1WEVA

Solution structure of phd domain in protein np_082203
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
88
structure length
88
Chain Sequence
GSSGSSGADDFAMEMGLACVVCRQMTVASGNQLVECQECHNLYHQDCHKPQVTDKEVNDPRLVWYCARCTRQMKRMAQKNQKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of PHD domain in protein NP_082203
rcsb
source organism Mus musculus
molecule tags Gene regulation
molecule keywords RIKEN cDNA 1110020M19
total genus 9
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2004-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1wevA01
2LGLA 4FIPA 4YC9A 2K17A 2E6RA 3C6WA 4YBMA 3RPGB 3O35A 3O70A 3N9MA 2VJFA 5H1VA 2YHNA 2ZETC 2ECIA 3I2DA 2LV9A 5B75A 5B79A 2YUCA 2DX8A 4W4UA 2L5UA 2F6NA 1HYIA 4AVXA 4FK5A 2ECWA 2MA5A 3ZPV1 1WEQA 2LGGA 2G45A 4R8PK 5G0FA 3ZVZB 1WIMA 2VPBA 2VJEA 2MIQA 4QF2A 2M6MA 4X3GA 1ZBDB 5B77A 1WEMA 4MVTA 2E6SA 2YHOA 3EB6A 2KR4A 2VNFA 2UZGA 5G05B 3U5NA 2YW8A 4I7BA 4TKPB 3L1XA 2YURA 2KIZA 2M3HA 3LRQA 1X4UA 1WGMA 1V87A 4S3OC 3GV4A 3L1ZB 5D1MB 4WZ0A 3N9NA 1XWHA 3HCUA 5LCWB 2K1JA 3LQJA 4O64A 4GNDA 2LRIC 5KH9A 1N87A 5TABA 2G6QA 3DQVR 3SOUA 2Y1MA 2L43A 3LQHA 5KH3A 4R2YA 1LDKC 1FP0A 2MD8C 3PHDA 1JM7B 2ECJA 2NAAA 4LJNA 2KWKA 2KREA 4UP5A 4P5OB 5H1TA 2C2LA 4B7YC 3N9PA 4AYCB 4CCGX 2JRJA 2VJEB 3M99A 5I3LA 1DVPA 2KGGA 1VD4A 5FB0A 2CT2A 5EYAF 1WILA 1Z6UA 3QZVA 4S3OB 5FEYA 4YBTA 2ECTA 3O33A 1FBVA 4YADA 5G04B 1VFYA 3U5OA 1T1HA 4L7XA 2L75A 3IHPA 2EGPA 4ZQLA 4CA1A 4I7DA 3O7AA 4V3LC 1VYXA 3DPLR 1Z2QA 1Z60A 5AITA 3VK6A 2CSYA 2YT5A 2FUUA 2RSDA 4UP0A 2LGKA 1X4IA 4YABA 1F62A 1IYMA 4NN2A 1WFKA 3N9LA 2QJ0A 2FUIA 1LDJB 4YAXA 2D8SA 1U6GB 3ZNIA 1G25A 2KU3A 2VJFB 1WEEA 2G43A 2JMDA 2LQ6A 2KGIA 2QIZA 5LKUA 4A0CD 2H0DA 3ZVYA 3SOXA 4C9ZA 4F52B 4YATA 2LXHC 3RPGC 2MUMA 2RI7A 1WESA 4A4BA 2QICA 3HTKC 2AN6A 2LN0A 3O37A 3PURA 1JOCA 2IDAA 2M1RA 4QF3A 4LKAA 4YBSA 2KWOA 2LXPC 4L58A 4WA6A 3U5MA 2M85A 2OXQC 2YSJA 4WZ3B 5DKAA 2KWNA 1E4UA 2C2VS 2YYRA 3RTRB 2MT5A 2F42A 2Y1NA 2YSMA 4MSXA 5DINA 3GL6A 4GB0A 5H1UA 2HYED 1RMDA 2JMIA 2I50A 3ASLA 1HYJA 5JG6A 4LLBA 2KYUA 1WE9A 2YU4A 5B76A 2VPDA 3T7LA 2L80A 3M62A 3SOWA 2MA6A 5D1KB 1MM2A 4V3KC 4N3WA 2H0DB 5C11A 3U5PA 2YREA 4IC3A 3KQIA 4AYCA 1WEVA 4XI1A 1BORA 1WEUA 3HCSA 3C5KA 4LADB 3ZTGA 5C13A 2ECVA 2ECNA 3M63A 2EA6A 5LKTA 5D1LB 5FERA 1WENA 5B8DA 2VP7A 2MNYA 3O36A 2KWJA 3KV6A 4GNFA 4B86C 3N9OA 4A49A 3MHSA 2CKLA 5J3XA 3N9QA 2Y43A 2K4DA 2PNXA 2VPEA 5LKXA 2MNZA 3PUQA 4LK9A 2XEUA 4IC2A 3HCTA 3SHBA 4N4FA 1WEOA 4AP4A 4BHWA 3KV5A 1JM7A 4FO9A 2FSAA 3NG2A 2BAYA 2LGVA 2YQLA 3ZYQA 5H9MA 3KNVA 5TRBA 1WEWA 4R7EA 2PUYA 4AUQB 4BBQA 3O34A 2ECGA 4I7CA 1CHCA 5TDWA 4Q6FA 2LDRA 4ZUXU 5TDRA 1X4JA 4UI9B 4A4CA 5TBNA 2KE1A 4FJCA 2L0BA 5LKZA 2VPGA 3V43A 2EODA 3FL2A 4GNGA 1WEPA 2K16A 2F6JA 4PTBA 2MD7B 2XB1A 3EB5A 4ZDTA 2KFTA 2YQMA 2CKLB 5FB1A 4WZ2A 5B78A 5AIUA 2JMJA 3MHHA 2CSZA 4PPEA 3T6RA 3LQIA 2HDPA 3ZPVE 3L11A 1MM3A 1K2FA 5KH7A 4GNEA
chains in the Genus database with same CATH superfamily
2LGLA 4FIPA 4YC9A 2K17A 2E6RA 3C6WA 4YBMA 3RPGB 3O35A 3O70A 3N9MA 3H7HA 2VJFA 5H1VA 2YHNA 2ZETC 3O47A 2ECIA 3I2DA 2LV9A 5B75A 2CONA 5B79A 2YUCA 2DX8A 4W4UA 2L5UA 2F6NA 1HYIA 4AVXA 4FK5A 3FAOA 2ECWA 2MA5A 2XP0A 2CRWA 3ZPV1 1WEQA 2LGGA 4OGEA 2G45A 4R8PK 5G0FA 3ZVZB 1WIMA 2VPBA 4OGCA 2VJEA 2P57A 2MIQA 3LVQE 4QF2A 2M6MA 4X3GA 2JUNA 1ZBDB 5B77A 1WEMA 4MVTA 2E6SA 2YHOA 3EB6A 2KR4A 2VNFA 2MKEA 2UZGA 5G05B 3U5NA 2YW8A 4I7BA 4TKPB 3L1XA 2YURA 2KIZA 2M3HA 3LRQA 1X4UA 1WGMA 1V87A 4S3OC 3GV4A 3LVRE 3L1ZB 2EGMA 3DWDA 5D1MB 4WZ0A 3N9NA 1XWHA 3HCUA 5LCWB 2K1JA 3LQJA 4O64A 4GNDA 2LRIC 1N87A 5KH9A 3DQVR 2G6QA 5TABA 3SOUA 2Y1MA 2L43A 3LQHA 2KKXA 5KH3A 4R2YA 1LDKC 1FP0A 2FFWA 2MD8C 3KDEC 3PHDA 1JM7B 2ECJA 2YVRA 2NAAA 4LJNA 2KWKA 3JUEA 2KREA 4UP5A 4P5OB 5H1TA 2C2LA 4B7YC 3N9PA 4AYCB 3SUBA 4CCGX 2JRJA 2E61A 2VJEB 3M99A 5I3LA 1DVPA 2KGGA 1VD4A 5FB0A 2CT2A 5EYAF 3MDBC 1WILA 1Z6UA 2CSVA 3QZVA 4S3OB 5FEYA 4YBTA 2ECTA 3O33A 1FBVA 4YADA 5G04B 1VFYA 3U5OA 1T1HA 5SVIA 4L7XA 2L75A 3IHPA 2EGPA 5SVYA 4ZQLA 4CA1A 4Z0OA 4I7DA 1MBMA 3O7AA 4V3LC 3PLWA 1VYXA 3DPLR 1Z2QA 1Z60A 3FM8C 5AITA 5SVXA 3VK6A 2CSYA 2YT5A 2FUUA 2RSDA 4UP0A 2LGKA 1X4IA 2D8UA 4YABA 1F62A 1IYMA 4NN2A 1WFKA 3N9LA 2QJ0A 2FUIA 1LDJB 4YAXA 2D8SA 1U6GB 3ZNIA 1G25A 2KU3A 2VJFB 2IQJA 1WEEA 2G43A 2JMDA 2LQ6A 2KGIA 2QIZA 5LKUA 4A0CD 3LJUX 2H0DA 3ZVYA 3SOXA 4C9ZA 4F52B 4YATA 2LXHC 3RPGC 2MUMA 2RI7A 1WESA 4A4BA 2QICA 3HTKC 2AN6A 2LN0A 3O37A 3PURA 1JOCA 2IDAA 5K3QA 2M1RA 4QF3A 4LKAA 4YBSA 4F1PA 2KWOA 2LXPC 4L58A 5SVIB 4WA6A 3U5MA 2M85A 2OXQC 2YSJA 4WZ3B 5DKAA 2KKYA 2KWNA 1E4UA 2C2VS 2YYRA 3M7KA 3RTRB 2MT5A 2F42A 2Y1NA 2YSMA 4MSXA 2B0OE 5DINA 3GL6A 4GB0A 5H1UA 2HYED 1RMDA 2JMIA 2I50A 3ASLA 1HYJA 5JG6A 4LLBA 2KYUA 1WE9A 2YU4A 5B76A 2VPDA 3T7LA 4H9DA 2L80A 3M62A 3SOWA 2XOCA 2MA6A 5D1KB 1MM2A 2EXUA 4V3KC 4N3WA 2H0DB 2FD4A 5C11A 3U5PA 2YREA 2DSMA 3E2DA 4IC3A 3KQIA 4AYCA 1WEVA 4XI1A 1BORA 1WEUA 3HCSA 3C5KA 4LADB 3ZTGA 3FEHA 5C13A 2ECVA 2ECNA 3M63A 2EA6A 3Q1DA 5LKTA 5D1LB 2CRRA 3T9KA 5FERA 1WENA 5B8DA 2VP7A 2MNYA 3O36A 2KWJA 3KV6A 4GNFA 4B86C 3N9OA 4A49A 3MHSA 2CKLA 5J3XA 3N9QA 4Z0RA 2Y43A 2K4DA 2PNXA 2RR4A 2VPEA 5LKXA 2MNZA 3PUQA 4LK9A 2XEUA 2XOZA 4IC2A 3HCTA 3SHBA 4N4FA 1WEOA 4AP4A 4BHWA 2L7PA 3KV5A 1JM7A 1DCQA 3FANA 4FO9A 2FSAA 3NG2A 2BAYA 2LGVA 2YQLA 3ZYQA 5H9MA 3KNVA 4O62A 5TRBA 1WEWA 4R7EA 2PUYA 4AUQB 2JM3A 4BBQA 3O34A 2ECGA 4I7CA 1CHCA 5TDWA 4Q6FA 2LDRA 3DDTA 4ZUXU 2DJAA 5TDRA 1X4JA 4UI9B 4A4CA 2XOYA 5TBNA 2KE1A 4QQ4A 3LDYA 4FJCA 2L0BA 5LKZA 3FJUB 2VPGA 3V43A 2EODA 3FL2A 4GNGA 1WEPA 2K16A 2F6JA 4PTBA 2MD7B 2XB1A 3EB5A 4ZDTA 2KFTA 2YQMA 2CKLB 5FB1A 4WZ2A 5B78A 5AIUA 2JMJA 3MHHA 2CSZA 4PPEA 3T6RA 3LQIA 2M13A 2HDPA 2OWAA 3ZPVE 3L11A 1MM3A 1K2FA 5KH7A 4GNEA 2LAUA
chains in the Genus database with same CATH topology
2LGLA 4FIPA 4YC9A 2K17A 2E6RA 3C6WA 4YBMA 3RPGB 3O35A 3O70A 3N9MA 2VJFA 5H1VA 2YHNA 2ZETC 2ECIA 3I2DA 2LV9A 5B75A 5B79A 2YUCA 2DX8A 4W4UA 2L5UA 2F6NA 1HYIA 4AVXA 4FK5A 2ECWA 2MA5A 3ZPV1 1WEQA 2LGGA 2G45A 4R8PK 5G0FA 3ZVZB 1WIMA 2VPBA 2VJEA 2MIQA 4QF2A 2M6MA 4X3GA 1ZBDB 5B77A 1WEMA 4MVTA 2E6SA 2YHOA 3EB6A 2KR4A 2VNFA 2UZGA 5G05B 3U5NA 2YW8A 4I7BA 4TKPB 3L1XA 2YURA 2KIZA 2M3HA 3LRQA 1X4UA 1WGMA 1V87A 4S3OC 3GV4A 3L1ZB 5D1MB 4WZ0A 3N9NA 1XWHA 3HCUA 5LCWB 2K1JA 3LQJA 4O64A 4GNDA 2LRIC 5KH9A 1N87A 5TABA 2G6QA 3DQVR 3SOUA 2Y1MA 2L43A 3LQHA 5KH3A 4R2YA 1LDKC 1FP0A 2MD8C 3PHDA 1JM7B 2ECJA 2NAAA 4LJNA 2KWKA 2KREA 4UP5A 4P5OB 5H1TA 2C2LA 4B7YC 3N9PA 4AYCB 4CCGX 2JRJA 2VJEB 3M99A 5I3LA 1DVPA 2KGGA 1VD4A 5FB0A 2CT2A 5EYAF 1WILA 1Z6UA 3QZVA 4S3OB 5FEYA 4YBTA 2ECTA 3O33A 1FBVA 4YADA 5G04B 1VFYA 3U5OA 1T1HA 4L7XA 2L75A 3IHPA 2EGPA 4ZQLA 4CA1A 4I7DA 3O7AA 4V3LC 1VYXA 3DPLR 1Z2QA 1Z60A 5AITA 3VK6A 2CSYA 2YT5A 2FUUA 2RSDA 4UP0A 2LGKA 1X4IA 4YABA 1F62A 1IYMA 4NN2A 1WFKA 3N9LA 2QJ0A 2FUIA 1LDJB 4YAXA 2D8SA 1U6GB 3ZNIA 1G25A 2KU3A 2VJFB 1WEEA 2G43A 2JMDA 2LQ6A 2KGIA 2QIZA 5LKUA 4A0CD 2H0DA 3ZVYA 3SOXA 4C9ZA 4F52B 4YATA 2LXHC 3RPGC 2MUMA 2RI7A 1WESA 4A4BA 2QICA 3HTKC 2AN6A 2LN0A 3O37A 3PURA 1JOCA 2IDAA 2M1RA 4QF3A 4LKAA 4YBSA 2KWOA 2LXPC 4L58A 4WA6A 3U5MA 2M85A 2OXQC 2YSJA 4WZ3B 5DKAA 2KWNA 1E4UA 2C2VS 2YYRA 3RTRB 2MT5A 2F42A 2Y1NA 2YSMA 4MSXA 5DINA 3GL6A 4GB0A 5H1UA 2HYED 1RMDA 2JMIA 2I50A 3ASLA 1HYJA 5JG6A 4LLBA 2KYUA 1WE9A 2YU4A 5B76A 2VPDA 3T7LA 2L80A 3M62A 3SOWA 2MA6A 5D1KB 1MM2A 4V3KC 4N3WA 2H0DB 5C11A 3U5PA 2YREA 4IC3A 3KQIA 4AYCA 1WEVA 4XI1A 1BORA 1WEUA 3HCSA 3C5KA 4LADB 3ZTGA 5C13A 2ECVA 2ECNA 3M63A 2EA6A 5LKTA 5D1LB 5FERA 1WENA 5B8DA 2VP7A 2MNYA 3O36A 2KWJA 3KV6A 4GNFA 4B86C 3N9OA 4A49A 3MHSA 2CKLA 5J3XA 3N9QA 2Y43A 2K4DA 2PNXA 2VPEA 5LKXA 2MNZA 3PUQA 4LK9A 2XEUA 4IC2A 3HCTA 3SHBA 4N4FA 1WEOA 4AP4A 4BHWA 3KV5A 1JM7A 4FO9A 2FSAA 3NG2A 2BAYA 2LGVA 2YQLA 3ZYQA 5H9MA 3KNVA 5TRBA 1WEWA 4R7EA 2PUYA 4AUQB 4BBQA 3O34A 2ECGA 4I7CA 1CHCA 5TDWA 4Q6FA 2LDRA 4ZUXU 5TDRA 1X4JA 4UI9B 4A4CA 5TBNA 2KE1A 4FJCA 2L0BA 5LKZA 2VPGA 3V43A 2EODA 3FL2A 4GNGA 1WEPA 2K16A 2F6JA 4PTBA 2MD7B 2XB1A 3EB5A 4ZDTA 2KFTA 2YQMA 2CKLB 5FB1A 4WZ2A 5B78A 5AIUA 2JMJA 3MHHA 2CSZA 4PPEA 3T6RA 3LQIA 2HDPA 3ZPVE 3L11A 1MM3A 1K2FA 5KH7A 4GNEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LGL A;  4FIP A;  4YC9 A;  2K17 A;  2E6R A;  3C6W A;  4YBM A;  3RPG B;  3O35 A;  3O70 A;  3N9M A;  2VJF A;  5H1V A;  2YHN A;  2ZET C;  2ECI A;  3I2D A;  2LV9 A;  5B75 A;  5B79 A;  2YUC A;  2DX8 A;  4W4U A;  2L5U A;  2F6N A;  1HYI A;  4AVX A;  4FK5 A;  2ECW A;  2MA5 A;  3ZPV 1;  1WEQ A;  2LGG A;  2G45 A;  4R8P K;  5G0F A;  3ZVZ B;  1WIM A;  2VPB A;  2VJE A;  2MIQ A;  4QF2 A;  2M6M A;  4X3G A;  1ZBD B;  5B77 A;  1WEM A;  4MVT A;  2E6S A;  2YHO A;  3EB6 A;  2KR4 A;  2VNF A;  2UZG A;  5G05 B;  3U5N A;  2YW8 A;  4I7B A;  4TKP B;  3L1X A;  2YUR A;  2KIZ A;  2M3H A;  3LRQ A;  1X4U A;  1WGM A;  1V87 A;  4S3O C;  3GV4 A;  3L1Z B;  5D1M B;  4WZ0 A;  3N9N A;  1XWH A;  3HCU A;  5LCW B;  2K1J A;  3LQJ A;  4O64 A;  4GND A;  2LRI C;  5KH9 A;  1N87 A;  5TAB A;  2G6Q A;  3DQV R;  3SOU A;  2Y1M A;  2L43 A;  3LQH A;  5KH3 A;  4R2Y A;  1LDK C;  1FP0 A;  2MD8 C;  3PHD A;  1JM7 B;  2ECJ A;  2NAA A;  4LJN A;  2KWK A;  2KRE A;  4UP5 A;  4P5O B;  5H1T A;  2C2L A;  4B7Y C;  3N9P A;  4AYC B;  4CCG X;  2JRJ A;  2VJE B;  3M99 A;  5I3L A;  1DVP A;  2KGG A;  1VD4 A;  5FB0 A;  2CT2 A;  5EYA F;  1WIL A;  1Z6U A;  3QZV A;  4S3O B;  5FEY A;  4YBT A;  2ECT A;  3O33 A;  1FBV A;  4YAD A;  5G04 B;  1VFY A;  3U5O A;  1T1H A;  4L7X A;  2L75 A;  3IHP A;  2EGP A;  4ZQL A;  4CA1 A;  4I7D A;  3O7A A;  4V3L C;  1VYX A;  3DPL R;  1Z2Q A;  1Z60 A;  5AIT A;  3VK6 A;  2CSY A;  2YT5 A;  2FUU A;  2RSD A;  4UP0 A;  2LGK A;  1X4I A;  4YAB A;  1F62 A;  1IYM A;  4NN2 A;  1WFK A;  3N9L A;  2QJ0 A;  2FUI A;  1LDJ B;  4YAX A;  2D8S A;  1U6G B;  3ZNI A;  1G25 A;  2KU3 A;  2VJF B;  1WEE A;  2G43 A;  2JMD A;  2LQ6 A;  2KGI A;  2QIZ A;  5LKU A;  4A0C D;  2H0D A;  3ZVY A;  3SOX A;  4C9Z A;  4F52 B;  4YAT A;  2LXH C;  3RPG C;  2MUM A;  2RI7 A;  1WES A;  4A4B A;  2QIC A;  3HTK C;  2AN6 A;  2LN0 A;  3O37 A;  3PUR A;  1JOC A;  2IDA A;  2M1R A;  4QF3 A;  4LKA A;  4YBS A;  2KWO A;  2LXP C;  4L58 A;  4WA6 A;  3U5M A;  2M85 A;  2OXQ C;  2YSJ A;  4WZ3 B;  5DKA A;  2KWN A;  1E4U A;  2C2V S;  2YYR A;  3RTR B;  2MT5 A;  2F42 A;  2Y1N A;  2YSM A;  4MSX A;  5DIN A;  3GL6 A;  4GB0 A;  5H1U A;  2HYE D;  1RMD A;  2JMI A;  2I50 A;  3ASL A;  1HYJ A;  5JG6 A;  4LLB A;  2KYU A;  1WE9 A;  2YU4 A;  5B76 A;  2VPD A;  3T7L A;  2L80 A;  3M62 A;  3SOW A;  2MA6 A;  5D1K B;  1MM2 A;  4V3K C;  4N3W A;  2H0D B;  5C11 A;  3U5P A;  2YRE A;  4IC3 A;  3KQI A;  4AYC A;  1WEV A;  4XI1 A;  1BOR A;  1WEU A;  3HCS A;  3C5K A;  4LAD B;  3ZTG A;  5C13 A;  2ECV A;  2ECN A;  3M63 A;  2EA6 A;  5LKT A;  5D1L B;  5FER A;  1WEN A;  5B8D A;  2VP7 A;  2MNY A;  3O36 A;  2KWJ A;  3KV6 A;  4GNF A;  4B86 C;  3N9O A;  4A49 A;  3MHS A;  2CKL A;  5J3X A;  3N9Q A;  2Y43 A;  2K4D A;  2PNX A;  2VPE A;  5LKX A;  2MNZ A;  3PUQ A;  4LK9 A;  2XEU A;  4IC2 A;  3HCT A;  3SHB A;  4N4F A;  1WEO A;  4AP4 A;  4BHW A;  3KV5 A;  1JM7 A;  4FO9 A;  2FSA A;  3NG2 A;  2BAY A;  2LGV A;  2YQL A;  3ZYQ A;  5H9M A;  3KNV A;  5TRB A;  1WEW A;  4R7E A;  2PUY A;  4AUQ B;  4BBQ A;  3O34 A;  2ECG A;  4I7C A;  1CHC A;  5TDW A;  4Q6F A;  2LDR A;  4ZUX U;  5TDR A;  1X4J A;  4UI9 B;  4A4C A;  5TBN A;  2KE1 A;  4FJC A;  2L0B A;  5LKZ A;  2VPG A;  3V43 A;  2EOD A;  3FL2 A;  4GNG A;  1WEP A;  2K16 A;  2F6J A;  4PTB A;  2MD7 B;  2XB1 A;  3EB5 A;  4ZDT A;  2KFT A;  2YQM A;  2CKL B;  5FB1 A;  4WZ2 A;  5B78 A;  5AIU A;  2JMJ A;  3MHH A;  2CSZ A;  4PPE A;  3T6R A;  3LQI A;  2HDP A;  3ZPV E;  3L11 A;  1MM3 A;  1K2F A;  5KH7 A;  4GNE A; 
#chains in the Genus database with same CATH topology
 2LGL A;  4FIP A;  4YC9 A;  2K17 A;  2E6R A;  3C6W A;  4YBM A;  3RPG B;  3O35 A;  3O70 A;  3N9M A;  3H7H A;  2VJF A;  5H1V A;  2YHN A;  2ZET C;  3O47 A;  2ECI A;  3I2D A;  2LV9 A;  5B75 A;  2CON A;  5B79 A;  2YUC A;  2DX8 A;  4W4U A;  2L5U A;  2F6N A;  1HYI A;  4AVX A;  4FK5 A;  3FAO A;  2ECW A;  2MA5 A;  2XP0 A;  2CRW A;  3ZPV 1;  1WEQ A;  2LGG A;  4OGE A;  2G45 A;  4R8P K;  5G0F A;  3ZVZ B;  1WIM A;  2VPB A;  4OGC A;  2VJE A;  2P57 A;  2MIQ A;  3LVQ E;  4QF2 A;  2M6M A;  4X3G A;  2JUN A;  1ZBD B;  5B77 A;  1WEM A;  4MVT A;  2E6S A;  2YHO A;  3EB6 A;  2KR4 A;  2VNF A;  2MKE A;  2UZG A;  5G05 B;  3U5N A;  2YW8 A;  4I7B A;  4TKP B;  3L1X A;  2YUR A;  2KIZ A;  2M3H A;  3LRQ A;  1X4U A;  1WGM A;  1V87 A;  4S3O C;  3GV4 A;  3LVR E;  3L1Z B;  2EGM A;  3DWD A;  5D1M B;  4WZ0 A;  3N9N A;  1XWH A;  3HCU A;  5LCW B;  2K1J A;  3LQJ A;  4O64 A;  4GND A;  2LRI C;  1N87 A;  5KH9 A;  3DQV R;  2G6Q A;  5TAB A;  3SOU A;  2Y1M A;  2L43 A;  3LQH A;  2KKX A;  5KH3 A;  4R2Y A;  1LDK C;  1FP0 A;  2FFW A;  2MD8 C;  3KDE C;  3PHD A;  1JM7 B;  2ECJ A;  2YVR A;  2NAA A;  4LJN A;  2KWK A;  3JUE A;  2KRE A;  4UP5 A;  4P5O B;  5H1T A;  2C2L A;  4B7Y C;  3N9P A;  4AYC B;  3SUB A;  4CCG X;  2JRJ A;  2E61 A;  2VJE B;  3M99 A;  5I3L A;  1DVP A;  2KGG A;  1VD4 A;  5FB0 A;  2CT2 A;  5EYA F;  3MDB C;  1WIL A;  1Z6U A;  2CSV A;  3QZV A;  4S3O B;  5FEY A;  4YBT A;  2ECT A;  3O33 A;  1FBV A;  4YAD A;  5G04 B;  1VFY A;  3U5O A;  1T1H A;  5SVI A;  4L7X A;  2L75 A;  3IHP A;  2EGP A;  5SVY A;  4ZQL A;  4CA1 A;  4Z0O A;  4I7D A;  1MBM A;  3O7A A;  4V3L C;  3PLW A;  1VYX A;  3DPL R;  1Z2Q A;  1Z60 A;  3FM8 C;  5AIT A;  5SVX A;  3VK6 A;  2CSY A;  2YT5 A;  2FUU A;  2RSD A;  4UP0 A;  2LGK A;  1X4I A;  2D8U A;  4YAB A;  1F62 A;  1IYM A;  4NN2 A;  1WFK A;  3N9L A;  2QJ0 A;  2FUI A;  1LDJ B;  4YAX A;  2D8S A;  1U6G B;  3ZNI A;  1G25 A;  2KU3 A;  2VJF B;  2IQJ A;  1WEE A;  2G43 A;  2JMD A;  2LQ6 A;  2KGI A;  2QIZ A;  5LKU A;  4A0C D;  3LJU X;  2H0D A;  3ZVY A;  3SOX A;  4C9Z A;  4F52 B;  4YAT A;  2LXH C;  3RPG C;  2MUM A;  2RI7 A;  1WES A;  4A4B A;  2QIC A;  3HTK C;  2AN6 A;  2LN0 A;  3O37 A;  3PUR A;  1JOC A;  2IDA A;  5K3Q A;  2M1R A;  4QF3 A;  4LKA A;  4YBS A;  4F1P A;  2KWO A;  2LXP C;  4L58 A;  5SVI B;  4WA6 A;  3U5M A;  2M85 A;  2OXQ C;  2YSJ A;  4WZ3 B;  5DKA A;  2KKY A;  2KWN A;  1E4U A;  2C2V S;  2YYR A;  3M7K A;  3RTR B;  2MT5 A;  2F42 A;  2Y1N A;  2YSM A;  4MSX A;  2B0O E;  5DIN A;  3GL6 A;  4GB0 A;  5H1U A;  2HYE D;  1RMD A;  2JMI A;  2I50 A;  3ASL A;  1HYJ A;  5JG6 A;  4LLB A;  2KYU A;  1WE9 A;  2YU4 A;  5B76 A;  2VPD A;  3T7L A;  4H9D A;  2L80 A;  3M62 A;  3SOW A;  2XOC A;  2MA6 A;  5D1K B;  1MM2 A;  2EXU A;  4V3K C;  4N3W A;  2H0D B;  2FD4 A;  5C11 A;  3U5P A;  2YRE A;  2DSM A;  3E2D A;  4IC3 A;  3KQI A;  4AYC A;  1WEV A;  4XI1 A;  1BOR A;  1WEU A;  3HCS A;  3C5K A;  4LAD B;  3ZTG A;  3FEH A;  5C13 A;  2ECV A;  2ECN A;  3M63 A;  2EA6 A;  3Q1D A;  5LKT A;  5D1L B;  2CRR A;  3T9K A;  5FER A;  1WEN A;  5B8D A;  2VP7 A;  2MNY A;  3O36 A;  2KWJ A;  3KV6 A;  4GNF A;  4B86 C;  3N9O A;  4A49 A;  3MHS A;  2CKL A;  5J3X A;  3N9Q A;  4Z0R A;  2Y43 A;  2K4D A;  2PNX A;  2RR4 A;  2VPE A;  5LKX A;  2MNZ A;  3PUQ A;  4LK9 A;  2XEU A;  2XOZ A;  4IC2 A;  3HCT A;  3SHB A;  4N4F A;  1WEO A;  4AP4 A;  4BHW A;  2L7P A;  3KV5 A;  1JM7 A;  1DCQ A;  3FAN A;  4FO9 A;  2FSA A;  3NG2 A;  2BAY A;  2LGV A;  2YQL A;  3ZYQ A;  5H9M A;  3KNV A;  4O62 A;  5TRB A;  1WEW A;  4R7E A;  2PUY A;  4AUQ B;  2JM3 A;  4BBQ A;  3O34 A;  2ECG A;  4I7C A;  1CHC A;  5TDW A;  4Q6F A;  2LDR A;  3DDT A;  4ZUX U;  2DJA A;  5TDR A;  1X4J A;  4UI9 B;  4A4C A;  2XOY A;  5TBN A;  2KE1 A;  4QQ4 A;  3LDY A;  4FJC A;  2L0B A;  5LKZ A;  3FJU B;  2VPG A;  3V43 A;  2EOD A;  3FL2 A;  4GNG A;  1WEP A;  2K16 A;  2F6J A;  4PTB A;  2MD7 B;  2XB1 A;  3EB5 A;  4ZDT A;  2KFT A;  2YQM A;  2CKL B;  5FB1 A;  4WZ2 A;  5B78 A;  5AIU A;  2JMJ A;  3MHH A;  2CSZ A;  4PPE A;  3T6R A;  3LQI A;  2M13 A;  2HDP A;  2OWA A;  3ZPV E;  3L11 A;  1MM3 A;  1K2F A;  5KH7 A;  4GNE A;  2LAU A; 
#chains in the Genus database with same CATH homology
 2LGL A;  4FIP A;  4YC9 A;  2K17 A;  2E6R A;  3C6W A;  4YBM A;  3RPG B;  3O35 A;  3O70 A;  3N9M A;  2VJF A;  5H1V A;  2YHN A;  2ZET C;  2ECI A;  3I2D A;  2LV9 A;  5B75 A;  5B79 A;  2YUC A;  2DX8 A;  4W4U A;  2L5U A;  2F6N A;  1HYI A;  4AVX A;  4FK5 A;  2ECW A;  2MA5 A;  3ZPV 1;  1WEQ A;  2LGG A;  2G45 A;  4R8P K;  5G0F A;  3ZVZ B;  1WIM A;  2VPB A;  2VJE A;  2MIQ A;  4QF2 A;  2M6M A;  4X3G A;  1ZBD B;  5B77 A;  1WEM A;  4MVT A;  2E6S A;  2YHO A;  3EB6 A;  2KR4 A;  2VNF A;  2UZG A;  5G05 B;  3U5N A;  2YW8 A;  4I7B A;  4TKP B;  3L1X A;  2YUR A;  2KIZ A;  2M3H A;  3LRQ A;  1X4U A;  1WGM A;  1V87 A;  4S3O C;  3GV4 A;  3L1Z B;  5D1M B;  4WZ0 A;  3N9N A;  1XWH A;  3HCU A;  5LCW B;  2K1J A;  3LQJ A;  4O64 A;  4GND A;  2LRI C;  5KH9 A;  1N87 A;  5TAB A;  2G6Q A;  3DQV R;  3SOU A;  2Y1M A;  2L43 A;  3LQH A;  5KH3 A;  4R2Y A;  1LDK C;  1FP0 A;  2MD8 C;  3PHD A;  1JM7 B;  2ECJ A;  2NAA A;  4LJN A;  2KWK A;  2KRE A;  4UP5 A;  4P5O B;  5H1T A;  2C2L A;  4B7Y C;  3N9P A;  4AYC B;  4CCG X;  2JRJ A;  2VJE B;  3M99 A;  5I3L A;  1DVP A;  2KGG A;  1VD4 A;  5FB0 A;  2CT2 A;  5EYA F;  1WIL A;  1Z6U A;  3QZV A;  4S3O B;  5FEY A;  4YBT A;  2ECT A;  3O33 A;  1FBV A;  4YAD A;  5G04 B;  1VFY A;  3U5O A;  1T1H A;  4L7X A;  2L75 A;  3IHP A;  2EGP A;  4ZQL A;  4CA1 A;  4I7D A;  3O7A A;  4V3L C;  1VYX A;  3DPL R;  1Z2Q A;  1Z60 A;  5AIT A;  3VK6 A;  2CSY A;  2YT5 A;  2FUU A;  2RSD A;  4UP0 A;  2LGK A;  1X4I A;  4YAB A;  1F62 A;  1IYM A;  4NN2 A;  1WFK A;  3N9L A;  2QJ0 A;  2FUI A;  1LDJ B;  4YAX A;  2D8S A;  1U6G B;  3ZNI A;  1G25 A;  2KU3 A;  2VJF B;  1WEE A;  2G43 A;  2JMD A;  2LQ6 A;  2KGI A;  2QIZ A;  5LKU A;  4A0C D;  2H0D A;  3ZVY A;  3SOX A;  4C9Z A;  4F52 B;  4YAT A;  2LXH C;  3RPG C;  2MUM A;  2RI7 A;  1WES A;  4A4B A;  2QIC A;  3HTK C;  2AN6 A;  2LN0 A;  3O37 A;  3PUR A;  1JOC A;  2IDA A;  2M1R A;  4QF3 A;  4LKA A;  4YBS A;  2KWO A;  2LXP C;  4L58 A;  4WA6 A;  3U5M A;  2M85 A;  2OXQ C;  2YSJ A;  4WZ3 B;  5DKA A;  2KWN A;  1E4U A;  2C2V S;  2YYR A;  3RTR B;  2MT5 A;  2F42 A;  2Y1N A;  2YSM A;  4MSX A;  5DIN A;  3GL6 A;  4GB0 A;  5H1U A;  2HYE D;  1RMD A;  2JMI A;  2I50 A;  3ASL A;  1HYJ A;  5JG6 A;  4LLB A;  2KYU A;  1WE9 A;  2YU4 A;  5B76 A;  2VPD A;  3T7L A;  2L80 A;  3M62 A;  3SOW A;  2MA6 A;  5D1K B;  1MM2 A;  4V3K C;  4N3W A;  2H0D B;  5C11 A;  3U5P A;  2YRE A;  4IC3 A;  3KQI A;  4AYC A;  1WEV A;  4XI1 A;  1BOR A;  1WEU A;  3HCS A;  3C5K A;  4LAD B;  3ZTG A;  5C13 A;  2ECV A;  2ECN A;  3M63 A;  2EA6 A;  5LKT A;  5D1L B;  5FER A;  1WEN A;  5B8D A;  2VP7 A;  2MNY A;  3O36 A;  2KWJ A;  3KV6 A;  4GNF A;  4B86 C;  3N9O A;  4A49 A;  3MHS A;  2CKL A;  5J3X A;  3N9Q A;  2Y43 A;  2K4D A;  2PNX A;  2VPE A;  5LKX A;  2MNZ A;  3PUQ A;  4LK9 A;  2XEU A;  4IC2 A;  3HCT A;  3SHB A;  4N4F A;  1WEO A;  4AP4 A;  4BHW A;  3KV5 A;  1JM7 A;  4FO9 A;  2FSA A;  3NG2 A;  2BAY A;  2LGV A;  2YQL A;  3ZYQ A;  5H9M A;  3KNV A;  5TRB A;  1WEW A;  4R7E A;  2PUY A;  4AUQ B;  4BBQ A;  3O34 A;  2ECG A;  4I7C A;  1CHC A;  5TDW A;  4Q6F A;  2LDR A;  4ZUX U;  5TDR A;  1X4J A;  4UI9 B;  4A4C A;  5TBN A;  2KE1 A;  4FJC A;  2L0B A;  5LKZ A;  2VPG A;  3V43 A;  2EOD A;  3FL2 A;  4GNG A;  1WEP A;  2K16 A;  2F6J A;  4PTB A;  2MD7 B;  2XB1 A;  3EB5 A;  4ZDT A;  2KFT A;  2YQM A;  2CKL B;  5FB1 A;  4WZ2 A;  5B78 A;  5AIU A;  2JMJ A;  3MHH A;  2CSZ A;  4PPE A;  3T6R A;  3LQI A;  2HDP A;  3ZPV E;  3L11 A;  1MM3 A;  1K2F A;  5KH7 A;  4GNE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...