2ZETC

Crystal structure of the small gtpase rab27b complexed with the slp homology domain of slac2-a/melanophilin
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
141
structure length
141
Chain Sequence
RLDLSTLTDEEAEHVWAVVQRDFDLRRREEERLQGLKGKIQKESSKRELLSDTAHLNETHCARCLQPYRLLLNSRRQCLECSLFVCKSCSHAHPEEQGWLCDPCHLARVVKIGSLEWYYQHVRARFKRFGSAKVIRSLCGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rab-27B
publication title Structural basis for the exclusive specificity of Slac2-a/melanophilin for the Rab27 GTPases.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 48
structure length 141
sequence length 141
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02318 FYVE_2 FYVE-type zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2zetC00
5LKUA 3ZPV1 5D1KB 3U5OA 3KNVA 3RPGB 5D1LB 4IC3A 5KH9A 4I7DA 2DX8A 5KH3A 2ZETC 5J3XA 2VJFA 1Z2QA 3HCUA 4GNFA 4YABA 4AUQB 2H0DA 3O70A 4A49A 4L58A 3RPGC 2CKLB 2MD7B 4I7CA 2M3HA 3LRQA 2YW8A 2M85A 4WZ2A 1XWHA 2KU3A 1WEUA 3ASLA 2HDPA 2VPDA 2F6NA 3O37A 2FSAA 2VPGA 3PHDA 2EODA 4ZQLA 4AVXA 5B78A 5B77A 2VJFB 3U5PA 2LGGA 4FO9A 4YADA 2VJEA 2YHNA 4F52B 3EB5A 4YC9A 4R8PK 2H0DB 2MT5A 4P5OB 2UZGA 1Z60A 1VD4A 4UP0A 4W4UA 2K16A 2YUCA 4FK5A 4I7BA 3SOWA 2KYUA 4LKAA 2XEUA 1K2FA 3EB6A 3HTKC 3O36A 5C13A 3HCTA 2KE1A 4CCGX 5FB0A 3ZTGA 2PUYA 3T7LA 3SHBA 2I50A 2YHOA 2YU4A 1MM3A 4ZDTA 3N9MA 1BORA 5H1TA 4S3OB 2AN6A 3SOUA 1WEWA 4BBQA 5B75A 5B76A 4R7EA 4A4CA 2LGVA 4PTBA 5JG6A 2YURA 4V3KC 2LDRA 3PURA 4CA1A 2KFTA 1WFKA 2KREA 2VPEA 4LK9A 5LKZA 2ECWA 4FIPA 4BHWA 4S3OC 3LQIA 3LQJA 2CT2A 2CSZA 2G43A 2F42A 2LRIC 4UI9B 1U6GB 2LXHC 1DVPA 1HYIA 3PUQA 1FP0A 2MD8C 2YT5A 2VP7A 2YREA 5G05B 2QICA 3ZVYA 3ZPVE 3MHHA 1CHCA 5AITA 2ECGA 4B7YC 3L1XA 2M6MA 4C9ZA 1MM2A 2OXQC 4QF2A 4WA6A 3NG2A 2KWOA 2RSDA 5LCWB 1G25A 1X4UA 1JM7A 4UP5A 3M99A 4GB0A 5B79A 4FJCA 2EGPA 5G0FA 5C11A 2RI7A 4YATA 5G04B 2NAAA 1JOCA 1LDJB 4LLBA 1VFYA 5D1MB 3N9NA 1WEVA 4YBMA 2ECVA 2YQMA 3RTRB 2JMIA 2HYED 2KR4A 3GL6A 3N9QA 3ZVZB 1IYMA 2L75A 2C2LA 3SOXA 1JM7B 2VJEB 4O64A 2ECJA 4TKPB 5H1UA 3N9PA 5DKAA 3O34A 2KGIA 2IDAA 1WESA 3FL2A 2D8SA 1F62A 1WGMA 3C5KA 3V43A 2L0BA 2LQ6A 1VYXA 1WIMA 4Q6FA 2FUIA 3N9OA 2VPBA 2FUUA 5TBNA 5FB1A 1WILA 2ECTA 3O35A 2E6SA 4YBTA 4A0CD 2KWKA 4ZUXU 4N3WA 3M63A 1RMDA 4YAXA 1Z6UA 3O7AA 4A4BA 1WEPA 4PPEA 2CKLA 1WEMA 2ECNA 2G45A 5B8DA 1FBVA 3KQIA 1WEOA 3DPLR 4R2YA 4QF3A 3VK6A 1X4IA 3HCSA 1T1HA 1LDKC 1X4JA 3U5MA 5I3LA 5FERA 2Y1NA 2YSMA 2YQLA 2LV9A 4GNGA 4IC2A 5AIUA 4AYCA 2K17A 4MSXA 2PNXA 4YBSA 4V3LC 2QJ0A 2YSJA 3ZYQA 2KIZA 3KV5A 5TDWA 2C2VS 2LGLA 2L80A 2ECIA 4N4FA 2MIQA 2KGGA 3C6WA 2BAYA 2CSYA 2XB1A 2JMJA 3I2DA 2MNZA 2MNYA 4LJNA 5LKTA 2K1JA 2LN0A 5H1VA 2F6JA 3L1ZB 3KV6A 3U5NA 2LGKA 4L7XA 2JMDA 5EYAF 2MA5A 4AYCB 3L11A 5LKXA 2K4DA 2KWNA 5H9MA 2E6RA 4GNDA 2MUMA 2YYRA 2EA6A 3GV4A 4B86C 4XI1A 1E4UA 3O33A 1WE9A 3M62A 1ZBDB 5TDRA 3ZNIA 2M1RA 1WEEA 2KWJA 3MHSA 5TRBA 1V87A 2QIZA 3QZVA 4LADB 2Y1MA 5KH7A 3T6RA 2L5UA 4GNEA 3DQVR 1HYJA 4WZ0A 1WEQA 4AP4A 2JRJA 4NN2A 2G6QA 4MVTA 2MA6A 1WENA 5FEYA 5TABA 2VNFA 2Y43A 3IHPA 1N87A 3N9LA 5DINA 3LQHA 4X3GA 2L43A 2LXPC 4WZ3B
chains in the Genus database with same CATH superfamily
5LKUA 3ZPV1 5D1KB 3U5OA 3DDTA 3KNVA 2KKYA 3SUBA 3RPGB 5D1LB 4IC3A 5KH9A 4I7DA 2DX8A 5KH3A 2CRRA 2ZETC 5J3XA 2VJFA 3O47A 1Z2QA 3HCUA 4GNFA 4YABA 4AUQB 2H0DA 3O70A 4A49A 4L58A 3RPGC 2CKLB 2MD7B 4I7CA 2M3HA 3LRQA 2YW8A 2M85A 4WZ2A 1XWHA 2KU3A 1WEUA 3ASLA 2HDPA 2VPDA 2F6NA 3O37A 3JUEA 2FSAA 2VPGA 3PHDA 2EODA 4OGEA 4ZQLA 4AVXA 5B78A 2VJFB 5B77A 2LGGA 3U5PA 4FO9A 4YADA 2VJEA 2YHNA 4F52B 3FAOA 3EB5A 4YC9A 4R8PK 2H0DB 2MT5A 4P5OB 2UZGA 1Z60A 1VD4A 4UP0A 4W4UA 2K16A 5SVXA 2YUCA 3DWDA 4FK5A 4I7BA 3SOWA 2KYUA 3M7KA 4LKAA 2XEUA 1K2FA 3EB6A 3HTKC 3O36A 5C13A 3HCTA 4F1PA 2KE1A 4CCGX 5FB0A 3ZTGA 2PUYA 2DSMA 3T7LA 3SHBA 2E61A 2I50A 2MKEA 2YHOA 2YU4A 1MM3A 4ZDTA 3N9MA 1BORA 5H1TA 4S3OB 2AN6A 3SOUA 1WEWA 4BBQA 5B75A 5B76A 4R7EA 4A4CA 2LGVA 4PTBA 5JG6A 2YURA 4V3KC 2LDRA 3PURA 4CA1A 2KFTA 1WFKA 2KREA 2VPEA 4LK9A 5LKZA 2ECWA 4FIPA 3LDYA 4BHWA 2IQJA 4S3OC 3LQIA 5SVYA 3LQJA 2CT2A 2CSZA 2JM3A 2G43A 2CRWA 2F42A 2LRIC 4UI9B 1U6GB 2LXHC 1DVPA 1HYIA 3PUQA 3FJUB 1FP0A 2KKXA 2MD8C 2YT5A 2VP7A 2XOYA 2YREA 5G05B 2QICA 3ZVYA 3ZPVE 3MHHA 1CHCA 5AITA 2ECGA 4B7YC 3L1XA 2M6MA 4C9ZA 1MM2A 2OXQC 3LVQE 4QF2A 4WA6A 3NG2A 2KWOA 2RSDA 5LCWB 1G25A 1X4UA 1DCQA 1JM7A 4UP5A 3M99A 4GB0A 5B79A 4FJCA 2EGPA 3FANA 5G0FA 5C11A 2RI7A 3E2DA 4YATA 5G04B 2NAAA 1JOCA 1LDJB 4LLBA 1VFYA 5D1MB 3N9NA 1WEVA 2LAUA 4YBMA 2ECVA 2YQMA 3RTRB 2JMIA 2M13A 2HYED 2KR4A 3GL6A 3N9QA 3ZVZB 1IYMA 2L75A 2C2LA 1MBMA 4QQ4A 3SOXA 1JM7B 4H9DA 2VJEB 4O64A 2ECJA 4OGCA 4TKPB 5H1UA 3N9PA 5DKAA 3O34A 2KGIA 2IDAA 1WESA 3FL2A 2D8SA 1F62A 1WGMA 3C5KA 3V43A 2L0BA 2LQ6A 1VYXA 1WIMA 4Q6FA 2FUIA 3N9OA 2VPBA 2FUUA 5TBNA 5FB1A 1WILA 3T9KA 2ECTA 2EGMA 3O35A 2E6SA 3LJUX 4YBTA 4A0CD 2KWKA 4ZUXU 4N3WA 3M63A 1RMDA 4YAXA 1Z6UA 3O7AA 4A4BA 1WEPA 4PPEA 2CKLA 1WEMA 2YVRA 2ECNA 2G45A 2B0OE 5B8DA 1FBVA 3KQIA 1WEOA 3DPLR 2CSVA 4R2YA 4QF3A 3VK6A 1X4IA 2CONA 3HCSA 2OWAA 2FD4A 1T1HA 1LDKC 1X4JA 3U5MA 5I3LA 5FERA 2Y1NA 2YSMA 2YQLA 2LV9A 4GNGA 4IC2A 5AIUA 4AYCA 2K17A 4MSXA 2PNXA 4YBSA 4V3LC 2QJ0A 2YSJA 3ZYQA 2KIZA 3KV5A 2C2VS 5TDWA 2LGLA 2L80A 2ECIA 4N4FA 4Z0OA 2MIQA 2KGGA 3C6WA 5SVIA 2FFWA 2RR4A 2BAYA 2CSYA 2XB1A 2JMJA 3I2DA 2MNZA 2MNYA 4LJNA 2DJAA 5LKTA 2P57A 2K1JA 2LN0A 5H1VA 2F6JA 3L1ZB 3KV6A 3U5NA 2LGKA 4L7XA 2XOCA 2JMDA 5EYAF 4O62A 2D8UA 2MA5A 4AYCB 3L11A 5LKXA 3MDBC 2JUNA 2K4DA 2KWNA 5H9MA 2E6RA 3LVRE 2L7PA 4GNDA 2MUMA 2YYRA 5SVIB 2EA6A 3GV4A 4B86C 4XI1A 2XOZA 4Z0RA 1E4UA 5K3QA 3FEHA 3O33A 1WE9A 3Q1DA 3M62A 1ZBDB 3PLWA 5TDRA 2M1RA 3ZNIA 1WEEA 2KWJA 3MHSA 5TRBA 1V87A 2EXUA 2QIZA 3QZVA 4LADB 2Y1MA 5KH7A 3T6RA 2XP0A 2L5UA 4GNEA 3DQVR 1HYJA 4WZ0A 3H7HA 1WEQA 4AP4A 2JRJA 4NN2A 2G6QA 4MVTA 2MA6A 1WENA 5FEYA 5TABA 2VNFA 3FM8C 2Y43A 3IHPA 1N87A 3N9LA 5DINA 3LQHA 3KDEC 4X3GA 2L43A 2LXPC 4WZ3B
chains in the Genus database with same CATH topology
5LKUA 3ZPV1 5D1KB 3U5OA 3KNVA 3RPGB 5D1LB 4IC3A 5KH9A 4I7DA 2DX8A 5KH3A 2ZETC 5J3XA 2VJFA 1Z2QA 3HCUA 4GNFA 4YABA 4AUQB 2H0DA 3O70A 4A49A 4L58A 3RPGC 2CKLB 2MD7B 4I7CA 2M3HA 3LRQA 2YW8A 2M85A 4WZ2A 1XWHA 2KU3A 1WEUA 3ASLA 2HDPA 2VPDA 2F6NA 3O37A 2FSAA 2VPGA 3PHDA 2EODA 4ZQLA 4AVXA 5B78A 5B77A 2VJFB 3U5PA 2LGGA 4FO9A 4YADA 2VJEA 2YHNA 4F52B 3EB5A 4YC9A 4R8PK 2H0DB 2MT5A 4P5OB 2UZGA 1Z60A 1VD4A 4UP0A 4W4UA 2K16A 2YUCA 4FK5A 4I7BA 3SOWA 2KYUA 4LKAA 2XEUA 1K2FA 3EB6A 3HTKC 3O36A 5C13A 3HCTA 2KE1A 4CCGX 5FB0A 3ZTGA 2PUYA 3T7LA 3SHBA 2I50A 2YHOA 2YU4A 1MM3A 4ZDTA 3N9MA 1BORA 5H1TA 4S3OB 2AN6A 3SOUA 1WEWA 4BBQA 5B75A 5B76A 4R7EA 4A4CA 2LGVA 4PTBA 5JG6A 2YURA 4V3KC 2LDRA 3PURA 4CA1A 2KFTA 1WFKA 2KREA 2VPEA 4LK9A 5LKZA 2ECWA 4FIPA 4BHWA 4S3OC 3LQIA 3LQJA 2CT2A 2CSZA 2G43A 2F42A 2LRIC 4UI9B 1U6GB 2LXHC 1DVPA 1HYIA 3PUQA 1FP0A 2MD8C 2YT5A 2VP7A 2YREA 5G05B 2QICA 3ZVYA 3ZPVE 3MHHA 1CHCA 5AITA 2ECGA 4B7YC 3L1XA 2M6MA 4C9ZA 1MM2A 2OXQC 4QF2A 4WA6A 3NG2A 2KWOA 2RSDA 5LCWB 1G25A 1X4UA 1JM7A 4UP5A 3M99A 4GB0A 5B79A 4FJCA 2EGPA 5G0FA 5C11A 2RI7A 4YATA 5G04B 2NAAA 1JOCA 1LDJB 4LLBA 1VFYA 5D1MB 3N9NA 1WEVA 4YBMA 2ECVA 2YQMA 3RTRB 2JMIA 2HYED 2KR4A 3GL6A 3N9QA 3ZVZB 1IYMA 2L75A 2C2LA 3SOXA 1JM7B 2VJEB 4O64A 2ECJA 4TKPB 5H1UA 3N9PA 5DKAA 3O34A 2KGIA 2IDAA 1WESA 3FL2A 2D8SA 1F62A 1WGMA 3C5KA 3V43A 2L0BA 2LQ6A 1VYXA 1WIMA 4Q6FA 2FUIA 3N9OA 2VPBA 2FUUA 5TBNA 5FB1A 1WILA 2ECTA 3O35A 2E6SA 4YBTA 4A0CD 2KWKA 4ZUXU 4N3WA 3M63A 1RMDA 4YAXA 1Z6UA 3O7AA 4A4BA 1WEPA 4PPEA 2CKLA 1WEMA 2ECNA 2G45A 5B8DA 1FBVA 3KQIA 1WEOA 3DPLR 4R2YA 4QF3A 3VK6A 1X4IA 3HCSA 1T1HA 1LDKC 1X4JA 3U5MA 5I3LA 5FERA 2Y1NA 2YSMA 2YQLA 2LV9A 4GNGA 4IC2A 5AIUA 4AYCA 2K17A 4MSXA 2PNXA 4YBSA 4V3LC 2QJ0A 2YSJA 3ZYQA 2KIZA 3KV5A 5TDWA 2C2VS 2LGLA 2L80A 2ECIA 4N4FA 2MIQA 2KGGA 3C6WA 2BAYA 2CSYA 2XB1A 2JMJA 3I2DA 2MNZA 2MNYA 4LJNA 5LKTA 2K1JA 2LN0A 5H1VA 2F6JA 3L1ZB 3KV6A 3U5NA 2LGKA 4L7XA 2JMDA 5EYAF 2MA5A 4AYCB 3L11A 5LKXA 2K4DA 2KWNA 5H9MA 2E6RA 4GNDA 2MUMA 2YYRA 2EA6A 3GV4A 4B86C 4XI1A 1E4UA 3O33A 1WE9A 3M62A 1ZBDB 5TDRA 3ZNIA 2M1RA 1WEEA 2KWJA 3MHSA 5TRBA 1V87A 2QIZA 3QZVA 4LADB 2Y1MA 5KH7A 3T6RA 2L5UA 4GNEA 3DQVR 1HYJA 4WZ0A 1WEQA 4AP4A 2JRJA 4NN2A 2G6QA 4MVTA 2MA6A 1WENA 5FEYA 5TABA 2VNFA 2Y43A 3IHPA 1N87A 3N9LA 5DINA 3LQHA 4X3GA 2L43A 2LXPC 4WZ3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LKU A;  3ZPV 1;  5D1K B;  3U5O A;  3KNV A;  3RPG B;  5D1L B;  4IC3 A;  5KH9 A;  4I7D A;  2DX8 A;  5KH3 A;  2ZET C;  5J3X A;  2VJF A;  1Z2Q A;  3HCU A;  4GNF A;  4YAB A;  4AUQ B;  2H0D A;  3O70 A;  4A49 A;  4L58 A;  3RPG C;  2CKL B;  2MD7 B;  4I7C A;  2M3H A;  3LRQ A;  2YW8 A;  2M85 A;  4WZ2 A;  1XWH A;  2KU3 A;  1WEU A;  3ASL A;  2HDP A;  2VPD A;  2F6N A;  3O37 A;  2FSA A;  2VPG A;  3PHD A;  2EOD A;  4ZQL A;  4AVX A;  5B78 A;  5B77 A;  2VJF B;  3U5P A;  2LGG A;  4FO9 A;  4YAD A;  2VJE A;  2YHN A;  4F52 B;  3EB5 A;  4YC9 A;  4R8P K;  2H0D B;  2MT5 A;  4P5O B;  2UZG A;  1Z60 A;  1VD4 A;  4UP0 A;  4W4U A;  2K16 A;  2YUC A;  4FK5 A;  4I7B A;  3SOW A;  2KYU A;  4LKA A;  2XEU A;  1K2F A;  3EB6 A;  3HTK C;  3O36 A;  5C13 A;  3HCT A;  2KE1 A;  4CCG X;  5FB0 A;  3ZTG A;  2PUY A;  3T7L A;  3SHB A;  2I50 A;  2YHO A;  2YU4 A;  1MM3 A;  4ZDT A;  3N9M A;  1BOR A;  5H1T A;  4S3O B;  2AN6 A;  3SOU A;  1WEW A;  4BBQ A;  5B75 A;  5B76 A;  4R7E A;  4A4C A;  2LGV A;  4PTB A;  5JG6 A;  2YUR A;  4V3K C;  2LDR A;  3PUR A;  4CA1 A;  2KFT A;  1WFK A;  2KRE A;  2VPE A;  4LK9 A;  5LKZ A;  2ECW A;  4FIP A;  4BHW A;  4S3O C;  3LQI A;  3LQJ A;  2CT2 A;  2CSZ A;  2G43 A;  2F42 A;  2LRI C;  4UI9 B;  1U6G B;  2LXH C;  1DVP A;  1HYI A;  3PUQ A;  1FP0 A;  2MD8 C;  2YT5 A;  2VP7 A;  2YRE A;  5G05 B;  2QIC A;  3ZVY A;  3ZPV E;  3MHH A;  1CHC A;  5AIT A;  2ECG A;  4B7Y C;  3L1X A;  2M6M A;  4C9Z A;  1MM2 A;  2OXQ C;  4QF2 A;  4WA6 A;  3NG2 A;  2KWO A;  2RSD A;  5LCW B;  1G25 A;  1X4U A;  1JM7 A;  4UP5 A;  3M99 A;  4GB0 A;  5B79 A;  4FJC A;  2EGP A;  5G0F A;  5C11 A;  2RI7 A;  4YAT A;  5G04 B;  2NAA A;  1JOC A;  1LDJ B;  4LLB A;  1VFY A;  5D1M B;  3N9N A;  1WEV A;  4YBM A;  2ECV A;  2YQM A;  3RTR B;  2JMI A;  2HYE D;  2KR4 A;  3GL6 A;  3N9Q A;  3ZVZ B;  1IYM A;  2L75 A;  2C2L A;  3SOX A;  1JM7 B;  2VJE B;  4O64 A;  2ECJ A;  4TKP B;  5H1U A;  3N9P A;  5DKA A;  3O34 A;  2KGI A;  2IDA A;  1WES A;  3FL2 A;  2D8S A;  1F62 A;  1WGM A;  3C5K A;  3V43 A;  2L0B A;  2LQ6 A;  1VYX A;  1WIM A;  4Q6F A;  2FUI A;  3N9O A;  2VPB A;  2FUU A;  5TBN A;  5FB1 A;  1WIL A;  2ECT A;  3O35 A;  2E6S A;  4YBT A;  4A0C D;  2KWK A;  4ZUX U;  4N3W A;  3M63 A;  1RMD A;  4YAX A;  1Z6U A;  3O7A A;  4A4B A;  1WEP A;  4PPE A;  2CKL A;  1WEM A;  2ECN A;  2G45 A;  5B8D A;  1FBV A;  3KQI A;  1WEO A;  3DPL R;  4R2Y A;  4QF3 A;  3VK6 A;  1X4I A;  3HCS A;  1T1H A;  1LDK C;  1X4J A;  3U5M A;  5I3L A;  5FER A;  2Y1N A;  2YSM A;  2YQL A;  2LV9 A;  4GNG A;  4IC2 A;  5AIU A;  4AYC A;  2K17 A;  4MSX A;  2PNX A;  4YBS A;  4V3L C;  2QJ0 A;  2YSJ A;  3ZYQ A;  2KIZ A;  3KV5 A;  5TDW A;  2C2V S;  2LGL A;  2L80 A;  2ECI A;  4N4F A;  2MIQ A;  2KGG A;  3C6W A;  2BAY A;  2CSY A;  2XB1 A;  2JMJ A;  3I2D A;  2MNZ A;  2MNY A;  4LJN A;  5LKT A;  2K1J A;  2LN0 A;  5H1V A;  2F6J A;  3L1Z B;  3KV6 A;  3U5N A;  2LGK A;  4L7X A;  2JMD A;  5EYA F;  2MA5 A;  4AYC B;  3L11 A;  5LKX A;  2K4D A;  2KWN A;  5H9M A;  2E6R A;  4GND A;  2MUM A;  2YYR A;  2EA6 A;  3GV4 A;  4B86 C;  4XI1 A;  1E4U A;  3O33 A;  1WE9 A;  3M62 A;  1ZBD B;  5TDR A;  3ZNI A;  2M1R A;  1WEE A;  2KWJ A;  3MHS A;  5TRB A;  1V87 A;  2QIZ A;  3QZV A;  4LAD B;  2Y1M A;  5KH7 A;  3T6R A;  2L5U A;  4GNE A;  3DQV R;  1HYJ A;  4WZ0 A;  1WEQ A;  4AP4 A;  2JRJ A;  4NN2 A;  2G6Q A;  4MVT A;  2MA6 A;  1WEN A;  5FEY A;  5TAB A;  2VNF A;  2Y43 A;  3IHP A;  1N87 A;  3N9L A;  5DIN A;  3LQH A;  4X3G A;  2L43 A;  2LXP C;  4WZ3 B; 
#chains in the Genus database with same CATH topology
 5LKU A;  3ZPV 1;  5D1K B;  3U5O A;  3DDT A;  3KNV A;  2KKY A;  3SUB A;  3RPG B;  5D1L B;  4IC3 A;  5KH9 A;  4I7D A;  2DX8 A;  5KH3 A;  2CRR A;  2ZET C;  5J3X A;  2VJF A;  3O47 A;  1Z2Q A;  3HCU A;  4GNF A;  4YAB A;  4AUQ B;  2H0D A;  3O70 A;  4A49 A;  4L58 A;  3RPG C;  2CKL B;  2MD7 B;  4I7C A;  2M3H A;  3LRQ A;  2YW8 A;  2M85 A;  4WZ2 A;  1XWH A;  2KU3 A;  1WEU A;  3ASL A;  2HDP A;  2VPD A;  2F6N A;  3O37 A;  3JUE A;  2FSA A;  2VPG A;  3PHD A;  2EOD A;  4OGE A;  4ZQL A;  4AVX A;  5B78 A;  2VJF B;  5B77 A;  2LGG A;  3U5P A;  4FO9 A;  4YAD A;  2VJE A;  2YHN A;  4F52 B;  3FAO A;  3EB5 A;  4YC9 A;  4R8P K;  2H0D B;  2MT5 A;  4P5O B;  2UZG A;  1Z60 A;  1VD4 A;  4UP0 A;  4W4U A;  2K16 A;  5SVX A;  2YUC A;  3DWD A;  4FK5 A;  4I7B A;  3SOW A;  2KYU A;  3M7K A;  4LKA A;  2XEU A;  1K2F A;  3EB6 A;  3HTK C;  3O36 A;  5C13 A;  3HCT A;  4F1P A;  2KE1 A;  4CCG X;  5FB0 A;  3ZTG A;  2PUY A;  2DSM A;  3T7L A;  3SHB A;  2E61 A;  2I50 A;  2MKE A;  2YHO A;  2YU4 A;  1MM3 A;  4ZDT A;  3N9M A;  1BOR A;  5H1T A;  4S3O B;  2AN6 A;  3SOU A;  1WEW A;  4BBQ A;  5B75 A;  5B76 A;  4R7E A;  4A4C A;  2LGV A;  4PTB A;  5JG6 A;  2YUR A;  4V3K C;  2LDR A;  3PUR A;  4CA1 A;  2KFT A;  1WFK A;  2KRE A;  2VPE A;  4LK9 A;  5LKZ A;  2ECW A;  4FIP A;  3LDY A;  4BHW A;  2IQJ A;  4S3O C;  3LQI A;  5SVY A;  3LQJ A;  2CT2 A;  2CSZ A;  2JM3 A;  2G43 A;  2CRW A;  2F42 A;  2LRI C;  4UI9 B;  1U6G B;  2LXH C;  1DVP A;  1HYI A;  3PUQ A;  3FJU B;  1FP0 A;  2KKX A;  2MD8 C;  2YT5 A;  2VP7 A;  2XOY A;  2YRE A;  5G05 B;  2QIC A;  3ZVY A;  3ZPV E;  3MHH A;  1CHC A;  5AIT A;  2ECG A;  4B7Y C;  3L1X A;  2M6M A;  4C9Z A;  1MM2 A;  2OXQ C;  3LVQ E;  4QF2 A;  4WA6 A;  3NG2 A;  2KWO A;  2RSD A;  5LCW B;  1G25 A;  1X4U A;  1DCQ A;  1JM7 A;  4UP5 A;  3M99 A;  4GB0 A;  5B79 A;  4FJC A;  2EGP A;  3FAN A;  5G0F A;  5C11 A;  2RI7 A;  3E2D A;  4YAT A;  5G04 B;  2NAA A;  1JOC A;  1LDJ B;  4LLB A;  1VFY A;  5D1M B;  3N9N A;  1WEV A;  2LAU A;  4YBM A;  2ECV A;  2YQM A;  3RTR B;  2JMI A;  2M13 A;  2HYE D;  2KR4 A;  3GL6 A;  3N9Q A;  3ZVZ B;  1IYM A;  2L75 A;  2C2L A;  1MBM A;  4QQ4 A;  3SOX A;  1JM7 B;  4H9D A;  2VJE B;  4O64 A;  2ECJ A;  4OGC A;  4TKP B;  5H1U A;  3N9P A;  5DKA A;  3O34 A;  2KGI A;  2IDA A;  1WES A;  3FL2 A;  2D8S A;  1F62 A;  1WGM A;  3C5K A;  3V43 A;  2L0B A;  2LQ6 A;  1VYX A;  1WIM A;  4Q6F A;  2FUI A;  3N9O A;  2VPB A;  2FUU A;  5TBN A;  5FB1 A;  1WIL A;  3T9K A;  2ECT A;  2EGM A;  3O35 A;  2E6S A;  3LJU X;  4YBT A;  4A0C D;  2KWK A;  4ZUX U;  4N3W A;  3M63 A;  1RMD A;  4YAX A;  1Z6U A;  3O7A A;  4A4B A;  1WEP A;  4PPE A;  2CKL A;  1WEM A;  2YVR A;  2ECN A;  2G45 A;  2B0O E;  5B8D A;  1FBV A;  3KQI A;  1WEO A;  3DPL R;  2CSV A;  4R2Y A;  4QF3 A;  3VK6 A;  1X4I A;  2CON A;  3HCS A;  2OWA A;  2FD4 A;  1T1H A;  1LDK C;  1X4J A;  3U5M A;  5I3L A;  5FER A;  2Y1N A;  2YSM A;  2YQL A;  2LV9 A;  4GNG A;  4IC2 A;  5AIU A;  4AYC A;  2K17 A;  4MSX A;  2PNX A;  4YBS A;  4V3L C;  2QJ0 A;  2YSJ A;  3ZYQ A;  2KIZ A;  3KV5 A;  2C2V S;  5TDW A;  2LGL A;  2L80 A;  2ECI A;  4N4F A;  4Z0O A;  2MIQ A;  2KGG A;  3C6W A;  5SVI A;  2FFW A;  2RR4 A;  2BAY A;  2CSY A;  2XB1 A;  2JMJ A;  3I2D A;  2MNZ A;  2MNY A;  4LJN A;  2DJA A;  5LKT A;  2P57 A;  2K1J A;  2LN0 A;  5H1V A;  2F6J A;  3L1Z B;  3KV6 A;  3U5N A;  2LGK A;  4L7X A;  2XOC A;  2JMD A;  5EYA F;  4O62 A;  2D8U A;  2MA5 A;  4AYC B;  3L11 A;  5LKX A;  3MDB C;  2JUN A;  2K4D A;  2KWN A;  5H9M A;  2E6R A;  3LVR E;  2L7P A;  4GND A;  2MUM A;  2YYR A;  5SVI B;  2EA6 A;  3GV4 A;  4B86 C;  4XI1 A;  2XOZ A;  4Z0R A;  1E4U A;  5K3Q A;  3FEH A;  3O33 A;  1WE9 A;  3Q1D A;  3M62 A;  1ZBD B;  3PLW A;  5TDR A;  2M1R A;  3ZNI A;  1WEE A;  2KWJ A;  3MHS A;  5TRB A;  1V87 A;  2EXU A;  2QIZ A;  3QZV A;  4LAD B;  2Y1M A;  5KH7 A;  3T6R A;  2XP0 A;  2L5U A;  4GNE A;  3DQV R;  1HYJ A;  4WZ0 A;  3H7H A;  1WEQ A;  4AP4 A;  2JRJ A;  4NN2 A;  2G6Q A;  4MVT A;  2MA6 A;  1WEN A;  5FEY A;  5TAB A;  2VNF A;  3FM8 C;  2Y43 A;  3IHP A;  1N87 A;  3N9L A;  5DIN A;  3LQH A;  3KDE C;  4X3G A;  2L43 A;  2LXP C;  4WZ3 B; 
#chains in the Genus database with same CATH homology
 5LKU A;  3ZPV 1;  5D1K B;  3U5O A;  3KNV A;  3RPG B;  5D1L B;  4IC3 A;  5KH9 A;  4I7D A;  2DX8 A;  5KH3 A;  2ZET C;  5J3X A;  2VJF A;  1Z2Q A;  3HCU A;  4GNF A;  4YAB A;  4AUQ B;  2H0D A;  3O70 A;  4A49 A;  4L58 A;  3RPG C;  2CKL B;  2MD7 B;  4I7C A;  2M3H A;  3LRQ A;  2YW8 A;  2M85 A;  4WZ2 A;  1XWH A;  2KU3 A;  1WEU A;  3ASL A;  2HDP A;  2VPD A;  2F6N A;  3O37 A;  2FSA A;  2VPG A;  3PHD A;  2EOD A;  4ZQL A;  4AVX A;  5B78 A;  5B77 A;  2VJF B;  3U5P A;  2LGG A;  4FO9 A;  4YAD A;  2VJE A;  2YHN A;  4F52 B;  3EB5 A;  4YC9 A;  4R8P K;  2H0D B;  2MT5 A;  4P5O B;  2UZG A;  1Z60 A;  1VD4 A;  4UP0 A;  4W4U A;  2K16 A;  2YUC A;  4FK5 A;  4I7B A;  3SOW A;  2KYU A;  4LKA A;  2XEU A;  1K2F A;  3EB6 A;  3HTK C;  3O36 A;  5C13 A;  3HCT A;  2KE1 A;  4CCG X;  5FB0 A;  3ZTG A;  2PUY A;  3T7L A;  3SHB A;  2I50 A;  2YHO A;  2YU4 A;  1MM3 A;  4ZDT A;  3N9M A;  1BOR A;  5H1T A;  4S3O B;  2AN6 A;  3SOU A;  1WEW A;  4BBQ A;  5B75 A;  5B76 A;  4R7E A;  4A4C A;  2LGV A;  4PTB A;  5JG6 A;  2YUR A;  4V3K C;  2LDR A;  3PUR A;  4CA1 A;  2KFT A;  1WFK A;  2KRE A;  2VPE A;  4LK9 A;  5LKZ A;  2ECW A;  4FIP A;  4BHW A;  4S3O C;  3LQI A;  3LQJ A;  2CT2 A;  2CSZ A;  2G43 A;  2F42 A;  2LRI C;  4UI9 B;  1U6G B;  2LXH C;  1DVP A;  1HYI A;  3PUQ A;  1FP0 A;  2MD8 C;  2YT5 A;  2VP7 A;  2YRE A;  5G05 B;  2QIC A;  3ZVY A;  3ZPV E;  3MHH A;  1CHC A;  5AIT A;  2ECG A;  4B7Y C;  3L1X A;  2M6M A;  4C9Z A;  1MM2 A;  2OXQ C;  4QF2 A;  4WA6 A;  3NG2 A;  2KWO A;  2RSD A;  5LCW B;  1G25 A;  1X4U A;  1JM7 A;  4UP5 A;  3M99 A;  4GB0 A;  5B79 A;  4FJC A;  2EGP A;  5G0F A;  5C11 A;  2RI7 A;  4YAT A;  5G04 B;  2NAA A;  1JOC A;  1LDJ B;  4LLB A;  1VFY A;  5D1M B;  3N9N A;  1WEV A;  4YBM A;  2ECV A;  2YQM A;  3RTR B;  2JMI A;  2HYE D;  2KR4 A;  3GL6 A;  3N9Q A;  3ZVZ B;  1IYM A;  2L75 A;  2C2L A;  3SOX A;  1JM7 B;  2VJE B;  4O64 A;  2ECJ A;  4TKP B;  5H1U A;  3N9P A;  5DKA A;  3O34 A;  2KGI A;  2IDA A;  1WES A;  3FL2 A;  2D8S A;  1F62 A;  1WGM A;  3C5K A;  3V43 A;  2L0B A;  2LQ6 A;  1VYX A;  1WIM A;  4Q6F A;  2FUI A;  3N9O A;  2VPB A;  2FUU A;  5TBN A;  5FB1 A;  1WIL A;  2ECT A;  3O35 A;  2E6S A;  4YBT A;  4A0C D;  2KWK A;  4ZUX U;  4N3W A;  3M63 A;  1RMD A;  4YAX A;  1Z6U A;  3O7A A;  4A4B A;  1WEP A;  4PPE A;  2CKL A;  1WEM A;  2ECN A;  2G45 A;  5B8D A;  1FBV A;  3KQI A;  1WEO A;  3DPL R;  4R2Y A;  4QF3 A;  3VK6 A;  1X4I A;  3HCS A;  1T1H A;  1LDK C;  1X4J A;  3U5M A;  5I3L A;  5FER A;  2Y1N A;  2YSM A;  2YQL A;  2LV9 A;  4GNG A;  4IC2 A;  5AIU A;  4AYC A;  2K17 A;  4MSX A;  2PNX A;  4YBS A;  4V3L C;  2QJ0 A;  2YSJ A;  3ZYQ A;  2KIZ A;  3KV5 A;  5TDW A;  2C2V S;  2LGL A;  2L80 A;  2ECI A;  4N4F A;  2MIQ A;  2KGG A;  3C6W A;  2BAY A;  2CSY A;  2XB1 A;  2JMJ A;  3I2D A;  2MNZ A;  2MNY A;  4LJN A;  5LKT A;  2K1J A;  2LN0 A;  5H1V A;  2F6J A;  3L1Z B;  3KV6 A;  3U5N A;  2LGK A;  4L7X A;  2JMD A;  5EYA F;  2MA5 A;  4AYC B;  3L11 A;  5LKX A;  2K4D A;  2KWN A;  5H9M A;  2E6R A;  4GND A;  2MUM A;  2YYR A;  2EA6 A;  3GV4 A;  4B86 C;  4XI1 A;  1E4U A;  3O33 A;  1WE9 A;  3M62 A;  1ZBD B;  5TDR A;  3ZNI A;  2M1R A;  1WEE A;  2KWJ A;  3MHS A;  5TRB A;  1V87 A;  2QIZ A;  3QZV A;  4LAD B;  2Y1M A;  5KH7 A;  3T6R A;  2L5U A;  4GNE A;  3DQV R;  1HYJ A;  4WZ0 A;  1WEQ A;  4AP4 A;  2JRJ A;  4NN2 A;  2G6Q A;  4MVT A;  2MA6 A;  1WEN A;  5FEY A;  5TAB A;  2VNF A;  2Y43 A;  3IHP A;  1N87 A;  3N9L A;  5DIN A;  3LQH A;  4X3G A;  2L43 A;  2LXP C;  4WZ3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...