPA 4BHWA 4S3OC 4AYCA 2CKLA 5AIUA 3RTRB 1WEPA 2Y43A 4YABA 4B7YC 2VJEB 3VK6A 2LGVA 4F52B 2LRIC 1Z6UA 3V43A 2H0DA 2OXQC 3FL2A 3SOUA 1VYXA 3T7LA 1JM7A 2F42A 2K1JA 3PURA 4W4UA 3O70A 2CT2A 3N9NA 3O36A 2K16A 2CSZA 4FO9A 2LXPC 2HYED 3KQIA 3M99A 1WGMA 2FSAA 5B76A 2MT5A 5H1VA 2E6RA 2QJ0A 2MD8C 5KH3A 4WZ0A 2KWJA 1X4JA 2LGKA 1VD4A 2FUIA 4A4CA 2I50A 4L7XA 2YYRA 4YADA 4BBQA 3ZYQA 4ZDTA 3DQVR 4FK5A 2IDAA 2G6QA 2VJFA 2E6SA 5LKZA 4R8PK 2EGPA 1WEWA 2JRJA 2G43A 1WEMA 4GB0A 1HYIA 1K2FA 4ZUXU 4LK9A 4LJNA 4PPEA 2XB1A 3N9LA 1WEEA 2LN0A 5H9MA 1E4UA 3ZVYA 2XEUA 1VFYA 1XWHA 4GNDA 1WESA 3L11A 1WEVA 1WEOA 5JG6A 4FJCA 4N4FA 2ECNA 1LDJB 3N9OA 5TDWA 3LQIA 5G04B 3HCSA 2VPEA 3U5MA 2MD7B 2KE1A 2VJEA 3ZPVE 2M6MA 4N3WA 2MNZA 2C2VS 3KV6A 2PNXA 1RMDA 3I2DA 4AUQB 3N9QA 4LADB 2L43A 2ECIA 3O33A 5D1LB 3RPGC 2YREA 5H1UA 1ZBDB 3C6WA 4AVXA 2M85A 2RI7A 3M62A 4QF2A 2KWNA 3U5PA 2MA5A 5DKAA 2C2LA 5C13A 1BORA 5KH7A 3GV4A 5KH9A 4A4BA 2MA6A 1DVPA 4WZ3B 4B86C 1WENA 5TDRA 2G45A 3PUQA 4C9ZA 2H0DB 4YATA 2YSMA 2KGIA 5FB1A 2JMDA 5D1MB 3N9MA 4I7DA 5I3LA 2K4DA 2NAAA 4GNEA 4X3GA 2LDRA 2M1RA 2QICA 3O35A 4O64A 4Q6FA 1U6GB 1FBVA 4MVTA 5J3XA 3SOWA 2VPBA 2Y1NA 2K17A 5C11A 4TKPB 2KWOA 2KU3A 1F62A 5G05B 3T6RA 4GNGA 1G25A 3L1XA 1WEQA 3HCTA 3O34A 4LLBA 4UP5A 4WA6A 1HYJA 2YSJA 1Z60A 2YHOA 1WILA 4YBTA 2F6JA 4I7CA 2MIQA 2FUUA 1Z2QA 2KWKA 2YQMA 3U5NA 5FERA 1WIMA 3NG2A 2EA6A 1CHCA 2L75A 3ASLA 1WEUA 4P5OB 2ECWA 2BAYA 2CKLB 3QZVA 2LV9A 5LCWB 2YU4A 3O37A 4UI9B 5G0FA 4L58A 4QF3A 5LKTA 4ZQLA 1N87A 2KR4A 2ZETC 1WFKA 3IHPA 2L0BA 5EYAF 2LQ6A 4AP4A 4NN2A 5B77A 2JMJA 1X4IA 1LDKC 3EB6A 2VPDA 3PHDA 2YQLA 4I7BA 3MHSA 2VPGA 2EODA 2ECTA 5LKXA 2QIZA 4CA1A 2ECVA 1MM3A 4WZ2A 2YT5A 2JMIA 2YHNA 2AN6A 5TBNA 4R7EA 2DX8A 3ZTGA 1FP0A 3DPLR 3KNVA 4MSXA 5TABA 2VP7A 4IC3A 3MHHA 5D1KB 4S3OB 3ZPV1 2VNFA 2ECJA 2LGGA 4PTBA 1IYMA 2D8SA 1MM2A 2M3HA 2YW8A 5B8DA 5DINA 1T1HA 3RPGB 1JOCA 5LKUA 4V3KC 2LXHC 1X4UA 3LQJA 4IC2A 2KIZA 3LQHA 3KV5A 2KFTA 5B79A 2LGLA 3HTKC 2PUYA 2MNYA 4FIPA 5FB0A 2KGGA 2Y1MA 4CCGX 3HCUA 2L5UA
chains in the Genus database with same CATH superfamily
3N9PA 1JM7B 3LRQA 4YBSA 2CRRA 2RSDA 2YURA 2XP0A 3C5KA 5B75A 1V87A 5AITA 3L1ZB 2ECGA 4YC9A 4AYCB 3ZNIA 4A0CD 4GNFA 2KREA 4YAXA 3SOXA 1WE9A 3SHBA 5FEYA 4LKAA 4YBMA 4UP0A 3O7AA 2VJFB 5H1TA 3GL6A 2XOZA 2CSYA 4R2YA 3ZVZB 3U5OA 2KYUA 2F6NA 5B78A 3M63A 2YUCA 4V3LC 4XI1A 3FANA 2UZGA 3EB5A 2L80A 5TRBA 2MUMA 4A49A 2HDPA 4BHWA 4S3OC 4AYCA 2CKLA 5AIUA 3RTRB 1WEPA 2Y43A 4YABA 4B7YC 2VJEB 3VK6A 2LGVA 4F52B 2LRIC 1Z6UA 3V43A 2H0DA 2OXQC 3FL2A 2JUNA 2FFWA 3SOUA 1VYXA 3O47A 3T7LA 1JM7A 2LAUA 3LVRE 2F42A 2K1JA 2DSMA 3PURA 4W4UA 3O70A 2CT2A 3N9NA 3O36A 2K16A 2CSZA 4FO9A 2LXPC 2HYED 3KQIA 3M99A 1WGMA 2FSAA 5B76A 2MT5A 2E6RA 2QJ0A 5H1VA 2MD8C 5KH3A 4WZ0A 2KWJA 1X4JA 2LGKA 1VD4A 2FUIA 2CSVA 4A4CA 2I50A 4L7XA 2YYRA 4YADA 4BBQA 3ZYQA 4ZDTA 3LVQE 3DQVR 2EGMA 2JM3A 4FK5A 2XOYA 2IDAA 2G6QA 2VJFA 2E6SA 3PLWA 3Q1DA 5LKZA 4R8PK 2EGPA 1WEWA 2JRJA 2G43A 1WEMA 4GB0A 1HYIA 1K2FA 4ZUXU 4LK9A 2EXUA 4LJNA 4PPEA 2XB1A 3N9LA 1WEEA 2LN0A 5SVXA 5H9MA 1E4UA 3ZVYA 2XEUA 1VFYA 1XWHA 3KDEC 4GNDA 2FD4A 1WESA 3L11A 1WEVA 1WEOA 5JG6A 4FJCA 4N4FA 4F1PA 4O62A 2ECNA 5SVIA 1LDJB 3H7HA 3N9OA 5TDWA 3LQIA 5G04B 3HCSA 2VPEA 3LJUX 3U5MA 2MD7B 2KE1A 2VJEA 3ZPVE 2M6MA 5SVIB 4N3WA 2MNZA 2C2VS 3E2DA 3KV6A 2PNXA 1RMDA 3I2DA 4AUQB 3N9QA 4LADB 2L43A 2ECIA 3O33A 2RR4A 5D1LB 3RPGC 3FJUB 2YREA 5H1UA 1ZBDB 3C6WA 4AVXA 2M85A 2RI7A 3M62A 4QF2A 2KWNA 3U5PA 2MA5A 5DKAA 2C2LA 5C13A 1DCQA 1BORA 2B0OE 5KH7A 4OGCA 3GV4A 5KH9A 4A4BA 2MA6A 1DVPA 2L7PA 4WZ3B 4B86C 1WENA 5TDRA 2G45A 3PUQA 4C9ZA 2H0DB 2P57A 4OGEA 5K3QA 4YATA 2YSMA 4QQ4A 2KGIA 5FB1A 2JMDA 5D1MB 3N9MA 1MBMA 4I7DA 5I3LA 2K4DA 2NAAA 4GNEA 4H9DA 4X3GA 2M13A 2LDRA 2M1RA 2QICA 3O35A 4O64A 3FM8C 4Q6FA 1U6GB 1FBVA 4MVTA 5J3XA 3SOWA 2VPBA 2Y1NA 2K17A 5C11A 4TKPB 2KWOA 2KU3A 3FAOA 1F62A 5G05B 3T6RA 3DWDA 4GNGA 3JUEA 2DJAA 1G25A 3L1XA 1WEQA 3HCTA 3O34A 4LLBA 4UP5A 4WA6A 1HYJA 2YSJA 1Z60A 2YHOA 1WILA 4YBTA 2F6JA 4I7CA 5SVYA 2MIQA 2FUUA 1Z2QA 2KWKA 2YQMA 3U5NA 5FERA 1WIMA 3NG2A 2EA6A 3FEHA 1CHCA 2L75A 3SUBA 3ASLA 1WEUA 4P5OB 2ECWA 2BAYA 2CKLB 3QZVA 2LV9A 5LCWB 2YU4A 3O37A 4UI9B 5G0FA 4L58A 4QF3A 5LKTA 4ZQLA 2KKXA 1N87A 2KR4A 2ZETC 1WFKA 3IHPA 2E61A 2L0BA 5EYAF 4Z0RA 2LQ6A 4AP4A 4NN2A 5B77A 2JMJA 1X4IA 1LDKC 3EB6A 2VPDA 3PHDA 2YQLA 4I7BA 3MHSA 2VPGA 2EODA 2ECTA 5LKXA 2QIZA 4CA1A 2ECVA 1MM3A 4WZ2A 2YT5A 2JMIA 2YHNA 2AN6A 5TBNA 4R7EA 2DX8A 3ZTGA 1FP0A 3DPLR 3KNVA 4MSXA 5TABA 3T9KA 2VP7A 4IC3A 3MHHA 5D1KB 4S3OB 3ZPV1 2VNFA 2ECJA 2LGGA 2XOCA 4PTBA 1IYMA 2D8SA 1MM2A 2M3HA 2YW8A 2CRWA 5B8DA 5DINA 3MDBC 1T1HA 3RPGB 2KKYA 1JOCA 2OWAA 2IQJA 5LKUA 3DDTA 4V3KC 2LXHC 1X4UA 3LDYA 3LQJA 4IC2A 2MKEA 2KIZA 3LQHA 2CONA 3KV5A 2KFTA 2LGLA 3HTKC 5B79A 2PUYA 2MNYA 4FIPA 5FB0A 2KGGA 4Z0OA 2Y1MA 4CCGX 3HCUA 2L5UA 2YVRA 3M7KA 2D8UA
chains in the Genus database with same CATH topology
3N9PA 1JM7B 3LRQA 4YBSA 2RSDA 2YURA 3C5KA 5B75A 1V87A 5AITA 3L1ZB 2ECGA 4YC9A 4AYCB 3ZNIA 4A0CD 4GNFA 2KREA 4YAXA 3SOXA 1WE9A 3SHBA 5FEYA 4LKAA 4YBMA 4UP0A 3O7AA 2VJFB 5H1TA 3GL6A 2CSYA 4R2YA 3ZVZB 3U5OA 2KYUA 2F6NA 5B78A 3M63A 2YUCA 4V3LC 4XI1A 2UZGA 3EB5A 2L80A 5TRBA 2MUMA 4A49A 2HDPA 4BHWA 4S3OC 4AYCA 2CKLA 5AIUA 3RTRB 1WEPA 2Y43A 4YABA 4B7YC 2VJEB 3VK6A 2LGVA 4F52B 2LRIC 1Z6UA 3V43A 2H0DA 2OXQC 3FL2A 3SOUA 1VYXA 3T7LA 1JM7A 2F42A 2K1JA 3PURA 4W4UA 3O70A 2CT2A 3N9NA 3O36A 2K16A 2CSZA 4FO9A 2LXPC 2HYED 3KQIA 3M99A 1WGMA 2FSAA 5B76A 2MT5A 5H1VA 2E6RA 2QJ0A 2MD8C 5KH3A 4WZ0A 2KWJA 1X4JA 2LGKA 1VD4A 2FUIA 4A4CA 2I50A 4L7XA 2YYRA 4YADA 4BBQA 3ZYQA 4ZDTA 3DQVR 4FK5A 2IDAA 2G6QA 2VJFA 2E6SA 5LKZA 4R8PK 2EGPA 1WEWA 2JRJA 2G43A 1WEMA 4GB0A 1HYIA 1K2FA 4ZUXU 4LK9A 4LJNA 4PPEA 2XB1A 3N9LA 1WEEA 2LN0A 5H9MA 1E4UA 3ZVYA 2XEUA 1VFYA 1XWHA 4GNDA 1WESA 3L11A 1WEVA 1WEOA 5JG6A 4FJCA 4N4FA 2ECNA 1LDJB 3N9OA 5TDWA 3LQIA 5G04B 3HCSA 2VPEA 3U5MA 2MD7B 2KE1A 2VJEA 3ZPVE 2M6MA 4N3WA 2MNZA 2C2VS 3KV6A 2PNXA 1RMDA 3I2DA 4AUQB 3N9QA 4LADB 2L43A 2ECIA 3O33A 5D1LB 3RPGC 2YREA 5H1UA 1ZBDB 3C6WA 4AVXA 2M85A 2RI7A 3M62A 4QF2A 2KWNA 3U5PA 2MA5A 5DKAA 2C2LA 5C13A 1BORA 5KH7A 3GV4A 5KH9A 4A4BA 2MA6A 1DVPA 4WZ3B 4B86C 1WENA 5TDRA 2G45A 3PUQA 4C9ZA 2H0DB 4YATA 2YSMA 2KGIA 5FB1A 2JMDA 5D1MB 3N9MA 4I7DA 5I3LA 2K4DA 2NAAA 4GNEA 4X3GA 2LDRA 2M1RA 2QICA 3O35A 4O64A 4Q6FA 1U6GB 1FBVA 4MVTA 5J3XA 3SOWA 2VPBA 2Y1NA 2K17A 5C11A 4TKPB 2KWOA 2KU3A 1F62A 5G05B 3T6RA 4GNGA 1G25A 3L1XA 1WEQA 3HCTA 3O34A 4LLBA 4UP5A 4WA6A 1HYJA 2YSJA 1Z60A 2YHOA 1WILA 4YBTA 2F6JA 4I7CA 2MIQA 2FUUA 1Z2QA 2KWKA 2YQMA 3U5NA 5FERA 1WIMA 3NG2A 2EA6A 1CHCA 2L75A 3ASLA 1WEUA 4P5OB 2ECWA 2BAYA 2CKLB 3QZVA 2LV9A 5LCWB 2YU4A 3O37A 4UI9B 5G0FA 4L58A 4QF3A 5LKTA 4ZQLA 1N87A 2KR4A 2ZETC 1WFKA 3IHPA 2L0BA 5EYAF 2LQ6A 4AP4A 4NN2A 5B77A 2JMJA 1X4IA 1LDKC 3EB6A 2VPDA 3PHDA 2YQLA 4I7BA 3MHSA 2VPGA 2EODA 2ECTA 5LKXA 2QIZA 4CA1A 2ECVA 1MM3A 4WZ2A 2YT5A 2JMIA 2YHNA 2AN6A 5TBNA 4R7EA 2DX8A 3ZTGA 1FP0A 3DPLR 3KNVA 4MSXA 5TABA 2VP7A 4IC3A 3MHHA 5D1KB 4S3OB 3ZPV1 2VNFA 2ECJA 2LGGA 4PTBA 1IYMA 2D8SA 1MM2A 2M3HA 2YW8A 5B8DA 5DINA 1T1HA 3RPGB 1JOCA 5LKUA 4V3KC 2LXHC 1X4UA 3LQJA 4IC2A 2KIZA 3LQHA 3KV5A 2KFTA 5B79A 2LGLA 3HTKC 2PUYA 2MNYA 4FIPA 5FB0A 2KGGA 2Y1MA 4CCGX 3HCUA 2L5UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N9P A;  1JM7 B;  3LRQ A;  4YBS A;  2RSD A;  2YUR A;  3C5K A;  5B75 A;  1V87 A;  5AIT A;  3L1Z B;  2ECG A;  4YC9 A;  4AYC B;  3ZNI A;  4A0C D;  4GNF A;  2KRE A;  4YAX A;  3SOX A;  1WE9 A;  3SHB A;  5FEY A;  4LKA A;  4YBM A;  4UP0 A;  3O7A A;  2VJF B;  5H1T A;  3GL6 A;  2CSY A;  4R2Y A;  3ZVZ B;  3U5O A;  2KYU A;  2F6N A;  5B78 A;  3M63 A;  2YUC A;  4V3L C;  4XI1 A;  2UZG A;  3EB5 A;  2L80 A;  5TRB A;  2MUM A;  4A49 A;  2HDP A;  4BHW A;  4S3O C;  4AYC A;  2CKL A;  5AIU A;  3RTR B;  1WEP A;  2Y43 A;  4YAB A;  4B7Y C;  2VJE B;  3VK6 A;  2LGV A;  4F52 B;  2LRI C;  1Z6U A;  3V43 A;  2H0D A;  2OXQ C;  3FL2 A;  3SOU A;  1VYX A;  3T7L A;  1JM7 A;  2F42 A;  2K1J A;  3PUR A;  4W4U A;  3O70 A;  2CT2 A;  3N9N A;  3O36 A;  2K16 A;  2CSZ A;  4FO9 A;  2LXP C;  2HYE D;  3KQI A;  3M99 A;  1WGM A;  2FSA A;  5B76 A;  2MT5 A;  5H1V A;  2E6R A;  2QJ0 A;  2MD8 C;  5KH3 A;  4WZ0 A;  2KWJ A;  1X4J A;  2LGK A;  1VD4 A;  2FUI A;  4A4C A;  2I50 A;  4L7X A;  2YYR A;  4YAD A;  4BBQ A;  3ZYQ A;  4ZDT A;  3DQV R;  4FK5 A;  2IDA A;  2G6Q A;  2VJF A;  2E6S A;  5LKZ A;  4R8P K;  2EGP A;  1WEW A;  2JRJ A;  2G43 A;  1WEM A;  4GB0 A;  1HYI A;  1K2F A;  4ZUX U;  4LK9 A;  4LJN A;  4PPE A;  2XB1 A;  3N9L A;  1WEE A;  2LN0 A;  5H9M A;  1E4U A;  3ZVY A;  2XEU A;  1VFY A;  1XWH A;  4GND A;  1WES A;  3L11 A;  1WEV A;  1WEO A;  5JG6 A;  4FJC A;  4N4F A;  2ECN A;  1LDJ B;  3N9O A;  5TDW A;  3LQI A;  5G04 B;  3HCS A;  2VPE A;  3U5M A;  2MD7 B;  2KE1 A;  2VJE A;  3ZPV E;  2M6M A;  4N3W A;  2MNZ A;  2C2V S;  3KV6 A;  2PNX A;  1RMD A;  3I2D A;  4AUQ B;  3N9Q A;  4LAD B;  2L43 A;  2ECI A;  3O33 A;  5D1L B;  3RPG C;  2YRE A;  5H1U A;  1ZBD B;  3C6W A;  4AVX A;  2M85 A;  2RI7 A;  3M62 A;  4QF2 A;  2KWN A;  3U5P A;  2MA5 A;  5DKA A;  2C2L A;  5C13 A;  1BOR A;  5KH7 A;  3GV4 A;  5KH9 A;  4A4B A;  2MA6 A;  1DVP A;  4WZ3 B;  4B86 C;  1WEN A;  5TDR A;  2G45 A;  3PUQ A;  4C9Z A;  2H0D B;  4YAT A;  2YSM A;  2KGI A;  5FB1 A;  2JMD A;  5D1M B;  3N9M A;  4I7D A;  5I3L A;  2K4D A;  2NAA A;  4GNE A;  4X3G A;  2LDR A;  2M1R A;  2QIC A;  3O35 A;  4O64 A;  4Q6F A;  1U6G B;  1FBV A;  4MVT A;  5J3X A;  3SOW A;  2VPB A;  2Y1N A;  2K17 A;  5C11 A;  4TKP B;  2KWO A;  2KU3 A;  1F62 A;  5G05 B;  3T6R A;  4GNG A;  1G25 A;  3L1X A;  1WEQ A;  3HCT A;  3O34 A;  4LLB A;  4UP5 A;  4WA6 A;  1HYJ A;  2YSJ A;  1Z60 A;  2YHO A;  1WIL A;  4YBT A;  2F6J A;  4I7C A;  2MIQ A;  2FUU A;  1Z2Q A;  2KWK A;  2YQM A;  3U5N A;  5FER A;  1WIM A;  3NG2 A;  2EA6 A;  1CHC A;  2L75 A;  3ASL A;  1WEU A;  4P5O B;  2ECW A;  2BAY A;  2CKL B;  3QZV A;  2LV9 A;  5LCW B;  2YU4 A;  3O37 A;  4UI9 B;  5G0F A;  4L58 A;  4QF3 A;  5LKT A;  4ZQL A;  1N87 A;  2KR4 A;  2ZET C;  1WFK A;  3IHP A;  2L0B A;  5EYA F;  2LQ6 A;  4AP4 A;  4NN2 A;  5B77 A;  2JMJ A;  1X4I A;  1LDK C;  3EB6 A;  2VPD A;  3PHD A;  2YQL A;  4I7B A;  3MHS A;  2VPG A;  2EOD A;  2ECT A;  5LKX A;  2QIZ A;  4CA1 A;  2ECV A;  1MM3 A;  4WZ2 A;  2YT5 A;  2JMI A;  2YHN A;  2AN6 A;  5TBN A;  4R7E A;  2DX8 A;  3ZTG A;  1FP0 A;  3DPL R;  3KNV A;  4MSX A;  5TAB A;  2VP7 A;  4IC3 A;  3MHH A;  5D1K B;  4S3O B;  3ZPV 1;  2VNF A;  2ECJ A;  2LGG A;  4PTB A;  1IYM A;  2D8S A;  1MM2 A;  2M3H A;  2YW8 A;  5B8D A;  5DIN A;  1T1H A;  3RPG B;  1JOC A;  5LKU A;  4V3K C;  2LXH C;  1X4U A;  3LQJ A;  4IC2 A;  2KIZ A;  3LQH A;  3KV5 A;  2KFT A;  5B79 A;  2LGL A;  3HTK C;  2PUY A;  2MNY A;  4FIP A;  5FB0 A;  2KGG A;  2Y1M A;  4CCG X;  3HCU A;  2L5U A; 
#chains in the Genus database with same CATH topology
 3N9P A;  1JM7 B;  3LRQ A;  4YBS A;  2CRR A;  2RSD A;  2YUR A;  2XP0 A;  3C5K A;  5B75 A;  1V87 A;  5AIT A;  3L1Z B;  2ECG A;  4YC9 A;  4AYC B;  3ZNI A;  4A0C D;  4GNF A;  2KRE A;  4YAX A;  3SOX A;  1WE9 A;  3SHB A;  5FEY A;  4LKA A;  4YBM A;  4UP0 A;  3O7A A;  2VJF B;  5H1T A;  3GL6 A;  2XOZ A;  2CSY A;  4R2Y A;  3ZVZ B;  3U5O A;  2KYU A;  2F6N A;  5B78 A;  3M63 A;  2YUC A;  4V3L C;  4XI1 A;  3FAN A;  2UZG A;  3EB5 A;  2L80 A;  5TRB A;  2MUM A;  4A49 A;  2HDP A;  4BHW A;  4S3O C;  4AYC A;  2CKL A;  5AIU A;  3RTR B;  1WEP A;  2Y43 A;  4YAB A;  4B7Y C;  2VJE B;  3VK6 A;  2LGV A;  4F52 B;  2LRI C;  1Z6U A;  3V43 A;  2H0D A;  2OXQ C;  3FL2 A;  2JUN A;  2FFW A;  3SOU A;  1VYX A;  3O47 A;  3T7L A;  1JM7 A;  2LAU A;  3LVR E;  2F42 A;  2K1J A;  2DSM A;  3PUR A;  4W4U A;  3O70 A;  2CT2 A;  3N9N A;  3O36 A;  2K16 A;  2CSZ A;  4FO9 A;  2LXP C;  2HYE D;  3KQI A;  3M99 A;  1WGM A;  2FSA A;  5B76 A;  2MT5 A;  2E6R A;  2QJ0 A;  5H1V A;  2MD8 C;  5KH3 A;  4WZ0 A;  2KWJ A;  1X4J A;  2LGK A;  1VD4 A;  2FUI A;  2CSV A;  4A4C A;  2I50 A;  4L7X A;  2YYR A;  4YAD A;  4BBQ A;  3ZYQ A;  4ZDT A;  3LVQ E;  3DQV R;  2EGM A;  2JM3 A;  4FK5 A;  2XOY A;  2IDA A;  2G6Q A;  2VJF A;  2E6S A;  3PLW A;  3Q1D A;  5LKZ A;  4R8P K;  2EGP A;  1WEW A;  2JRJ A;  2G43 A;  1WEM A;  4GB0 A;  1HYI A;  1K2F A;  4ZUX U;  4LK9 A;  2EXU A;  4LJN A;  4PPE A;  2XB1 A;  3N9L A;  1WEE A;  2LN0 A;  5SVX A;  5H9M A;  1E4U A;  3ZVY A;  2XEU A;  1VFY A;  1XWH A;  3KDE C;  4GND A;  2FD4 A;  1WES A;  3L11 A;  1WEV A;  1WEO A;  5JG6 A;  4FJC A;  4N4F A;  4F1P A;  4O62 A;  2ECN A;  5SVI A;  1LDJ B;  3H7H A;  3N9O A;  5TDW A;  3LQI A;  5G04 B;  3HCS A;  2VPE A;  3LJU X;  3U5M A;  2MD7 B;  2KE1 A;  2VJE A;  3ZPV E;  2M6M A;  5SVI B;  4N3W A;  2MNZ A;  2C2V S;  3E2D A;  3KV6 A;  2PNX A;  1RMD A;  3I2D A;  4AUQ B;  3N9Q A;  4LAD B;  2L43 A;  2ECI A;  3O33 A;  2RR4 A;  5D1L B;  3RPG C;  3FJU B;  2YRE A;  5H1U A;  1ZBD B;  3C6W A;  4AVX A;  2M85 A;  2RI7 A;  3M62 A;  4QF2 A;  2KWN A;  3U5P A;  2MA5 A;  5DKA A;  2C2L A;  5C13 A;  1DCQ A;  1BOR A;  2B0O E;  5KH7 A;  4OGC A;  3GV4 A;  5KH9 A;  4A4B A;  2MA6 A;  1DVP A;  2L7P A;  4WZ3 B;  4B86 C;  1WEN A;  5TDR A;  2G45 A;  3PUQ A;  4C9Z A;  2H0D B;  2P57 A;  4OGE A;  5K3Q A;  4YAT A;  2YSM A;  4QQ4 A;  2KGI A;  5FB1 A;  2JMD A;  5D1M B;  3N9M A;  1MBM A;  4I7D A;  5I3L A;  2K4D A;  2NAA A;  4GNE A;  4H9D A;  4X3G A;  2M13 A;  2LDR A;  2M1R A;  2QIC A;  3O35 A;  4O64 A;  3FM8 C;  4Q6F A;  1U6G B;  1FBV A;  4MVT A;  5J3X A;  3SOW A;  2VPB A;  2Y1N A;  2K17 A;  5C11 A;  4TKP B;  2KWO A;  2KU3 A;  3FAO A;  1F62 A;  5G05 B;  3T6R A;  3DWD A;  4GNG A;  3JUE A;  2DJA A;  1G25 A;  3L1X A;  1WEQ A;  3HCT A;  3O34 A;  4LLB A;  4UP5 A;  4WA6 A;  1HYJ A;  2YSJ A;  1Z60 A;  2YHO A;  1WIL A;  4YBT A;  2F6J A;  4I7C A;  5SVY A;  2MIQ A;  2FUU A;  1Z2Q A;  2KWK A;  2YQM A;  3U5N A;  5FER A;  1WIM A;  3NG2 A;  2EA6 A;  3FEH A;  1CHC A;  2L75 A;  3SUB A;  3ASL A;  1WEU A;  4P5O B;  2ECW A;  2BAY A;  2CKL B;  3QZV A;  2LV9 A;  5LCW B;  2YU4 A;  3O37 A;  4UI9 B;  5G0F A;  4L58 A;  4QF3 A;  5LKT A;  4ZQL A;  2KKX A;  1N87 A;  2KR4 A;  2ZET C;  1WFK A;  3IHP A;  2E61 A;  2L0B A;  5EYA F;  4Z0R A;  2LQ6 A;  4AP4 A;  4NN2 A;  5B77 A;  2JMJ A;  1X4I A;  1LDK C;  3EB6 A;  2VPD A;  3PHD A;  2YQL A;  4I7B A;  3MHS A;  2VPG A;  2EOD A;  2ECT A;  5LKX A;  2QIZ A;  4CA1 A;  2ECV A;  1MM3 A;  4WZ2 A;  2YT5 A;  2JMI A;  2YHN A;  2AN6 A;  5TBN A;  4R7E A;  2DX8 A;  3ZTG A;  1FP0 A;  3DPL R;  3KNV A;  4MSX A;  5TAB A;  3T9K A;  2VP7 A;  4IC3 A;  3MHH A;  5D1K B;  4S3O B;  3ZPV 1;  2VNF A;  2ECJ A;  2LGG A;  2XOC A;  4PTB A;  1IYM A;  2D8S A;  1MM2 A;  2M3H A;  2YW8 A;  2CRW A;  5B8D A;  5DIN A;  3MDB C;  1T1H A;  3RPG B;  2KKY A;  1JOC A;  2OWA A;  2IQJ A;  5LKU A;  3DDT A;  4V3K C;  2LXH C;  1X4U A;  3LDY A;  3LQJ A;  4IC2 A;  2MKE A;  2KIZ A;  3LQH A;  2CON A;  3KV5 A;  2KFT A;  2LGL A;  3HTK C;  5B79 A;  2PUY A;  2MNY A;  4FIP A;  5FB0 A;  2KGG A;  4Z0O A;  2Y1M A;  4CCG X;  3HCU A;  2L5U A;  2YVR A;  3M7K A;  2D8U A; 
#chains in the Genus database with same CATH homology
 3N9P A;  1JM7 B;  3LRQ A;  4YBS A;  2RSD A;  2YUR A;  3C5K A;  5B75 A;  1V87 A;  5AIT A;  3L1Z B;  2ECG A;  4YC9 A;  4AYC B;  3ZNI A;  4A0C D;  4GNF A;  2KRE A;  4YAX A;  3SOX A;  1WE9 A;  3SHB A;  5FEY A;  4LKA A;  4YBM A;  4UP0 A;  3O7A A;  2VJF B;  5H1T A;  3GL6 A;  2CSY A;  4R2Y A;  3ZVZ B;  3U5O A;  2KYU A;  2F6N A;  5B78 A;  3M63 A;  2YUC A;  4V3L C;  4XI1 A;  2UZG A;  3EB5 A;  2L80 A;  5TRB A;  2MUM A;  4A49 A;  2HDP A;  4BHW A;  4S3O C;  4AYC A;  2CKL A;  5AIU A;  3RTR B;  1WEP A;  2Y43 A;  4YAB A;  4B7Y C;  2VJE B;  3VK6 A;  2LGV A;  4F52 B;  2LRI C;  1Z6U A;  3V43 A;  2H0D A;  2OXQ C;  3FL2 A;  3SOU A;  1VYX A;  3T7L A;  1JM7 A;  2F42 A;  2K1J A;  3PUR A;  4W4U A;  3O70 A;  2CT2 A;  3N9N A;  3O36 A;  2K16 A;  2CSZ A;  4FO9 A;  2LXP C;  2HYE D;  3KQI A;  3M99 A;  1WGM A;  2FSA A;  5B76 A;  2MT5 A;  5H1V A;  2E6R A;  2QJ0 A;  2MD8 C;  5KH3 A;  4WZ0 A;  2KWJ A;  1X4J A;  2LGK A;  1VD4 A;  2FUI A;  4A4C A;  2I50 A;  4L7X A;  2YYR A;  4YAD A;  4BBQ A;  3ZYQ A;  4ZDT A;  3DQV R;  4FK5 A;  2IDA A;  2G6Q A;  2VJF A;  2E6S A;  5LKZ A;  4R8P K;  2EGP A;  1WEW A;  2JRJ A;  2G43 A;  1WEM A;  4GB0 A;  1HYI A;  1K2F A;  4ZUX U;  4LK9 A;  4LJN A;  4PPE A;  2XB1 A;  3N9L A;  1WEE A;  2LN0 A;  5H9M A;  1E4U A;  3ZVY A;  2XEU A;  1VFY A;  1XWH A;  4GND A;  1WES A;  3L11 A;  1WEV A;  1WEO A;  5JG6 A;  4FJC A;  4N4F A;  2ECN A;  1LDJ B;  3N9O A;  5TDW A;  3LQI A;  5G04 B;  3HCS A;  2VPE A;  3U5M A;  2MD7 B;  2KE1 A;  2VJE A;  3ZPV E;  2M6M A;  4N3W A;  2MNZ A;  2C2V S;  3KV6 A;  2PNX A;  1RMD A;  3I2D A;  4AUQ B;  3N9Q A;  4LAD B;  2L43 A;  2ECI A;  3O33 A;  5D1L B;  3RPG C;  2YRE A;  5H1U A;  1ZBD B;  3C6W A;  4AVX A;  2M85 A;  2RI7 A;  3M62 A;  4QF2 A;  2KWN A;  3U5P A;  2MA5 A;  5DKA A;  2C2L A;  5C13 A;  1BOR A;  5KH7 A;  3GV4 A;  5KH9 A;  4A4B A;  2MA6 A;  1DVP A;  4WZ3 B;  4B86 C;  1WEN A;  5TDR A;  2G45 A;  3PUQ A;  4C9Z A;  2H0D B;  4YAT A;  2YSM A;  2KGI A;  5FB1 A;  2JMD A;  5D1M B;  3N9M A;  4I7D A;  5I3L A;  2K4D A;  2NAA A;  4GNE A;  4X3G A;  2LDR A;  2M1R A;  2QIC A;  3O35 A;  4O64 A;  4Q6F A;  1U6G B;  1FBV A;  4MVT A;  5J3X A;  3SOW A;  2VPB A;  2Y1N A;  2K17 A;  5C11 A;  4TKP B;  2KWO A;  2KU3 A;  1F62 A;  5G05 B;  3T6R A;  4GNG A;  1G25 A;  3L1X A;  1WEQ A;  3HCT A;  3O34 A;  4LLB A;  4UP5 A;  4WA6 A;  1HYJ A;  2YSJ A;  1Z60 A;  2YHO A;  1WIL A;  4YBT A;  2F6J A;  4I7C A;  2MIQ A;  2FUU A;  1Z2Q A;  2KWK A;  2YQM A;  3U5N A;  5FER A;  1WIM A;  3NG2 A;  2EA6 A;  1CHC A;  2L75 A;  3ASL A;  1WEU A;  4P5O B;  2ECW A;  2BAY A;  2CKL B;  3QZV A;  2LV9 A;  5LCW B;  2YU4 A;  3O37 A;  4UI9 B;  5G0F A;  4L58 A;  4QF3 A;  5LKT A;  4ZQL A;  1N87 A;  2KR4 A;  2ZET C;  1WFK A;  3IHP A;  2L0B A;  5EYA F;  2LQ6 A;  4AP4 A;  4NN2 A;  5B77 A;  2JMJ A;  1X4I A;  1LDK C;  3EB6 A;  2VPD A;  3PHD A;  2YQL A;  4I7B A;  3MHS A;  2VPG A;  2EOD A;  2ECT A;  5LKX A;  2QIZ A;  4CA1 A;  2ECV A;  1MM3 A;  4WZ2 A;  2YT5 A;  2JMI A;  2YHN A;  2AN6 A;  5TBN A;  4R7E A;  2DX8 A;  3ZTG A;  1FP0 A;  3DPL R;  3KNV A;  4MSX A;  5TAB A;  2VP7 A;  4IC3 A;  3MHH A;  5D1K B;  4S3O B;  3ZPV 1;  2VNF A;  2ECJ A;  2LGG A;  4PTB A;  1IYM A;  2D8S A;  1MM2 A;  2M3H A;  2YW8 A;  5B8D A;  5DIN A;  1T1H A;  3RPG B;  1JOC A;  5LKU A;  4V3K C;  2LXH C;  1X4U A;  3LQJ A;  4IC2 A;  2KIZ A;  3LQH A;  3KV5 A;  2KFT A;  5B79 A;  2LGL A;  3HTK C;  2PUY A;  2MNY A;  4FIP A;  5FB0 A;  2KGG A;  2Y1M A;  4CCG X;  3HCU A;  2L5U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...