2CKLA

Ring1b-bmi1 e3 catalytic domain structure
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
98
structure length
98
Chain Sequence
RIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and E3-Ligase Activity of the Ring-Ring Complex of Polycomb Proteins Bmi1 and Ring1B.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
molecule keywords POLYCOMB GROUP RING FINGER PROTEIN 4
total genus 30
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2006-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2cklA00
2QICA 2G6QA 4WA6A 5DKAA 1WFKA 2F6JA 5JG6A 3C6WA 3RPGB 3ZYQA 1ZBDB 4FJCA 1X4JA 2VPGA 1WGMA 3O33A 3C5KA 3IHPA 4YBSA 4YAXA 5TBNA 5DINA 1DVPA 1X4UA 4NN2A 2VJFA 2KWJA 1WEMA 3HTKC 5LKXA 4ZQLA 3N9MA 3U5OA 2RSDA 3LRQA 5B8DA 1WEEA 1V87A 1WEVA 2CT2A 2ECNA 2LRIC 2YURA 4L7XA 4XI1A 2H0DB 2FUUA 2JMDA 1N87A 2MUMA 3N9PA 5FEYA 5B78A 1FP0A 4LJNA 4PTBA 1JM7B 4ZDTA 2CSZA 3T6RA 2YHNA 1FBVA 2MIQA 1WEUA 3M99A 2LGVA 3VK6A 5FB0A 2Y1NA 2FUIA 4AYCA 1BORA 1MM3A 5FB1A 4B86C 2KIZA 2BAYA 1JM7A 2K1JA 4YBMA 1IYMA 2C2LA 1WENA 5B77A 3I2DA 2KYUA 3DPLR 2KGGA 3N9NA 4QF2A 5B76A 1JOCA 4GNDA 3ZVZB 3KQIA 2L0BA 3RPGC 4YC9A 3PHDA 5H1VA 4UP0A 2LXHC 5H1TA 2YU4A 2C2VS 2MT5A 2L75A 1HYIA 5D1LB 4BHWA 3O7AA 4C9ZA 3U5PA 2JMIA 5KH7A 1F62A 4I7DA 5D1MB 4A0CD 2PNXA 4WZ3B 3LQHA 4ZUXU 4YATA 2I50A 2VJEB 5B79A 4FO9A 2EODA 1XWHA 2H0DA 2D8SA 5G05B 2Y1MA 2AN6A 2JMJA 4GNFA 3QZVA 4YABA 3ZPVE 3EB5A 5TDRA 4YADA 1WIMA 2CKLB 2E6SA 3ZNIA 1U6GB 2VPDA 4MVTA 5FERA 4LK9A 3HCSA 4MSXA 2LDRA 2VPBA 5J3XA 2YREA 3ZVYA 3V43A 3U5MA 1LDJB 4R7EA 3U5NA 1E4UA 4GB0A 1T1HA 5LCWB 4AYCB 3SHBA 2FSAA 2ECGA 2F6NA 2PUYA 3SOWA 4LLBA 3HCUA 1WEQA 5KH9A 3NG2A 3KNVA 4I7CA 2LXPC 4N3WA 2MNZA 3GL6A 3N9QA 3L1ZB 3N9OA 4GNEA 4A4CA 4F52B 5C11A 5TRBA 2QJ0A 5TABA 5G04B 2ECJA 3M63A 4UP5A 2YQLA 4YBTA 1Z2QA 5LKUA 2K17A 2ECTA 2HYED 5AITA 3SOXA 2RI7A 2VJEA 4AP4A 2L43A 4UI9B 3O34A 2LV9A 2ECWA 2KFTA 3T7LA 2MA5A 3HCTA 3O36A 4P5OB 4WZ0A 4A4BA 4CA1A 1WILA 1WEWA 2LGGA 2YUCA 1HYJA 3MHSA 2KWOA 2LQ6A 2K16A 2M6MA 4AUQB 2EA6A 2CKLA 2ZETC 3ZTGA 5LKTA 2VPEA 2NAAA 2KU3A 4WZ2A 2LN0A 4A49A 1G25A 2OXQC 5TDWA 4O64A 5B75A 2YSJA 3O35A 4LADB 3KV6A 3ASLA 3N9LA 3LQIA 2MD7B 5C13A 2VJFB 3LQJA 2UZGA 2LGKA 4L58A 2XEUA 2YT5A 4V3LC 4S3OB 4TKPB 1WEOA 3L11A 3O70A 4W4UA 2G45A 2VNFA 3SOUA 4BBQA 2Y43A 4Q6FA 4N4FA 4QF3A 3ZPV1 3O37A 5G0FA 2KWNA 3MHHA 2IDAA 5H9MA 1WEPA 2KREA 4GNGA 5I3LA 2JRJA 1Z6UA 4X3GA 4V3KC 2K4DA 2MNYA 1VFYA 4R2YA 4S3OC 4AVXA 1Z60A 1VD4A 2KR4A 4LKAA 1CHCA 5KH3A 2CSYA 5AIUA 2F42A 2DX8A 2HDPA 2YSMA 2XB1A 2KE1A 2KWKA 5LKZA 3L1XA 2L5UA 1MM2A 4IC3A 2MD8C 4I7BA 4FK5A 3M62A 1K2FA 2MA6A 1RMDA 4PPEA 2M1RA 3GV4A 1WESA 2YQMA 2M85A 5D1KB 1VYXA 2L80A 2YW8A 5H1UA 2LGLA 2YHOA 3RTRB 2KGIA 2E6RA 1WE9A 5EYAF 3FL2A 2M3HA 4FIPA 4B7YC 2QIZA 3KV5A 2ECVA 4CCGX 3PURA 3DQVR 3PUQA 2EGPA 2ECIA 2YYRA 3EB6A 4IC2A 1LDKC 1X4IA 2VP7A 4R8PK 2G43A
chains in the Genus database with same CATH superfamily
2QICA 2G6QA 4WA6A 5DKAA 2KKYA 1WFKA 5SVYA 2F6JA 5JG6A 3C6WA 2CSVA 3RPGB 3ZYQA 1ZBDB 2EXUA 4FJCA 1X4JA 2VPGA 1WGMA 3O33A 3C5KA 3IHPA 3FJUB 4YBSA 4YAXA 5TBNA 5DINA 3T9KA 1DVPA 1X4UA 4NN2A 2VJFA 2KWJA 5SVIA 1WEMA 3HTKC 5LKXA 4O62A 2OWAA 4ZQLA 3N9MA 3U5OA 2RSDA 3LRQA 5B8DA 1WEEA 3KDEC 1V87A 1WEVA 2CT2A 2ECNA 2LRIC 2YURA 3DWDA 4L7XA 4XI1A 2H0DB 2FUUA 2JMDA 1N87A 2MUMA 3N9PA 5FEYA 5B78A 1FP0A 4LJNA 4PTBA 1JM7B 4ZDTA 2CSZA 3T6RA 2YHNA 1FBVA 2MIQA 1WEUA 3M99A 2LGVA 3VK6A 5FB0A 2Y1NA 2FUIA 4AYCA 1BORA 1MM3A 5FB1A 4Z0RA 3PLWA 2KIZA 4B86C 2BAYA 1JM7A 2K1JA 4YBMA 1IYMA 2C2LA 2IQJA 1WENA 5B77A 3I2DA 2KYUA 3DPLR 5SVXA 2KGGA 3N9NA 4QF2A 5B76A 1JOCA 4GNDA 3ZVZB 3KQIA 2L0BA 3RPGC 4YC9A 3PHDA 5H1VA 4UP0A 2LXHC 5H1TA 2YU4A 2C2VS 2MT5A 2L75A 1HYIA 5D1LB 4OGEA 4BHWA 3O7AA 4C9ZA 3U5PA 2JMIA 5KH7A 1F62A 4I7DA 5D1MB 4A0CD 2PNXA 4WZ3B 3FANA 3LQHA 4ZUXU 3FM8C 4YATA 2I50A 2VJEB 5B79A 4FO9A 2EODA 1XWHA 2H0DA 2D8SA 5G05B 3FAOA 2RR4A 2Y1MA 2XOCA 2AN6A 2JMJA 2JUNA 4GNFA 2EGMA 3QZVA 4YABA 3ZPVE 3EB5A 5TDRA 4YADA 1WIMA 5K3QA 4H9DA 2CKLB 2E6SA 3ZNIA 1U6GB 2VPDA 4MVTA 5FERA 2XOZA 2XP0A 4LK9A 3HCSA 4MSXA 2LDRA 2KKXA 2VPBA 5J3XA 2YREA 2DJAA 2JM3A 3ZVYA 3V43A 3U5MA 1LDJB 4R7EA 3JUEA 3U5NA 2B0OE 1E4UA 4GB0A 4QQ4A 1T1HA 2P57A 5LCWB 4AYCB 3SHBA 2FSAA 2ECGA 2F6NA 2PUYA 3SOWA 4LLBA 3HCUA 1WEQA 5KH9A 3NG2A 3KNVA 4I7CA 2LXPC 4N3WA 2MNZA 3GL6A 3N9QA 3L1ZB 3N9OA 4GNEA 4A4CA 4F52B 5C11A 5TRBA 2QJ0A 5TABA 5G04B 2ECJA 3M63A 4UP5A 2YQLA 4YBTA 1Z2QA 5LKUA 2K17A 2ECTA 2HYED 3DDTA 5AITA 3SOXA 2RI7A 2VJEA 4AP4A 2L43A 4UI9B 3O34A 2LV9A 2ECWA 2KFTA 2CRWA 3T7LA 2MA5A 3HCTA 3O36A 4P5OB 4WZ0A 4A4BA 4CA1A 1WILA 1WEWA 3LVRE 3MDBC 2LGGA 2YUCA 1HYJA 3MHSA 2KWOA 2E61A 2LQ6A 3O47A 2K16A 2CONA 2M6MA 4AUQB 2EA6A 2CKLA 2ZETC 3ZTGA 2XOYA 5LKTA 2CRRA 2VPEA 2NAAA 2KU3A 3LJUX 4WZ2A 2FD4A 2L7PA 2LN0A 4A49A 2LAUA 3LDYA 1G25A 2OXQC 5TDWA 4O64A 5B75A 2YSJA 3O35A 4LADB 3KV6A 3ASLA 3N9LA 3LQIA 2MD7B 2D8UA 5C13A 2VJFB 2YVRA 2UZGA 3LQJA 3LVQE 2LGKA 4L58A 2XEUA 2YT5A 4V3LC 4S3OB 4TKPB 1WEOA 3L11A 3O70A 4W4UA 2G45A 2VNFA 4F1PA 3SOUA 4BBQA 2Y43A 4Q6FA 4N4FA 4QF3A 3ZPV1 3O37A 5G0FA 2KWNA 3SUBA 3MHHA 2IDAA 5H9MA 1WEPA 2KREA 4GNGA 5I3LA 2JRJA 1Z6UA 4X3GA 4V3KC 2K4DA 5SVIB 1DCQA 2MNYA 1VFYA 4R2YA 4S3OC 4AVXA 1Z60A 1VD4A 3FEHA 2KR4A 4LKAA 2DSMA 1CHCA 5KH3A 2MKEA 2CSYA 3Q1DA 5AIUA 2F42A 2DX8A 2HDPA 2YSMA 2XB1A 2FFWA 2KE1A 2KWKA 5LKZA 4Z0OA 3L1XA 2L5UA 1MM2A 4IC3A 2MD8C 4I7BA 4FK5A 3M62A 1K2FA 2MA6A 1RMDA 4PPEA 1MBMA 2M1RA 3GV4A 3M7KA 1WESA 2YQMA 2M85A 5D1KB 1VYXA 2L80A 3E2DA 2YW8A 5H1UA 2LGLA 2YHOA 3RTRB 2KGIA 2E6RA 1WE9A 5EYAF 3FL2A 2M3HA 4FIPA 4B7YC 2QIZA 3KV5A 2ECVA 3H7HA 4CCGX 2M13A 4OGCA 3PURA 3DQVR 3PUQA 2EGPA 2ECIA 2YYRA 3EB6A 4IC2A 1LDKC 1X4IA 2VP7A 4R8PK 2G43A
chains in the Genus database with same CATH topology
2QICA 2G6QA 4WA6A 5DKAA 1WFKA 2F6JA 5JG6A 3C6WA 3RPGB 3ZYQA 1ZBDB 4FJCA 1X4JA 2VPGA 1WGMA 3O33A 3C5KA 3IHPA 4YBSA 4YAXA 5TBNA 5DINA 1DVPA 1X4UA 4NN2A 2VJFA 2KWJA 1WEMA 3HTKC 5LKXA 4ZQLA 3N9MA 3U5OA 2RSDA 3LRQA 5B8DA 1WEEA 1V87A 1WEVA 2CT2A 2ECNA 2LRIC 2YURA 4L7XA 4XI1A 2H0DB 2FUUA 2JMDA 1N87A 2MUMA 3N9PA 5FEYA 5B78A 1FP0A 4LJNA 4PTBA 1JM7B 4ZDTA 2CSZA 3T6RA 2YHNA 1FBVA 2MIQA 1WEUA 3M99A 2LGVA 3VK6A 5FB0A 2Y1NA 2FUIA 4AYCA 1BORA 1MM3A 5FB1A 4B86C 2KIZA 2BAYA 1JM7A 2K1JA 4YBMA 1IYMA 2C2LA 1WENA 5B77A 3I2DA 2KYUA 3DPLR 2KGGA 3N9NA 4QF2A 5B76A 1JOCA 4GNDA 3ZVZB 3KQIA 2L0BA 3RPGC 4YC9A 3PHDA 5H1VA 4UP0A 2LXHC 5H1TA 2YU4A 2C2VS 2MT5A 2L75A 1HYIA 5D1LB 4BHWA 3O7AA 4C9ZA 3U5PA 2JMIA 5KH7A 1F62A 4I7DA 5D1MB 4A0CD 2PNXA 4WZ3B 3LQHA 4ZUXU 4YATA 2I50A 2VJEB 5B79A 4FO9A 2EODA 1XWHA 2H0DA 2D8SA 5G05B 2Y1MA 2AN6A 2JMJA 4GNFA 3QZVA 4YABA 3ZPVE 3EB5A 5TDRA 4YADA 1WIMA 2CKLB 2E6SA 3ZNIA 1U6GB 2VPDA 4MVTA 5FERA 4LK9A 3HCSA 4MSXA 2LDRA 2VPBA 5J3XA 2YREA 3ZVYA 3V43A 3U5MA 1LDJB 4R7EA 3U5NA 1E4UA 4GB0A 1T1HA 5LCWB 4AYCB 3SHBA 2FSAA 2ECGA 2F6NA 2PUYA 3SOWA 4LLBA 3HCUA 1WEQA 5KH9A 3NG2A 3KNVA 4I7CA 2LXPC 4N3WA 2MNZA 3GL6A 3N9QA 3L1ZB 3N9OA 4GNEA 4A4CA 4F52B 5C11A 5TRBA 2QJ0A 5TABA 5G04B 2ECJA 3M63A 4UP5A 2YQLA 4YBTA 1Z2QA 5LKUA 2K17A 2ECTA 2HYED 5AITA 3SOXA 2RI7A 2VJEA 4AP4A 2L43A 4UI9B 3O34A 2LV9A 2ECWA 2KFTA 3T7LA 2MA5A 3HCTA 3O36A 4P5OB 4WZ0A 4A4BA 4CA1A 1WILA 1WEWA 2LGGA 2YUCA 1HYJA 3MHSA 2KWOA 2LQ6A 2K16A 2M6MA 4AUQB 2EA6A 2CKLA 2ZETC 3ZTGA 5LKTA 2VPEA 2NAAA 2KU3A 4WZ2A 2LN0A 4A49A 1G25A 2OXQC 5TDWA 4O64A 5B75A 2YSJA 3O35A 4LADB 3KV6A 3ASLA 3N9LA 3LQIA 2MD7B 5C13A 2VJFB 3LQJA 2UZGA 2LGKA 4L58A 2XEUA 2YT5A 4V3LC 4S3OB 4TKPB 1WEOA 3L11A 3O70A 4W4UA 2G45A 2VNFA 3SOUA 4BBQA 2Y43A 4Q6FA 4N4FA 4QF3A 3ZPV1 3O37A 5G0FA 2KWNA 3MHHA 2IDAA 5H9MA 1WEPA 2KREA 4GNGA 5I3LA 2JRJA 1Z6UA 4X3GA 4V3KC 2K4DA 2MNYA 1VFYA 4R2YA 4S3OC 4AVXA 1Z60A 1VD4A 2KR4A 4LKAA 1CHCA 5KH3A 2CSYA 5AIUA 2F42A 2DX8A 2HDPA 2YSMA 2XB1A 2KE1A 2KWKA 5LKZA 3L1XA 2L5UA 1MM2A 4IC3A 2MD8C 4I7BA 4FK5A 3M62A 1K2FA 2MA6A 1RMDA 4PPEA 2M1RA 3GV4A 1WESA 2YQMA 2M85A 5D1KB 1VYXA 2L80A 2YW8A 5H1UA 2LGLA 2YHOA 3RTRB 2KGIA 2E6RA 1WE9A 5EYAF 3FL2A 2M3HA 4FIPA 4B7YC 2QIZA 3KV5A 2ECVA 4CCGX 3PURA 3DQVR 3PUQA 2EGPA 2ECIA 2YYRA 3EB6A 4IC2A 1LDKC 1X4IA 2VP7A 4R8PK 2G43A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QIC A;  2G6Q A;  4WA6 A;  5DKA A;  1WFK A;  2F6J A;  5JG6 A;  3C6W A;  3RPG B;  3ZYQ A;  1ZBD B;  4FJC A;  1X4J A;  2VPG A;  1WGM A;  3O33 A;  3C5K A;  3IHP A;  4YBS A;  4YAX A;  5TBN A;  5DIN A;  1DVP A;  1X4U A;  4NN2 A;  2VJF A;  2KWJ A;  1WEM A;  3HTK C;  5LKX A;  4ZQL A;  3N9M A;  3U5O A;  2RSD A;  3LRQ A;  5B8D A;  1WEE A;  1V87 A;  1WEV A;  2CT2 A;  2ECN A;  2LRI C;  2YUR A;  4L7X A;  4XI1 A;  2H0D B;  2FUU A;  2JMD A;  1N87 A;  2MUM A;  3N9P A;  5FEY A;  5B78 A;  1FP0 A;  4LJN A;  4PTB A;  1JM7 B;  4ZDT A;  2CSZ A;  3T6R A;  2YHN A;  1FBV A;  2MIQ A;  1WEU A;  3M99 A;  2LGV A;  3VK6 A;  5FB0 A;  2Y1N A;  2FUI A;  4AYC A;  1BOR A;  1MM3 A;  5FB1 A;  4B86 C;  2KIZ A;  2BAY A;  1JM7 A;  2K1J A;  4YBM A;  1IYM A;  2C2L A;  1WEN A;  5B77 A;  3I2D A;  2KYU A;  3DPL R;  2KGG A;  3N9N A;  4QF2 A;  5B76 A;  1JOC A;  4GND A;  3ZVZ B;  3KQI A;  2L0B A;  3RPG C;  4YC9 A;  3PHD A;  5H1V A;  4UP0 A;  2LXH C;  5H1T A;  2YU4 A;  2C2V S;  2MT5 A;  2L75 A;  1HYI A;  5D1L B;  4BHW A;  3O7A A;  4C9Z A;  3U5P A;  2JMI A;  5KH7 A;  1F62 A;  4I7D A;  5D1M B;  4A0C D;  2PNX A;  4WZ3 B;  3LQH A;  4ZUX U;  4YAT A;  2I50 A;  2VJE B;  5B79 A;  4FO9 A;  2EOD A;  1XWH A;  2H0D A;  2D8S A;  5G05 B;  2Y1M A;  2AN6 A;  2JMJ A;  4GNF A;  3QZV A;  4YAB A;  3ZPV E;  3EB5 A;  5TDR A;  4YAD A;  1WIM A;  2CKL B;  2E6S A;  3ZNI A;  1U6G B;  2VPD A;  4MVT A;  5FER A;  4LK9 A;  3HCS A;  4MSX A;  2LDR A;  2VPB A;  5J3X A;  2YRE A;  3ZVY A;  3V43 A;  3U5M A;  1LDJ B;  4R7E A;  3U5N A;  1E4U A;  4GB0 A;  1T1H A;  5LCW B;  4AYC B;  3SHB A;  2FSA A;  2ECG A;  2F6N A;  2PUY A;  3SOW A;  4LLB A;  3HCU A;  1WEQ A;  5KH9 A;  3NG2 A;  3KNV A;  4I7C A;  2LXP C;  4N3W A;  2MNZ A;  3GL6 A;  3N9Q A;  3L1Z B;  3N9O A;  4GNE A;  4A4C A;  4F52 B;  5C11 A;  5TRB A;  2QJ0 A;  5TAB A;  5G04 B;  2ECJ A;  3M63 A;  4UP5 A;  2YQL A;  4YBT A;  1Z2Q A;  5LKU A;  2K17 A;  2ECT A;  2HYE D;  5AIT A;  3SOX A;  2RI7 A;  2VJE A;  4AP4 A;  2L43 A;  4UI9 B;  3O34 A;  2LV9 A;  2ECW A;  2KFT A;  3T7L A;  2MA5 A;  3HCT A;  3O36 A;  4P5O B;  4WZ0 A;  4A4B A;  4CA1 A;  1WIL A;  1WEW A;  2LGG A;  2YUC A;  1HYJ A;  3MHS A;  2KWO A;  2LQ6 A;  2K16 A;  2M6M A;  4AUQ B;  2EA6 A;  2CKL A;  2ZET C;  3ZTG A;  5LKT A;  2VPE A;  2NAA A;  2KU3 A;  4WZ2 A;  2LN0 A;  4A49 A;  1G25 A;  2OXQ C;  5TDW A;  4O64 A;  5B75 A;  2YSJ A;  3O35 A;  4LAD B;  3KV6 A;  3ASL A;  3N9L A;  3LQI A;  2MD7 B;  5C13 A;  2VJF B;  3LQJ A;  2UZG A;  2LGK A;  4L58 A;  2XEU A;  2YT5 A;  4V3L C;  4S3O B;  4TKP B;  1WEO A;  3L11 A;  3O70 A;  4W4U A;  2G45 A;  2VNF A;  3SOU A;  4BBQ A;  2Y43 A;  4Q6F A;  4N4F A;  4QF3 A;  3ZPV 1;  3O37 A;  5G0F A;  2KWN A;  3MHH A;  2IDA A;  5H9M A;  1WEP A;  2KRE A;  4GNG A;  5I3L A;  2JRJ A;  1Z6U A;  4X3G A;  4V3K C;  2K4D A;  2MNY A;  1VFY A;  4R2Y A;  4S3O C;  4AVX A;  1Z60 A;  1VD4 A;  2KR4 A;  4LKA A;  1CHC A;  5KH3 A;  2CSY A;  5AIU A;  2F42 A;  2DX8 A;  2HDP A;  2YSM A;  2XB1 A;  2KE1 A;  2KWK A;  5LKZ A;  3L1X A;  2L5U A;  1MM2 A;  4IC3 A;  2MD8 C;  4I7B A;  4FK5 A;  3M62 A;  1K2F A;  2MA6 A;  1RMD A;  4PPE A;  2M1R A;  3GV4 A;  1WES A;  2YQM A;  2M85 A;  5D1K B;  1VYX A;  2L80 A;  2YW8 A;  5H1U A;  2LGL A;  2YHO A;  3RTR B;  2KGI A;  2E6R A;  1WE9 A;  5EYA F;  3FL2 A;  2M3H A;  4FIP A;  4B7Y C;  2QIZ A;  3KV5 A;  2ECV A;  4CCG X;  3PUR A;  3DQV R;  3PUQ A;  2EGP A;  2ECI A;  2YYR A;  3EB6 A;  4IC2 A;  1LDK C;  1X4I A;  2VP7 A;  4R8P K;  2G43 A; 
#chains in the Genus database with same CATH topology
 2QIC A;  2G6Q A;  4WA6 A;  5DKA A;  2KKY A;  1WFK A;  5SVY A;  2F6J A;  5JG6 A;  3C6W A;  2CSV A;  3RPG B;  3ZYQ A;  1ZBD B;  2EXU A;  4FJC A;  1X4J A;  2VPG A;  1WGM A;  3O33 A;  3C5K A;  3IHP A;  3FJU B;  4YBS A;  4YAX A;  5TBN A;  5DIN A;  3T9K A;  1DVP A;  1X4U A;  4NN2 A;  2VJF A;  2KWJ A;  5SVI A;  1WEM A;  3HTK C;  5LKX A;  4O62 A;  2OWA A;  4ZQL A;  3N9M A;  3U5O A;  2RSD A;  3LRQ A;  5B8D A;  1WEE A;  3KDE C;  1V87 A;  1WEV A;  2CT2 A;  2ECN A;  2LRI C;  2YUR A;  3DWD A;  4L7X A;  4XI1 A;  2H0D B;  2FUU A;  2JMD A;  1N87 A;  2MUM A;  3N9P A;  5FEY A;  5B78 A;  1FP0 A;  4LJN A;  4PTB A;  1JM7 B;  4ZDT A;  2CSZ A;  3T6R A;  2YHN A;  1FBV A;  2MIQ A;  1WEU A;  3M99 A;  2LGV A;  3VK6 A;  5FB0 A;  2Y1N A;  2FUI A;  4AYC A;  1BOR A;  1MM3 A;  5FB1 A;  4Z0R A;  3PLW A;  2KIZ A;  4B86 C;  2BAY A;  1JM7 A;  2K1J A;  4YBM A;  1IYM A;  2C2L A;  2IQJ A;  1WEN A;  5B77 A;  3I2D A;  2KYU A;  3DPL R;  5SVX A;  2KGG A;  3N9N A;  4QF2 A;  5B76 A;  1JOC A;  4GND A;  3ZVZ B;  3KQI A;  2L0B A;  3RPG C;  4YC9 A;  3PHD A;  5H1V A;  4UP0 A;  2LXH C;  5H1T A;  2YU4 A;  2C2V S;  2MT5 A;  2L75 A;  1HYI A;  5D1L B;  4OGE A;  4BHW A;  3O7A A;  4C9Z A;  3U5P A;  2JMI A;  5KH7 A;  1F62 A;  4I7D A;  5D1M B;  4A0C D;  2PNX A;  4WZ3 B;  3FAN A;  3LQH A;  4ZUX U;  3FM8 C;  4YAT A;  2I50 A;  2VJE B;  5B79 A;  4FO9 A;  2EOD A;  1XWH A;  2H0D A;  2D8S A;  5G05 B;  3FAO A;  2RR4 A;  2Y1M A;  2XOC A;  2AN6 A;  2JMJ A;  2JUN A;  4GNF A;  2EGM A;  3QZV A;  4YAB A;  3ZPV E;  3EB5 A;  5TDR A;  4YAD A;  1WIM A;  5K3Q A;  4H9D A;  2CKL B;  2E6S A;  3ZNI A;  1U6G B;  2VPD A;  4MVT A;  5FER A;  2XOZ A;  2XP0 A;  4LK9 A;  3HCS A;  4MSX A;  2LDR A;  2KKX A;  2VPB A;  5J3X A;  2YRE A;  2DJA A;  2JM3 A;  3ZVY A;  3V43 A;  3U5M A;  1LDJ B;  4R7E A;  3JUE A;  3U5N A;  2B0O E;  1E4U A;  4GB0 A;  4QQ4 A;  1T1H A;  2P57 A;  5LCW B;  4AYC B;  3SHB A;  2FSA A;  2ECG A;  2F6N A;  2PUY A;  3SOW A;  4LLB A;  3HCU A;  1WEQ A;  5KH9 A;  3NG2 A;  3KNV A;  4I7C A;  2LXP C;  4N3W A;  2MNZ A;  3GL6 A;  3N9Q A;  3L1Z B;  3N9O A;  4GNE A;  4A4C A;  4F52 B;  5C11 A;  5TRB A;  2QJ0 A;  5TAB A;  5G04 B;  2ECJ A;  3M63 A;  4UP5 A;  2YQL A;  4YBT A;  1Z2Q A;  5LKU A;  2K17 A;  2ECT A;  2HYE D;  3DDT A;  5AIT A;  3SOX A;  2RI7 A;  2VJE A;  4AP4 A;  2L43 A;  4UI9 B;  3O34 A;  2LV9 A;  2ECW A;  2KFT A;  2CRW A;  3T7L A;  2MA5 A;  3HCT A;  3O36 A;  4P5O B;  4WZ0 A;  4A4B A;  4CA1 A;  1WIL A;  1WEW A;  3LVR E;  3MDB C;  2LGG A;  2YUC A;  1HYJ A;  3MHS A;  2KWO A;  2E61 A;  2LQ6 A;  3O47 A;  2K16 A;  2CON A;  2M6M A;  4AUQ B;  2EA6 A;  2CKL A;  2ZET C;  3ZTG A;  2XOY A;  5LKT A;  2CRR A;  2VPE A;  2NAA A;  2KU3 A;  3LJU X;  4WZ2 A;  2FD4 A;  2L7P A;  2LN0 A;  4A49 A;  2LAU A;  3LDY A;  1G25 A;  2OXQ C;  5TDW A;  4O64 A;  5B75 A;  2YSJ A;  3O35 A;  4LAD B;  3KV6 A;  3ASL A;  3N9L A;  3LQI A;  2MD7 B;  2D8U A;  5C13 A;  2VJF B;  2YVR A;  2UZG A;  3LQJ A;  3LVQ E;  2LGK A;  4L58 A;  2XEU A;  2YT5 A;  4V3L C;  4S3O B;  4TKP B;  1WEO A;  3L11 A;  3O70 A;  4W4U A;  2G45 A;  2VNF A;  4F1P A;  3SOU A;  4BBQ A;  2Y43 A;  4Q6F A;  4N4F A;  4QF3 A;  3ZPV 1;  3O37 A;  5G0F A;  2KWN A;  3SUB A;  3MHH A;  2IDA A;  5H9M A;  1WEP A;  2KRE A;  4GNG A;  5I3L A;  2JRJ A;  1Z6U A;  4X3G A;  4V3K C;  2K4D A;  5SVI B;  1DCQ A;  2MNY A;  1VFY A;  4R2Y A;  4S3O C;  4AVX A;  1Z60 A;  1VD4 A;  3FEH A;  2KR4 A;  4LKA A;  2DSM A;  1CHC A;  5KH3 A;  2MKE A;  2CSY A;  3Q1D A;  5AIU A;  2F42 A;  2DX8 A;  2HDP A;  2YSM A;  2XB1 A;  2FFW A;  2KE1 A;  2KWK A;  5LKZ A;  4Z0O A;  3L1X A;  2L5U A;  1MM2 A;  4IC3 A;  2MD8 C;  4I7B A;  4FK5 A;  3M62 A;  1K2F A;  2MA6 A;  1RMD A;  4PPE A;  1MBM A;  2M1R A;  3GV4 A;  3M7K A;  1WES A;  2YQM A;  2M85 A;  5D1K B;  1VYX A;  2L80 A;  3E2D A;  2YW8 A;  5H1U A;  2LGL A;  2YHO A;  3RTR B;  2KGI A;  2E6R A;  1WE9 A;  5EYA F;  3FL2 A;  2M3H A;  4FIP A;  4B7Y C;  2QIZ A;  3KV5 A;  2ECV A;  3H7H A;  4CCG X;  2M13 A;  4OGC A;  3PUR A;  3DQV R;  3PUQ A;  2EGP A;  2ECI A;  2YYR A;  3EB6 A;  4IC2 A;  1LDK C;  1X4I A;  2VP7 A;  4R8P K;  2G43 A; 
#chains in the Genus database with same CATH homology
 2QIC A;  2G6Q A;  4WA6 A;  5DKA A;  1WFK A;  2F6J A;  5JG6 A;  3C6W A;  3RPG B;  3ZYQ A;  1ZBD B;  4FJC A;  1X4J A;  2VPG A;  1WGM A;  3O33 A;  3C5K A;  3IHP A;  4YBS A;  4YAX A;  5TBN A;  5DIN A;  1DVP A;  1X4U A;  4NN2 A;  2VJF A;  2KWJ A;  1WEM A;  3HTK C;  5LKX A;  4ZQL A;  3N9M A;  3U5O A;  2RSD A;  3LRQ A;  5B8D A;  1WEE A;  1V87 A;  1WEV A;  2CT2 A;  2ECN A;  2LRI C;  2YUR A;  4L7X A;  4XI1 A;  2H0D B;  2FUU A;  2JMD A;  1N87 A;  2MUM A;  3N9P A;  5FEY A;  5B78 A;  1FP0 A;  4LJN A;  4PTB A;  1JM7 B;  4ZDT A;  2CSZ A;  3T6R A;  2YHN A;  1FBV A;  2MIQ A;  1WEU A;  3M99 A;  2LGV A;  3VK6 A;  5FB0 A;  2Y1N A;  2FUI A;  4AYC A;  1BOR A;  1MM3 A;  5FB1 A;  4B86 C;  2KIZ A;  2BAY A;  1JM7 A;  2K1J A;  4YBM A;  1IYM A;  2C2L A;  1WEN A;  5B77 A;  3I2D A;  2KYU A;  3DPL R;  2KGG A;  3N9N A;  4QF2 A;  5B76 A;  1JOC A;  4GND A;  3ZVZ B;  3KQI A;  2L0B A;  3RPG C;  4YC9 A;  3PHD A;  5H1V A;  4UP0 A;  2LXH C;  5H1T A;  2YU4 A;  2C2V S;  2MT5 A;  2L75 A;  1HYI A;  5D1L B;  4BHW A;  3O7A A;  4C9Z A;  3U5P A;  2JMI A;  5KH7 A;  1F62 A;  4I7D A;  5D1M B;  4A0C D;  2PNX A;  4WZ3 B;  3LQH A;  4ZUX U;  4YAT A;  2I50 A;  2VJE B;  5B79 A;  4FO9 A;  2EOD A;  1XWH A;  2H0D A;  2D8S A;  5G05 B;  2Y1M A;  2AN6 A;  2JMJ A;  4GNF A;  3QZV A;  4YAB A;  3ZPV E;  3EB5 A;  5TDR A;  4YAD A;  1WIM A;  2CKL B;  2E6S A;  3ZNI A;  1U6G B;  2VPD A;  4MVT A;  5FER A;  4LK9 A;  3HCS A;  4MSX A;  2LDR A;  2VPB A;  5J3X A;  2YRE A;  3ZVY A;  3V43 A;  3U5M A;  1LDJ B;  4R7E A;  3U5N A;  1E4U A;  4GB0 A;  1T1H A;  5LCW B;  4AYC B;  3SHB A;  2FSA A;  2ECG A;  2F6N A;  2PUY A;  3SOW A;  4LLB A;  3HCU A;  1WEQ A;  5KH9 A;  3NG2 A;  3KNV A;  4I7C A;  2LXP C;  4N3W A;  2MNZ A;  3GL6 A;  3N9Q A;  3L1Z B;  3N9O A;  4GNE A;  4A4C A;  4F52 B;  5C11 A;  5TRB A;  2QJ0 A;  5TAB A;  5G04 B;  2ECJ A;  3M63 A;  4UP5 A;  2YQL A;  4YBT A;  1Z2Q A;  5LKU A;  2K17 A;  2ECT A;  2HYE D;  5AIT A;  3SOX A;  2RI7 A;  2VJE A;  4AP4 A;  2L43 A;  4UI9 B;  3O34 A;  2LV9 A;  2ECW A;  2KFT A;  3T7L A;  2MA5 A;  3HCT A;  3O36 A;  4P5O B;  4WZ0 A;  4A4B A;  4CA1 A;  1WIL A;  1WEW A;  2LGG A;  2YUC A;  1HYJ A;  3MHS A;  2KWO A;  2LQ6 A;  2K16 A;  2M6M A;  4AUQ B;  2EA6 A;  2CKL A;  2ZET C;  3ZTG A;  5LKT A;  2VPE A;  2NAA A;  2KU3 A;  4WZ2 A;  2LN0 A;  4A49 A;  1G25 A;  2OXQ C;  5TDW A;  4O64 A;  5B75 A;  2YSJ A;  3O35 A;  4LAD B;  3KV6 A;  3ASL A;  3N9L A;  3LQI A;  2MD7 B;  5C13 A;  2VJF B;  3LQJ A;  2UZG A;  2LGK A;  4L58 A;  2XEU A;  2YT5 A;  4V3L C;  4S3O B;  4TKP B;  1WEO A;  3L11 A;  3O70 A;  4W4U A;  2G45 A;  2VNF A;  3SOU A;  4BBQ A;  2Y43 A;  4Q6F A;  4N4F A;  4QF3 A;  3ZPV 1;  3O37 A;  5G0F A;  2KWN A;  3MHH A;  2IDA A;  5H9M A;  1WEP A;  2KRE A;  4GNG A;  5I3L A;  2JRJ A;  1Z6U A;  4X3G A;  4V3K C;  2K4D A;  2MNY A;  1VFY A;  4R2Y A;  4S3O C;  4AVX A;  1Z60 A;  1VD4 A;  2KR4 A;  4LKA A;  1CHC A;  5KH3 A;  2CSY A;  5AIU A;  2F42 A;  2DX8 A;  2HDP A;  2YSM A;  2XB1 A;  2KE1 A;  2KWK A;  5LKZ A;  3L1X A;  2L5U A;  1MM2 A;  4IC3 A;  2MD8 C;  4I7B A;  4FK5 A;  3M62 A;  1K2F A;  2MA6 A;  1RMD A;  4PPE A;  2M1R A;  3GV4 A;  1WES A;  2YQM A;  2M85 A;  5D1K B;  1VYX A;  2L80 A;  2YW8 A;  5H1U A;  2LGL A;  2YHO A;  3RTR B;  2KGI A;  2E6R A;  1WE9 A;  5EYA F;  3FL2 A;  2M3H A;  4FIP A;  4B7Y C;  2QIZ A;  3KV5 A;  2ECV A;  4CCG X;  3PUR A;  3DQV R;  3PUQ A;  2EGP A;  2ECI A;  2YYR A;  3EB6 A;  4IC2 A;  1LDK C;  1X4I A;  2VP7 A;  4R8P K;  2G43 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...