1WEVA

Solution structure of phd domain in protein np_082203
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
88
structure length
88
Chain Sequence
GSSGSSGADDFAMEMGLACVVCRQMTVASGNQLVECQECHNLYHQDCHKPQVTDKEVNDPRLVWYCARCTRQMKRMAQKNQKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIKEN cDNA 1110020M19
publication title Solution structure of PHD domain in protein NP_082203
rcsb
source organism Mus musculus
molecule tags Gene regulation
total genus 9
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2004-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1wevA01
2L75A 5KH7A 4GNFA 1X4JA 2MIQA 2VJEA 3M62A 3SHBA 2L80A 2CT2A 1LDJB 5J3XA 2L43A 1N87A 4IC3A 2KWOA 2OXQC 2ZETC 2VJFA 4IC2A 2MT5A 1WEWA 5LKXA 1ZBDB 1WEUA 2LGKA 2LQ6A 2YQMA 2F6JA 3N9OA 4GNGA 3ZVYA 4YATA 4A49A 2IDAA 2KWKA 3SOUA 2YHNA 1WFKA 4MSXA 3O7AA 2MA6A 1WENA 2I50A 4A4BA 5TBNA 1WEMA 4LKAA 4R2YA 2G43A 2VPDA 3RTRB 3PUQA 2ECVA 2YHOA 3MHHA 4ZQLA 5G04B 4AVXA 4WZ3B 3MHSA 3HTKC 4ZUXU 2RI7A 1RMDA 3KV6A 4I7CA 3L1ZB 3N9NA 3M99A 5TDRA 4YBSA 2LN0A 3QZVA 2ECJA 2VPGA 3PHDA 4YBTA 5FEYA 4CCGX 1V87A 5D1KB 1VYXA 2NAAA 1T1HA 4I7DA 2LXPC 1WGMA 2YUCA 5DINA 5G05B 1K2FA 3O34A 1LDKC 4S3OB 2K1JA 2CSYA 4S3OC 3N9PA 2Y1NA 4L7XA 2VPBA 2M3HA 2YU4A 2LXHC 2G45A 3N9QA 2ECGA 2LGLA 4FJCA 2L5UA 5H9MA 2H0DB 1IYMA 2K4DA 4LJNA 5B75A 3I2DA 1CHCA 3ZPV1 1E4UA 5FB1A 3GL6A 5KH3A 3U5NA 2MUMA 4P5OB 2PNXA 1FP0A 2KIZA 4V3LC 4GNDA 1BORA 5D1MB 1Z60A 3N9MA 5LKUA 2H0DA 2HDPA 4YBMA 5TDWA 4AP4A 1VFYA 4PPEA 1X4UA 3HCUA 5LCWB 4YABA 3SOXA 1WEOA 3L1XA 4B7YC 5H1VA 1WILA 3T7LA 2KU3A 4L58A 4BBQA 4R8PK 2QICA 2VNFA 3SOWA 2F42A 2M6MA 3VK6A 3ZVZB 2YREA 3ASLA 3HCSA 2UZGA 1U6GB 4YADA 4B86C 3EB5A 5EYAF 1HYIA 4N3WA 1WEVA 5B79A 1WEQA 2ECNA 3O36A 2LGVA 4QF2A 4ZDTA 4UI9B 1DVPA 2FUIA 5G0FA 4LK9A 2ECWA 2YW8A 3V43A 2EGPA 1JM7B 1G25A 2DX8A 2CKLB 3LQIA 2YSJA 4FIPA 3M63A 1X4IA 3O35A 3IHPA 5TABA 2YYRA 2D8SA 3KQIA 5JG6A 2LGGA 2XEUA 4A0CD 3ZYQA 2KWJA 2CKLA 2VPEA 4WA6A 5DKAA 5FB0A 1VD4A 1WEPA 5LKTA 4UP5A 2PUYA 4C9ZA 2MD8C 3U5OA 2MNYA 2YQLA 4MVTA 3ZTGA 5D1LB 4Q6FA 2F6NA 5I3LA 5C11A 1WE9A 4V3KC 5H1UA 3U5MA 2YT5A 3EB6A 2M85A 3KV5A 1MM3A 3ZPVE 1XWHA 2VP7A 2VJEB 1WESA 3LQJA 3DPLR 4FO9A 2K16A 1MM2A 3ZNIA 2VJFB 5B8DA 5FERA 1HYJA 4WZ2A 2QIZA 2Y1MA 3C5KA 2KGIA 4GB0A 1JOCA 3O33A 1FBVA 1WEEA 4F52B 2BAYA 2KYUA 3GV4A 4FK5A 1Z6UA 2LV9A 5AITA 3LQHA 3N9LA 4LADB 2G6QA 2JMIA 3KNVA 2KFTA 2LRIC 5H1TA 2KGGA 4PTBA 3T6RA 2MD7B 4YAXA 5B77A 4N4FA 5LKZA 2FSAA 2FUUA 1WIMA 5KH9A 3RPGB 3LRQA 3FL2A 3RPGC 5B78A 4NN2A 4AUQB 2MA5A 2C2VS 3O70A 4UP0A 2LDRA 3U5PA 3NG2A 2KREA 2KWNA 4AYCB 4W4UA 2EODA 3O37A 4QF3A 3DQVR 3PURA 2AN6A 2JMDA 1JM7A 2KE1A 2MNZA 3L11A 2JMJA 2C2LA 2EA6A 2E6SA 4CA1A 1F62A 2ECTA 3HCTA 2QJ0A 4YC9A 4LLBA 5TRBA 4AYCA 2KR4A 2RSDA 5AIUA 4A4CA 3C6WA 2YSMA 4O64A 4XI1A 2XB1A 1Z2QA 4WZ0A 2JRJA 2HYED 2M1RA 2Y43A 2YURA 5C13A 2CSZA 4GNEA 5B76A 4R7EA 2E6RA 4I7BA 4TKPB 2ECIA 2L0BA 2K17A 4X3GA 4BHWA
chains in the Genus database with same CATH superfamily
2L75A 3SUBA 5KH7A 4GNFA 1X4JA 2MIQA 2VJEA 3M62A 3SHBA 2L80A 4Z0OA 2CT2A 1LDJB 5J3XA 2L43A 1N87A 4IC3A 2KWOA 3FANA 2OXQC 2ZETC 5SVXA 2VJFA 4IC2A 2MT5A 1WEWA 5LKXA 1ZBDB 1WEUA 2LGKA 2LQ6A 2YQMA 2F6JA 3N9OA 4GNGA 3ZVYA 4YATA 4A49A 2IDAA 2KWKA 3SOUA 3LVQE 2YHNA 1WFKA 4MSXA 2M13A 3O7AA 2MA6A 1WENA 2I50A 4A4BA 5TBNA 1WEMA 3DDTA 4LKAA 4R2YA 2FD4A 2G43A 2VPDA 3RTRB 4F1PA 3PUQA 5SVIB 2ECVA 2YHOA 3MHHA 4ZQLA 5G04B 4AVXA 4WZ3B 3MHSA 3HTKC 4ZUXU 2RI7A 1RMDA 3KV6A 4I7CA 3L1ZB 3N9NA 3M99A 5TDRA 4YBSA 2LN0A 3QZVA 2ECJA 2VPGA 3PHDA 4YBTA 2CONA 5FEYA 3DWDA 4CCGX 1V87A 5D1KB 1VYXA 2NAAA 1T1HA 4I7DA 2LXPC 2MKEA 2FFWA 1WGMA 2YUCA 5DINA 5G05B 1K2FA 3O34A 2RR4A 1LDKC 4S3OB 2K1JA 2KKXA 2CSYA 4S3OC 4OGCA 3N9PA 2Y1NA 4L7XA 2L7PA 2DSMA 2VPBA 2M3HA 2YU4A 2LXHC 2G45A 3N9QA 2ECGA 2LGLA 4FJCA 2L5UA 5H9MA 2H0DB 1IYMA 2K4DA 4LJNA 5B75A 3I2DA 1CHCA 3ZPV1 1E4UA 5FB1A 3GL6A 5KH3A 3U5NA 2MUMA 4P5OB 2PNXA 1FP0A 2KIZA 4V3LC 4QQ4A 4GNDA 1BORA 2OWAA 2XOYA 5D1MB 1Z60A 3N9MA 5LKUA 2H0DA 2HDPA 4YBMA 5TDWA 4AP4A 1VFYA 4PPEA 1X4UA 3HCUA 5LCWB 4YABA 3SOXA 1WEOA 2JUNA 3L1XA 4B7YC 5H1VA 1WILA 3T7LA 2KU3A 4L58A 4BBQA 4R8PK 2QICA 2XP0A 2VNFA 3SOWA 2F42A 2M6MA 3VK6A 3ZVZB 2YREA 3ASLA 3HCSA 2UZGA 1U6GB 4YADA 4B86C 3EB5A 5EYAF 2EXUA 1HYIA 4N3WA 1WEVA 2JM3A 5B79A 1WEQA 2B0OE 2ECNA 3O36A 4QF2A 2LGVA 3FJUB 4ZDTA 2D8UA 4UI9B 1DVPA 2FUIA 5G0FA 4LK9A 2ECWA 2YW8A 3M7KA 3V43A 2EGPA 1JM7B 1G25A 2DX8A 2CKLB 3LQIA 2YSJA 4FIPA 3FM8C 3M63A 1X4IA 3O35A 3IHPA 5TABA 2YYRA 2D8SA 3Q1DA 3KQIA 5JG6A 2LGGA 2XEUA 4A0CD 5SVIA 3ZYQA 2KWJA 2CKLA 2VPEA 4WA6A 5DKAA 5FB0A 1VD4A 1WEPA 3T9KA 4OGEA 5LKTA 4UP5A 2XOCA 3PLWA 2PUYA 4C9ZA 5K3QA 2MD8C 3U5OA 2CRWA 2MNYA 2YQLA 4MVTA 3ZTGA 5D1LB 4Q6FA 5SVYA 2F6NA 5I3LA 5C11A 1WE9A 4V3KC 5H1UA 3U5MA 2YT5A 2CRRA 3EB6A 2M85A 3KV5A 1MM3A 3ZPVE 1XWHA 2VP7A 3LJUX 2VJEB 1WESA 2XOZA 4O62A 3O47A 3LQJA 3DPLR 4FO9A 2K16A 1MM2A 3ZNIA 2VJFB 5B8DA 5FERA 1HYJA 4WZ2A 2QIZA 2Y1MA 3C5KA 2KGIA 4GB0A 3KDEC 1JOCA 3O33A 1FBVA 4Z0RA 1WEEA 2IQJA 4F52B 2BAYA 2KYUA 2DJAA 3GV4A 1DCQA 4FK5A 1Z6UA 2LV9A 5AITA 3MDBC 3LQHA 3N9LA 4LADB 2G6QA 2JMIA 3KNVA 2KFTA 2LRIC 5H1TA 2KGGA 4PTBA 2P57A 3T6RA 2MD7B 4YAXA 5B77A 4N4FA 2KKYA 5LKZA 2FSAA 2FUUA 1WIMA 1MBMA 5KH9A 3RPGB 3LRQA 3FL2A 3RPGC 5B78A 3JUEA 4NN2A 4AUQB 2MA5A 2C2VS 4H9DA 3O70A 4UP0A 2EGMA 2LDRA 3U5PA 3LDYA 3NG2A 2YVRA 2KREA 2KWNA 4AYCB 3LVRE 4W4UA 2EODA 3O37A 4QF3A 3DQVR 3PURA 2AN6A 2JMDA 1JM7A 2KE1A 2MNZA 3L11A 2JMJA 2C2LA 2EA6A 2E6SA 4CA1A 1F62A 3H7HA 2ECTA 3HCTA 2QJ0A 4YC9A 4LLBA 5TRBA 4AYCA 2KR4A 2RSDA 5AIUA 4A4CA 2LAUA 3FEHA 3C6WA 2YSMA 2E61A 4O64A 4XI1A 2XB1A 1Z2QA 3E2DA 4WZ0A 2JRJA 2CSVA 2HYED 2M1RA 2Y43A 2YURA 3FAOA 5C13A 2CSZA 4GNEA 5B76A 4R7EA 2E6RA 4I7BA 4TKPB 2ECIA 2L0BA 2K17A 4X3GA 4BHWA
chains in the Genus database with same CATH topology
2L75A 5KH7A 4GNFA 1X4JA 2MIQA 2VJEA 3M62A 3SHBA 2L80A 2CT2A 1LDJB 5J3XA 2L43A 1N87A 4IC3A 2KWOA 2OXQC 2ZETC 2VJFA 4IC2A 2MT5A 1WEWA 5LKXA 1ZBDB 1WEUA 2LGKA 2LQ6A 2YQMA 2F6JA 3N9OA 4GNGA 3ZVYA 4YATA 4A49A 2IDAA 2KWKA 3SOUA 2YHNA 1WFKA 4MSXA 3O7AA 2MA6A 1WENA 2I50A 4A4BA 5TBNA 1WEMA 4LKAA 4R2YA 2G43A 2VPDA 3RTRB 3PUQA 2ECVA 2YHOA 3MHHA 4ZQLA 5G04B 4AVXA 4WZ3B 3MHSA 3HTKC 4ZUXU 2RI7A 1RMDA 3KV6A 4I7CA 3L1ZB 3N9NA 3M99A 5TDRA 4YBSA 2LN0A 3QZVA 2ECJA 2VPGA 3PHDA 4YBTA 5FEYA 4CCGX 1V87A 5D1KB 1VYXA 2NAAA 1T1HA 4I7DA 2LXPC 1WGMA 2YUCA 5DINA 5G05B 1K2FA 3O34A 1LDKC 4S3OB 2K1JA 2CSYA 4S3OC 3N9PA 2Y1NA 4L7XA 2VPBA 2M3HA 2YU4A 2LXHC 2G45A 3N9QA 2ECGA 2LGLA 4FJCA 2L5UA 5H9MA 2H0DB 1IYMA 2K4DA 4LJNA 5B75A 3I2DA 1CHCA 3ZPV1 1E4UA 5FB1A 3GL6A 5KH3A 3U5NA 2MUMA 4P5OB 2PNXA 1FP0A 2KIZA 4V3LC 4GNDA 1BORA 5D1MB 1Z60A 3N9MA 5LKUA 2H0DA 2HDPA 4YBMA 5TDWA 4AP4A 1VFYA 4PPEA 1X4UA 3HCUA 5LCWB 4YABA 3SOXA 1WEOA 3L1XA 4B7YC 5H1VA 1WILA 3T7LA 2KU3A 4L58A 4BBQA 4R8PK 2QICA 2VNFA 3SOWA 2F42A 2M6MA 3VK6A 3ZVZB 2YREA 3ASLA 3HCSA 2UZGA 1U6GB 4YADA 4B86C 3EB5A 5EYAF 1HYIA 4N3WA 1WEVA 5B79A 1WEQA 2ECNA 3O36A 2LGVA 4QF2A 4ZDTA 4UI9B 1DVPA 2FUIA 5G0FA 4LK9A 2ECWA 2YW8A 3V43A 2EGPA 1JM7B 1G25A 2DX8A 2CKLB 3LQIA 2YSJA 4FIPA 3M63A 1X4IA 3O35A 3IHPA 5TABA 2YYRA 2D8SA 3KQIA 5JG6A 2LGGA 2XEUA 4A0CD 3ZYQA 2KWJA 2CKLA 2VPEA 4WA6A 5DKAA 5FB0A 1VD4A 1WEPA 5LKTA 4UP5A 2PUYA 4C9ZA 2MD8C 3U5OA 2MNYA 2YQLA 4MVTA 3ZTGA 5D1LB 4Q6FA 2F6NA 5I3LA 5C11A 1WE9A 4V3KC 5H1UA 3U5MA 2YT5A 3EB6A 2M85A 3KV5A 1MM3A 3ZPVE 1XWHA 2VP7A 2VJEB 1WESA 3LQJA 3DPLR 4FO9A 2K16A 1MM2A 3ZNIA 2VJFB 5B8DA 5FERA 1HYJA 4WZ2A 2QIZA 2Y1MA 3C5KA 2KGIA 4GB0A 1JOCA 3O33A 1FBVA 1WEEA 4F52B 2BAYA 2KYUA 3GV4A 4FK5A 1Z6UA 2LV9A 5AITA 3LQHA 3N9LA 4LADB 2G6QA 2JMIA 3KNVA 2KFTA 2LRIC 5H1TA 2KGGA 4PTBA 3T6RA 2MD7B 4YAXA 5B77A 4N4FA 5LKZA 2FSAA 2FUUA 1WIMA 5KH9A 3RPGB 3LRQA 3FL2A 3RPGC 5B78A 4NN2A 4AUQB 2MA5A 2C2VS 3O70A 4UP0A 2LDRA 3U5PA 3NG2A 2KREA 2KWNA 4AYCB 4W4UA 2EODA 3O37A 4QF3A 3DQVR 3PURA 2AN6A 2JMDA 1JM7A 2KE1A 2MNZA 3L11A 2JMJA 2C2LA 2EA6A 2E6SA 4CA1A 1F62A 2ECTA 3HCTA 2QJ0A 4YC9A 4LLBA 5TRBA 4AYCA 2KR4A 2RSDA 5AIUA 4A4CA 3C6WA 2YSMA 4O64A 4XI1A 2XB1A 1Z2QA 4WZ0A 2JRJA 2HYED 2M1RA 2Y43A 2YURA 5C13A 2CSZA 4GNEA 5B76A 4R7EA 2E6RA 4I7BA 4TKPB 2ECIA 2L0BA 2K17A 4X3GA 4BHWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L75 A;  5KH7 A;  4GNF A;  1X4J A;  2MIQ A;  2VJE A;  3M62 A;  3SHB A;  2L80 A;  2CT2 A;  1LDJ B;  5J3X A;  2L43 A;  1N87 A;  4IC3 A;  2KWO A;  2OXQ C;  2ZET C;  2VJF A;  4IC2 A;  2MT5 A;  1WEW A;  5LKX A;  1ZBD B;  1WEU A;  2LGK A;  2LQ6 A;  2YQM A;  2F6J A;  3N9O A;  4GNG A;  3ZVY A;  4YAT A;  4A49 A;  2IDA A;  2KWK A;  3SOU A;  2YHN A;  1WFK A;  4MSX A;  3O7A A;  2MA6 A;  1WEN A;  2I50 A;  4A4B A;  5TBN A;  1WEM A;  4LKA A;  4R2Y A;  2G43 A;  2VPD A;  3RTR B;  3PUQ A;  2ECV A;  2YHO A;  3MHH A;  4ZQL A;  5G04 B;  4AVX A;  4WZ3 B;  3MHS A;  3HTK C;  4ZUX U;  2RI7 A;  1RMD A;  3KV6 A;  4I7C A;  3L1Z B;  3N9N A;  3M99 A;  5TDR A;  4YBS A;  2LN0 A;  3QZV A;  2ECJ A;  2VPG A;  3PHD A;  4YBT A;  5FEY A;  4CCG X;  1V87 A;  5D1K B;  1VYX A;  2NAA A;  1T1H A;  4I7D A;  2LXP C;  1WGM A;  2YUC A;  5DIN A;  5G05 B;  1K2F A;  3O34 A;  1LDK C;  4S3O B;  2K1J A;  2CSY A;  4S3O C;  3N9P A;  2Y1N A;  4L7X A;  2VPB A;  2M3H A;  2YU4 A;  2LXH C;  2G45 A;  3N9Q A;  2ECG A;  2LGL A;  4FJC A;  2L5U A;  5H9M A;  2H0D B;  1IYM A;  2K4D A;  4LJN A;  5B75 A;  3I2D A;  1CHC A;  3ZPV 1;  1E4U A;  5FB1 A;  3GL6 A;  5KH3 A;  3U5N A;  2MUM A;  4P5O B;  2PNX A;  1FP0 A;  2KIZ A;  4V3L C;  4GND A;  1BOR A;  5D1M B;  1Z60 A;  3N9M A;  5LKU A;  2H0D A;  2HDP A;  4YBM A;  5TDW A;  4AP4 A;  1VFY A;  4PPE A;  1X4U A;  3HCU A;  5LCW B;  4YAB A;  3SOX A;  1WEO A;  3L1X A;  4B7Y C;  5H1V A;  1WIL A;  3T7L A;  2KU3 A;  4L58 A;  4BBQ A;  4R8P K;  2QIC A;  2VNF A;  3SOW A;  2F42 A;  2M6M A;  3VK6 A;  3ZVZ B;  2YRE A;  3ASL A;  3HCS A;  2UZG A;  1U6G B;  4YAD A;  4B86 C;  3EB5 A;  5EYA F;  1HYI A;  4N3W A;  1WEV A;  5B79 A;  1WEQ A;  2ECN A;  3O36 A;  2LGV A;  4QF2 A;  4ZDT A;  4UI9 B;  1DVP A;  2FUI A;  5G0F A;  4LK9 A;  2ECW A;  2YW8 A;  3V43 A;  2EGP A;  1JM7 B;  1G25 A;  2DX8 A;  2CKL B;  3LQI A;  2YSJ A;  4FIP A;  3M63 A;  1X4I A;  3O35 A;  3IHP A;  5TAB A;  2YYR A;  2D8S A;  3KQI A;  5JG6 A;  2LGG A;  2XEU A;  4A0C D;  3ZYQ A;  2KWJ A;  2CKL A;  2VPE A;  4WA6 A;  5DKA A;  5FB0 A;  1VD4 A;  1WEP A;  5LKT A;  4UP5 A;  2PUY A;  4C9Z A;  2MD8 C;  3U5O A;  2MNY A;  2YQL A;  4MVT A;  3ZTG A;  5D1L B;  4Q6F A;  2F6N A;  5I3L A;  5C11 A;  1WE9 A;  4V3K C;  5H1U A;  3U5M A;  2YT5 A;  3EB6 A;  2M85 A;  3KV5 A;  1MM3 A;  3ZPV E;  1XWH A;  2VP7 A;  2VJE B;  1WES A;  3LQJ A;  3DPL R;  4FO9 A;  2K16 A;  1MM2 A;  3ZNI A;  2VJF B;  5B8D A;  5FER A;  1HYJ A;  4WZ2 A;  2QIZ A;  2Y1M A;  3C5K A;  2KGI A;  4GB0 A;  1JOC A;  3O33 A;  1FBV A;  1WEE A;  4F52 B;  2BAY A;  2KYU A;  3GV4 A;  4FK5 A;  1Z6U A;  2LV9 A;  5AIT A;  3LQH A;  3N9L A;  4LAD B;  2G6Q A;  2JMI A;  3KNV A;  2KFT A;  2LRI C;  5H1T A;  2KGG A;  4PTB A;  3T6R A;  2MD7 B;  4YAX A;  5B77 A;  4N4F A;  5LKZ A;  2FSA A;  2FUU A;  1WIM A;  5KH9 A;  3RPG B;  3LRQ A;  3FL2 A;  3RPG C;  5B78 A;  4NN2 A;  4AUQ B;  2MA5 A;  2C2V S;  3O70 A;  4UP0 A;  2LDR A;  3U5P A;  3NG2 A;  2KRE A;  2KWN A;  4AYC B;  4W4U A;  2EOD A;  3O37 A;  4QF3 A;  3DQV R;  3PUR A;  2AN6 A;  2JMD A;  1JM7 A;  2KE1 A;  2MNZ A;  3L11 A;  2JMJ A;  2C2L A;  2EA6 A;  2E6S A;  4CA1 A;  1F62 A;  2ECT A;  3HCT A;  2QJ0 A;  4YC9 A;  4LLB A;  5TRB A;  4AYC A;  2KR4 A;  2RSD A;  5AIU A;  4A4C A;  3C6W A;  2YSM A;  4O64 A;  4XI1 A;  2XB1 A;  1Z2Q A;  4WZ0 A;  2JRJ A;  2HYE D;  2M1R A;  2Y43 A;  2YUR A;  5C13 A;  2CSZ A;  4GNE A;  5B76 A;  4R7E A;  2E6R A;  4I7B A;  4TKP B;  2ECI A;  2L0B A;  2K17 A;  4X3G A;  4BHW A; 
#chains in the Genus database with same CATH topology
 2L75 A;  3SUB A;  5KH7 A;  4GNF A;  1X4J A;  2MIQ A;  2VJE A;  3M62 A;  3SHB A;  2L80 A;  4Z0O A;  2CT2 A;  1LDJ B;  5J3X A;  2L43 A;  1N87 A;  4IC3 A;  2KWO A;  3FAN A;  2OXQ C;  2ZET C;  5SVX A;  2VJF A;  4IC2 A;  2MT5 A;  1WEW A;  5LKX A;  1ZBD B;  1WEU A;  2LGK A;  2LQ6 A;  2YQM A;  2F6J A;  3N9O A;  4GNG A;  3ZVY A;  4YAT A;  4A49 A;  2IDA A;  2KWK A;  3SOU A;  3LVQ E;  2YHN A;  1WFK A;  4MSX A;  2M13 A;  3O7A A;  2MA6 A;  1WEN A;  2I50 A;  4A4B A;  5TBN A;  1WEM A;  3DDT A;  4LKA A;  4R2Y A;  2FD4 A;  2G43 A;  2VPD A;  3RTR B;  4F1P A;  3PUQ A;  5SVI B;  2ECV A;  2YHO A;  3MHH A;  4ZQL A;  5G04 B;  4AVX A;  4WZ3 B;  3MHS A;  3HTK C;  4ZUX U;  2RI7 A;  1RMD A;  3KV6 A;  4I7C A;  3L1Z B;  3N9N A;  3M99 A;  5TDR A;  4YBS A;  2LN0 A;  3QZV A;  2ECJ A;  2VPG A;  3PHD A;  4YBT A;  2CON A;  5FEY A;  3DWD A;  4CCG X;  1V87 A;  5D1K B;  1VYX A;  2NAA A;  1T1H A;  4I7D A;  2LXP C;  2MKE A;  2FFW A;  1WGM A;  2YUC A;  5DIN A;  5G05 B;  1K2F A;  3O34 A;  2RR4 A;  1LDK C;  4S3O B;  2K1J A;  2KKX A;  2CSY A;  4S3O C;  4OGC A;  3N9P A;  2Y1N A;  4L7X A;  2L7P A;  2DSM A;  2VPB A;  2M3H A;  2YU4 A;  2LXH C;  2G45 A;  3N9Q A;  2ECG A;  2LGL A;  4FJC A;  2L5U A;  5H9M A;  2H0D B;  1IYM A;  2K4D A;  4LJN A;  5B75 A;  3I2D A;  1CHC A;  3ZPV 1;  1E4U A;  5FB1 A;  3GL6 A;  5KH3 A;  3U5N A;  2MUM A;  4P5O B;  2PNX A;  1FP0 A;  2KIZ A;  4V3L C;  4QQ4 A;  4GND A;  1BOR A;  2OWA A;  2XOY A;  5D1M B;  1Z60 A;  3N9M A;  5LKU A;  2H0D A;  2HDP A;  4YBM A;  5TDW A;  4AP4 A;  1VFY A;  4PPE A;  1X4U A;  3HCU A;  5LCW B;  4YAB A;  3SOX A;  1WEO A;  2JUN A;  3L1X A;  4B7Y C;  5H1V A;  1WIL A;  3T7L A;  2KU3 A;  4L58 A;  4BBQ A;  4R8P K;  2QIC A;  2XP0 A;  2VNF A;  3SOW A;  2F42 A;  2M6M A;  3VK6 A;  3ZVZ B;  2YRE A;  3ASL A;  3HCS A;  2UZG A;  1U6G B;  4YAD A;  4B86 C;  3EB5 A;  5EYA F;  2EXU A;  1HYI A;  4N3W A;  1WEV A;  2JM3 A;  5B79 A;  1WEQ A;  2B0O E;  2ECN A;  3O36 A;  4QF2 A;  2LGV A;  3FJU B;  4ZDT A;  2D8U A;  4UI9 B;  1DVP A;  2FUI A;  5G0F A;  4LK9 A;  2ECW A;  2YW8 A;  3M7K A;  3V43 A;  2EGP A;  1JM7 B;  1G25 A;  2DX8 A;  2CKL B;  3LQI A;  2YSJ A;  4FIP A;  3FM8 C;  3M63 A;  1X4I A;  3O35 A;  3IHP A;  5TAB A;  2YYR A;  2D8S A;  3Q1D A;  3KQI A;  5JG6 A;  2LGG A;  2XEU A;  4A0C D;  5SVI A;  3ZYQ A;  2KWJ A;  2CKL A;  2VPE A;  4WA6 A;  5DKA A;  5FB0 A;  1VD4 A;  1WEP A;  3T9K A;  4OGE A;  5LKT A;  4UP5 A;  2XOC A;  3PLW A;  2PUY A;  4C9Z A;  5K3Q A;  2MD8 C;  3U5O A;  2CRW A;  2MNY A;  2YQL A;  4MVT A;  3ZTG A;  5D1L B;  4Q6F A;  5SVY A;  2F6N A;  5I3L A;  5C11 A;  1WE9 A;  4V3K C;  5H1U A;  3U5M A;  2YT5 A;  2CRR A;  3EB6 A;  2M85 A;  3KV5 A;  1MM3 A;  3ZPV E;  1XWH A;  2VP7 A;  3LJU X;  2VJE B;  1WES A;  2XOZ A;  4O62 A;  3O47 A;  3LQJ A;  3DPL R;  4FO9 A;  2K16 A;  1MM2 A;  3ZNI A;  2VJF B;  5B8D A;  5FER A;  1HYJ A;  4WZ2 A;  2QIZ A;  2Y1M A;  3C5K A;  2KGI A;  4GB0 A;  3KDE C;  1JOC A;  3O33 A;  1FBV A;  4Z0R A;  1WEE A;  2IQJ A;  4F52 B;  2BAY A;  2KYU A;  2DJA A;  3GV4 A;  1DCQ A;  4FK5 A;  1Z6U A;  2LV9 A;  5AIT A;  3MDB C;  3LQH A;  3N9L A;  4LAD B;  2G6Q A;  2JMI A;  3KNV A;  2KFT A;  2LRI C;  5H1T A;  2KGG A;  4PTB A;  2P57 A;  3T6R A;  2MD7 B;  4YAX A;  5B77 A;  4N4F A;  2KKY A;  5LKZ A;  2FSA A;  2FUU A;  1WIM A;  1MBM A;  5KH9 A;  3RPG B;  3LRQ A;  3FL2 A;  3RPG C;  5B78 A;  3JUE A;  4NN2 A;  4AUQ B;  2MA5 A;  2C2V S;  4H9D A;  3O70 A;  4UP0 A;  2EGM A;  2LDR A;  3U5P A;  3LDY A;  3NG2 A;  2YVR A;  2KRE A;  2KWN A;  4AYC B;  3LVR E;  4W4U A;  2EOD A;  3O37 A;  4QF3 A;  3DQV R;  3PUR A;  2AN6 A;  2JMD A;  1JM7 A;  2KE1 A;  2MNZ A;  3L11 A;  2JMJ A;  2C2L A;  2EA6 A;  2E6S A;  4CA1 A;  1F62 A;  3H7H A;  2ECT A;  3HCT A;  2QJ0 A;  4YC9 A;  4LLB A;  5TRB A;  4AYC A;  2KR4 A;  2RSD A;  5AIU A;  4A4C A;  2LAU A;  3FEH A;  3C6W A;  2YSM A;  2E61 A;  4O64 A;  4XI1 A;  2XB1 A;  1Z2Q A;  3E2D A;  4WZ0 A;  2JRJ A;  2CSV A;  2HYE D;  2M1R A;  2Y43 A;  2YUR A;  3FAO A;  5C13 A;  2CSZ A;  4GNE A;  5B76 A;  4R7E A;  2E6R A;  4I7B A;  4TKP B;  2ECI A;  2L0B A;  2K17 A;  4X3G A;  4BHW A; 
#chains in the Genus database with same CATH homology
 2L75 A;  5KH7 A;  4GNF A;  1X4J A;  2MIQ A;  2VJE A;  3M62 A;  3SHB A;  2L80 A;  2CT2 A;  1LDJ B;  5J3X A;  2L43 A;  1N87 A;  4IC3 A;  2KWO A;  2OXQ C;  2ZET C;  2VJF A;  4IC2 A;  2MT5 A;  1WEW A;  5LKX A;  1ZBD B;  1WEU A;  2LGK A;  2LQ6 A;  2YQM A;  2F6J A;  3N9O A;  4GNG A;  3ZVY A;  4YAT A;  4A49 A;  2IDA A;  2KWK A;  3SOU A;  2YHN A;  1WFK A;  4MSX A;  3O7A A;  2MA6 A;  1WEN A;  2I50 A;  4A4B A;  5TBN A;  1WEM A;  4LKA A;  4R2Y A;  2G43 A;  2VPD A;  3RTR B;  3PUQ A;  2ECV A;  2YHO A;  3MHH A;  4ZQL A;  5G04 B;  4AVX A;  4WZ3 B;  3MHS A;  3HTK C;  4ZUX U;  2RI7 A;  1RMD A;  3KV6 A;  4I7C A;  3L1Z B;  3N9N A;  3M99 A;  5TDR A;  4YBS A;  2LN0 A;  3QZV A;  2ECJ A;  2VPG A;  3PHD A;  4YBT A;  5FEY A;  4CCG X;  1V87 A;  5D1K B;  1VYX A;  2NAA A;  1T1H A;  4I7D A;  2LXP C;  1WGM A;  2YUC A;  5DIN A;  5G05 B;  1K2F A;  3O34 A;  1LDK C;  4S3O B;  2K1J A;  2CSY A;  4S3O C;  3N9P A;  2Y1N A;  4L7X A;  2VPB A;  2M3H A;  2YU4 A;  2LXH C;  2G45 A;  3N9Q A;  2ECG A;  2LGL A;  4FJC A;  2L5U A;  5H9M A;  2H0D B;  1IYM A;  2K4D A;  4LJN A;  5B75 A;  3I2D A;  1CHC A;  3ZPV 1;  1E4U A;  5FB1 A;  3GL6 A;  5KH3 A;  3U5N A;  2MUM A;  4P5O B;  2PNX A;  1FP0 A;  2KIZ A;  4V3L C;  4GND A;  1BOR A;  5D1M B;  1Z60 A;  3N9M A;  5LKU A;  2H0D A;  2HDP A;  4YBM A;  5TDW A;  4AP4 A;  1VFY A;  4PPE A;  1X4U A;  3HCU A;  5LCW B;  4YAB A;  3SOX A;  1WEO A;  3L1X A;  4B7Y C;  5H1V A;  1WIL A;  3T7L A;  2KU3 A;  4L58 A;  4BBQ A;  4R8P K;  2QIC A;  2VNF A;  3SOW A;  2F42 A;  2M6M A;  3VK6 A;  3ZVZ B;  2YRE A;  3ASL A;  3HCS A;  2UZG A;  1U6G B;  4YAD A;  4B86 C;  3EB5 A;  5EYA F;  1HYI A;  4N3W A;  1WEV A;  5B79 A;  1WEQ A;  2ECN A;  3O36 A;  2LGV A;  4QF2 A;  4ZDT A;  4UI9 B;  1DVP A;  2FUI A;  5G0F A;  4LK9 A;  2ECW A;  2YW8 A;  3V43 A;  2EGP A;  1JM7 B;  1G25 A;  2DX8 A;  2CKL B;  3LQI A;  2YSJ A;  4FIP A;  3M63 A;  1X4I A;  3O35 A;  3IHP A;  5TAB A;  2YYR A;  2D8S A;  3KQI A;  5JG6 A;  2LGG A;  2XEU A;  4A0C D;  3ZYQ A;  2KWJ A;  2CKL A;  2VPE A;  4WA6 A;  5DKA A;  5FB0 A;  1VD4 A;  1WEP A;  5LKT A;  4UP5 A;  2PUY A;  4C9Z A;  2MD8 C;  3U5O A;  2MNY A;  2YQL A;  4MVT A;  3ZTG A;  5D1L B;  4Q6F A;  2F6N A;  5I3L A;  5C11 A;  1WE9 A;  4V3K C;  5H1U A;  3U5M A;  2YT5 A;  3EB6 A;  2M85 A;  3KV5 A;  1MM3 A;  3ZPV E;  1XWH A;  2VP7 A;  2VJE B;  1WES A;  3LQJ A;  3DPL R;  4FO9 A;  2K16 A;  1MM2 A;  3ZNI A;  2VJF B;  5B8D A;  5FER A;  1HYJ A;  4WZ2 A;  2QIZ A;  2Y1M A;  3C5K A;  2KGI A;  4GB0 A;  1JOC A;  3O33 A;  1FBV A;  1WEE A;  4F52 B;  2BAY A;  2KYU A;  3GV4 A;  4FK5 A;  1Z6U A;  2LV9 A;  5AIT A;  3LQH A;  3N9L A;  4LAD B;  2G6Q A;  2JMI A;  3KNV A;  2KFT A;  2LRI C;  5H1T A;  2KGG A;  4PTB A;  3T6R A;  2MD7 B;  4YAX A;  5B77 A;  4N4F A;  5LKZ A;  2FSA A;  2FUU A;  1WIM A;  5KH9 A;  3RPG B;  3LRQ A;  3FL2 A;  3RPG C;  5B78 A;  4NN2 A;  4AUQ B;  2MA5 A;  2C2V S;  3O70 A;  4UP0 A;  2LDR A;  3U5P A;  3NG2 A;  2KRE A;  2KWN A;  4AYC B;  4W4U A;  2EOD A;  3O37 A;  4QF3 A;  3DQV R;  3PUR A;  2AN6 A;  2JMD A;  1JM7 A;  2KE1 A;  2MNZ A;  3L11 A;  2JMJ A;  2C2L A;  2EA6 A;  2E6S A;  4CA1 A;  1F62 A;  2ECT A;  3HCT A;  2QJ0 A;  4YC9 A;  4LLB A;  5TRB A;  4AYC A;  2KR4 A;  2RSD A;  5AIU A;  4A4C A;  3C6W A;  2YSM A;  4O64 A;  4XI1 A;  2XB1 A;  1Z2Q A;  4WZ0 A;  2JRJ A;  2HYE D;  2M1R A;  2Y43 A;  2YUR A;  5C13 A;  2CSZ A;  4GNE A;  5B76 A;  4R7E A;  2E6R A;  4I7B A;  4TKP B;  2ECI A;  2L0B A;  2K17 A;  4X3G A;  4BHW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...