1WEVA

Solution structure of phd domain in protein np_082203
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
88
structure length
88
Chain Sequence
GSSGSSGADDFAMEMGLACVVCRQMTVASGNQLVECQECHNLYHQDCHKPQVTDKEVNDPRLVWYCARCTRQMKRMAQKNQKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of PHD domain in protein NP_082203
rcsb
source organism Mus musculus
molecule tags Gene regulation
molecule keywords RIKEN cDNA 1110020M19
total genus 9
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2004-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1wevA01
2F42A 4UP5A 2MA6A 3LQIA 4AP4A 1K2FA 4I7DA 5B8DA 4AUQB 4BBQA 3ZTGA 2CT2A 2MD7B 1HYJA 4LK9A 3ZPV1 4GB0A 2CSYA 5KH3A 3C6WA 5TRBA 2KWNA 3SOXA 2XB1A 2LGGA 2PNXA 2K1JA 4L58A 1RMDA 2ECTA 3ZNIA 1MM3A 2LGKA 3KV6A 5KH9A 5H1UA 2EGPA 1LDKC 2M1RA 5AIUA 2H0DA 2G43A 5LKXA 2F6NA 3PURA 5B76A 4BHWA 4S3OB 3PUQA 4YBMA 4R7EA 3SOUA 2QJ0A 2MA5A 4QF2A 2YQMA 2Y1MA 2YQLA 2JMDA 5J3XA 1U6GB 3N9NA 2L43A 2YSMA 2E6SA 2G6QA 2LDRA 3EB5A 4WZ3B 2KFTA 2KREA 5G0FA 2KGGA 4X3GA 3M99A 5LKUA 4ZDTA 2FUIA 2LRIC 3L11A 5LCWB 5I3LA 2ECJA 2Y43A 3MHHA 4MSXA 2KE1A 2VJEB 2VJEA 3U5NA 1WFKA 4NN2A 3KNVA 2VJFA 4IC3A 1HYIA 2JMIA 5FERA 2C2LA 5DKAA 4N3WA 3DQVR 3PHDA 5C11A 4YC9A 2DX8A 5B75A 3O36A 4AVXA 2VPDA 2VP7A 4O64A 2YHOA 1DVPA 4P5OB 4ZQLA 4MVTA 4B86C 2LXPC 1ZBDB 4IC2A 4L7XA 1WEQA 2D8SA 2AN6A 2YYRA 4F52B 3ASLA 3O34A 1WGMA 4WZ2A 2LQ6A 1WEPA 2H0DB 1WEEA 1Z2QA 3N9LA 5H9MA 2LV9A 2KWJA 4R8PK 4PPEA 4GNDA 3GV4A 1X4JA 5KH7A 1WILA 2YUCA 2L75A 2RI7A 2C2VS 1JM7B 4ZUXU 2FSAA 3IHPA 2KIZA 4LJNA 1FP0A 4Q6FA 2MT5A 5H1VA 2MD8C 2NAAA 1X4UA 2Y1NA 5TABA 4B7YC 1WE9A 2VNFA 5FB0A 3RPGB 3U5PA 4R2YA 5TBNA 2CSZA 2KYUA 4YABA 2HDPA 1X4IA 3FL2A 3HCUA 5B79A 4W4UA 1WEMA 4WZ0A 4XI1A 3SHBA 2M3HA 4A49A 4I7CA 4AYCB 2FUUA 3LRQA 5B78A 4AYCA 3NG2A 2PUYA 5LKTA 1CHCA 3U5MA 1XWHA 4LKAA 3U5OA 2YW8A 1N87A 4I7BA 2QIZA 2M6MA 3M63A 3T6RA 3ZVZB 3T7LA 4TKPB 3C5KA 2CKLB 3N9MA 2I50A 5D1LB 4YBTA 5G05B 3SOWA 1WIMA 1JOCA 2JRJA 4YBSA 2K4DA 3L1ZB 3QZVA 5LKZA 2YREA 2IDAA 2YU4A 2YHNA 1WEWA 3ZYQA 2VPGA 3O35A 3M62A 2LGLA 3RTRB 2G45A 2VJFB 3O37A 5FB1A 2EODA 1WEUA 3O7AA 2KWKA 5G04B 3V43A 3HCSA 4UP0A 2ECNA 2F6JA 2M85A 2XEUA 4UI9B 2L5UA 2MNYA 4YADA 2YT5A 5EYAF 3L1XA 2ZETC 1F62A 4YAXA 3LQHA 4A0CD 3N9QA 4GNFA 1WENA 1MM2A 1WEOA 1WESA 4LADB 2KU3A 1VYXA 1VD4A 5B77A 2BAYA 3HTKC 2ECVA 4V3KC 5AITA 4PTBA 2K17A 4C9ZA 5TDWA 2LN0A 3KV5A 4S3OC 5D1KB 5JG6A 2RSDA 4FO9A 2MUMA 2ECIA 3HCTA 2KGIA 2YURA 3RPGC 4FIPA 2KR4A 2L80A 2ECWA 2LGVA 3KQIA 3EB6A 4QF3A 4LLBA 2VPBA 1JM7A 1Z60A 1T1HA 2HYED 2VPEA 5H1TA 2L0BA 4N4FA 1WEVA 2QICA 2JMJA 2MIQA 4FJCA 4V3LC 5D1MB 3N9OA 2LXHC 4CA1A 3O70A 2OXQC 3MHSA 2EA6A 3ZVYA 3ZPVE 2KWOA 4FK5A 3LQJA 1VFYA 4CCGX 2E6RA 2CKLA 2MNZA 3I2DA 5DINA 5TDRA 3VK6A 1G25A 4A4BA 3DPLR 1IYMA 1BORA 1E4UA 2YSJA 5C13A 1V87A 3N9PA 4GNEA 1Z6UA 1LDJB 2K16A 5FEYA 3O33A 4GNGA 1FBVA 4A4CA 2ECGA 4WA6A 2UZGA 3GL6A 4YATA
chains in the Genus database with same CATH superfamily
2F42A 4UP5A 2MA6A 3LQIA 4AP4A 5K3QA 1K2FA 4I7DA 5B8DA 4AUQB 4BBQA 3ZTGA 2CT2A 2MD7B 1HYJA 4LK9A 3ZPV1 4GB0A 2CSYA 5KH3A 3C6WA 5TRBA 2KWNA 3SOXA 2XB1A 2LGGA 2PNXA 2K1JA 4L58A 1RMDA 2ECTA 3ZNIA 1MM3A 2LGKA 3KV6A 5KH9A 5H1UA 2EGPA 1LDKC 2M1RA 5AIUA 2H0DA 2G43A 5LKXA 2F6NA 3PURA 5B76A 4BHWA 4S3OB 3PUQA 1DCQA 4YBMA 4OGCA 4R7EA 3FM8C 3SOUA 2QJ0A 2MA5A 4QF2A 2YQMA 2Y1MA 2YQLA 2JMDA 5J3XA 1U6GB 3N9NA 2L43A 2YSMA 2E6SA 2G6QA 3PLWA 2LDRA 3DWDA 3EB5A 4WZ3B 2KFTA 2KREA 5G0FA 2KGGA 4X3GA 3M99A 5LKUA 2DSMA 4ZDTA 2FUIA 2LRIC 3L11A 5LCWB 5I3LA 2ECJA 2Y43A 3MHHA 4MSXA 2KE1A 2VJEB 2VJEA 3U5NA 1WFKA 4NN2A 3KNVA 2VJFA 2FD4A 4IC3A 1HYIA 3JUEA 2XP0A 2JMIA 5FERA 2C2LA 5DKAA 4N3WA 3DQVR 3PHDA 5C11A 4YC9A 2DX8A 5B75A 3O36A 4AVXA 2VPDA 3E2DA 2VP7A 4O64A 2YHOA 1DVPA 4P5OB 3FANA 4ZQLA 4MVTA 4B86C 2LXPC 2YVRA 1ZBDB 4IC2A 4L7XA 1WEQA 2D8SA 4OGEA 2AN6A 3M7KA 2YYRA 4F52B 3ASLA 3O34A 1WGMA 4WZ2A 2LQ6A 1WEPA 2H0DB 1WEEA 1Z2QA 3LVQE 3N9LA 5H9MA 2LV9A 2KWJA 5SVYA 4R8PK 4PPEA 4GNDA 3GV4A 1X4JA 5KH7A 1WILA 2YUCA 2L75A 3LDYA 2RI7A 3Q1DA 2C2VS 1JM7B 4ZUXU 2FSAA 3IHPA 2KIZA 4LJNA 1FP0A 4Q6FA 2MT5A 5H1VA 2MD8C 3FAOA 2NAAA 1X4UA 2Y1NA 5TABA 2KKXA 2D8UA 4B7YC 1WE9A 2VNFA 2CRWA 5FB0A 3RPGB 3U5PA 2LAUA 4R2YA 5TBNA 2CSZA 2KYUA 2HDPA 4YABA 1X4IA 3FL2A 3HCUA 5B79A 2XOZA 4W4UA 3FEHA 1WEMA 4WZ0A 4XI1A 3SHBA 2M3HA 4A49A 4I7CA 4AYCB 2FUUA 3LRQA 5B78A 4AYCA 3NG2A 2PUYA 5LKTA 1CHCA 3U5MA 2OWAA 1XWHA 4LKAA 3U5OA 2YW8A 1N87A 4I7BA 2QIZA 2M6MA 3M63A 2CONA 3T6RA 3ZVZB 3T7LA 4TKPB 3C5KA 2DJAA 2CKLB 3N9MA 2I50A 2L7PA 3LJUX 5D1LB 2M13A 4YBTA 2MKEA 5G05B 3SOWA 1WIMA 1JOCA 2JRJA 2XOCA 4YBSA 2K4DA 3L1ZB 3QZVA 5LKZA 2YREA 2IDAA 2YU4A 2YHNA 5SVIA 1WEWA 3ZYQA 2VPGA 3O35A 3M62A 2LGLA 3RTRB 2G45A 2VJFB 3O37A 5FB1A 2EODA 1WEUA 3O7AA 2KWKA 2JUNA 5G04B 3V43A 3HCSA 3T9KA 4UP0A 2ECNA 2F6JA 2M85A 4Z0RA 2XEUA 3H7HA 4UI9B 2L5UA 2MNYA 4YADA 2FFWA 2YT5A 3DDTA 5EYAF 3L1XA 3LVRE 2P57A 2ZETC 1F62A 2E61A 1MBMA 4YAXA 3LQHA 4A0CD 3N9QA 4GNFA 1WENA 1MM2A 1WEOA 1WESA 4LADB 2KU3A 1VYXA 1VD4A 5B77A 2BAYA 3HTKC 2ECVA 4V3KC 5AITA 4F1PA 4PTBA 2K17A 4C9ZA 2CRRA 5TDWA 2LN0A 3KV5A 4S3OC 5D1KB 5JG6A 2RSDA 4FO9A 2MUMA 2ECIA 3FJUB 3HCTA 2KGIA 4H9DA 2YURA 3RPGC 4FIPA 4QQ4A 2KR4A 2L80A 2ECWA 2LGVA 2B0OE 3KQIA 3EB6A 5SVIB 4QF3A 4LLBA 2VPBA 5SVXA 1JM7A 2CSVA 1Z60A 1T1HA 2HYED 2EXUA 2VPEA 5H1TA 2L0BA 4N4FA 1WEVA 2IQJA 2QICA 2JMJA 2MIQA 4FJCA 4V3LC 5D1MB 4Z0OA 2XOYA 2KKYA 3N9OA 2LXHC 4CA1A 3O70A 2OXQC 3MHSA 2EA6A 3ZVYA 2EGMA 2KWOA 3ZPVE 4FK5A 3LQJA 1VFYA 4CCGX 2E6RA 2CKLA 2MNZA 3I2DA 5DINA 5TDRA 3VK6A 2JM3A 1G25A 3SUBA 4A4BA 3DPLR 1IYMA 1BORA 3KDEC 1E4UA 2YSJA 5C13A 1V87A 3N9PA 4GNEA 1Z6UA 4O62A 1LDJB 2K16A 5FEYA 3O33A 4GNGA 2RR4A 1FBVA 4A4CA 3O47A 2ECGA 4WA6A 2UZGA 3GL6A 3MDBC 4YATA
chains in the Genus database with same CATH topology
2F42A 4UP5A 2MA6A 3LQIA 4AP4A 1K2FA 4I7DA 5B8DA 4AUQB 4BBQA 3ZTGA 2CT2A 2MD7B 1HYJA 4LK9A 3ZPV1 4GB0A 2CSYA 5KH3A 3C6WA 5TRBA 2KWNA 3SOXA 2XB1A 2LGGA 2PNXA 2K1JA 4L58A 1RMDA 2ECTA 3ZNIA 1MM3A 2LGKA 3KV6A 5KH9A 5H1UA 2EGPA 1LDKC 2M1RA 5AIUA 2H0DA 2G43A 5LKXA 2F6NA 3PURA 5B76A 4BHWA 4S3OB 3PUQA 4YBMA 4R7EA 3SOUA 2QJ0A 2MA5A 4QF2A 2YQMA 2Y1MA 2YQLA 2JMDA 5J3XA 1U6GB 3N9NA 2L43A 2YSMA 2E6SA 2G6QA 2LDRA 3EB5A 4WZ3B 2KFTA 2KREA 5G0FA 2KGGA 4X3GA 3M99A 5LKUA 4ZDTA 2FUIA 2LRIC 3L11A 5LCWB 5I3LA 2ECJA 2Y43A 3MHHA 4MSXA 2KE1A 2VJEB 2VJEA 3U5NA 1WFKA 4NN2A 3KNVA 2VJFA 4IC3A 1HYIA 2JMIA 5FERA 2C2LA 5DKAA 4N3WA 3DQVR 3PHDA 5C11A 4YC9A 2DX8A 5B75A 3O36A 4AVXA 2VPDA 2VP7A 4O64A 2YHOA 1DVPA 4P5OB 4ZQLA 4MVTA 4B86C 2LXPC 1ZBDB 4IC2A 4L7XA 1WEQA 2D8SA 2AN6A 2YYRA 4F52B 3ASLA 3O34A 1WGMA 4WZ2A 2LQ6A 1WEPA 2H0DB 1WEEA 1Z2QA 3N9LA 5H9MA 2LV9A 2KWJA 4R8PK 4PPEA 4GNDA 3GV4A 1X4JA 5KH7A 1WILA 2YUCA 2L75A 2RI7A 2C2VS 1JM7B 4ZUXU 2FSAA 3IHPA 2KIZA 4LJNA 1FP0A 4Q6FA 2MT5A 5H1VA 2MD8C 2NAAA 1X4UA 2Y1NA 5TABA 4B7YC 1WE9A 2VNFA 5FB0A 3RPGB 3U5PA 4R2YA 5TBNA 2CSZA 2KYUA 4YABA 2HDPA 1X4IA 3FL2A 3HCUA 5B79A 4W4UA 1WEMA 4WZ0A 4XI1A 3SHBA 2M3HA 4A49A 4I7CA 4AYCB 2FUUA 3LRQA 5B78A 4AYCA 3NG2A 2PUYA 5LKTA 1CHCA 3U5MA 1XWHA 4LKAA 3U5OA 2YW8A 1N87A 4I7BA 2QIZA 2M6MA 3M63A 3T6RA 3ZVZB 3T7LA 4TKPB 3C5KA 2CKLB 3N9MA 2I50A 5D1LB 4YBTA 5G05B 3SOWA 1WIMA 1JOCA 2JRJA 4YBSA 2K4DA 3L1ZB 3QZVA 5LKZA 2YREA 2IDAA 2YU4A 2YHNA 1WEWA 3ZYQA 2VPGA 3O35A 3M62A 2LGLA 3RTRB 2G45A 2VJFB 3O37A 5FB1A 2EODA 1WEUA 3O7AA 2KWKA 5G04B 3V43A 3HCSA 4UP0A 2ECNA 2F6JA 2M85A 2XEUA 4UI9B 2L5UA 2MNYA 4YADA 2YT5A 5EYAF 3L1XA 2ZETC 1F62A 4YAXA 3LQHA 4A0CD 3N9QA 4GNFA 1WENA 1MM2A 1WEOA 1WESA 4LADB 2KU3A 1VYXA 1VD4A 5B77A 2BAYA 3HTKC 2ECVA 4V3KC 5AITA 4PTBA 2K17A 4C9ZA 5TDWA 2LN0A 3KV5A 4S3OC 5D1KB 5JG6A 2RSDA 4FO9A 2MUMA 2ECIA 3HCTA 2KGIA 2YURA 3RPGC 4FIPA 2KR4A 2L80A 2ECWA 2LGVA 3KQIA 3EB6A 4QF3A 4LLBA 2VPBA 1JM7A 1Z60A 1T1HA 2HYED 2VPEA 5H1TA 2L0BA 4N4FA 1WEVA 2QICA 2JMJA 2MIQA 4FJCA 4V3LC 5D1MB 3N9OA 2LXHC 4CA1A 3O70A 2OXQC 3MHSA 2EA6A 3ZVYA 3ZPVE 2KWOA 4FK5A 3LQJA 1VFYA 4CCGX 2E6RA 2CKLA 2MNZA 3I2DA 5DINA 5TDRA 3VK6A 1G25A 4A4BA 3DPLR 1IYMA 1BORA 1E4UA 2YSJA 5C13A 1V87A 3N9PA 4GNEA 1Z6UA 1LDJB 2K16A 5FEYA 3O33A 4GNGA 1FBVA 4A4CA 2ECGA 4WA6A 2UZGA 3GL6A 4YATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F42 A;  4UP5 A;  2MA6 A;  3LQI A;  4AP4 A;  1K2F A;  4I7D A;  5B8D A;  4AUQ B;  4BBQ A;  3ZTG A;  2CT2 A;  2MD7 B;  1HYJ A;  4LK9 A;  3ZPV 1;  4GB0 A;  2CSY A;  5KH3 A;  3C6W A;  5TRB A;  2KWN A;  3SOX A;  2XB1 A;  2LGG A;  2PNX A;  2K1J A;  4L58 A;  1RMD A;  2ECT A;  3ZNI A;  1MM3 A;  2LGK A;  3KV6 A;  5KH9 A;  5H1U A;  2EGP A;  1LDK C;  2M1R A;  5AIU A;  2H0D A;  2G43 A;  5LKX A;  2F6N A;  3PUR A;  5B76 A;  4BHW A;  4S3O B;  3PUQ A;  4YBM A;  4R7E A;  3SOU A;  2QJ0 A;  2MA5 A;  4QF2 A;  2YQM A;  2Y1M A;  2YQL A;  2JMD A;  5J3X A;  1U6G B;  3N9N A;  2L43 A;  2YSM A;  2E6S A;  2G6Q A;  2LDR A;  3EB5 A;  4WZ3 B;  2KFT A;  2KRE A;  5G0F A;  2KGG A;  4X3G A;  3M99 A;  5LKU A;  4ZDT A;  2FUI A;  2LRI C;  3L11 A;  5LCW B;  5I3L A;  2ECJ A;  2Y43 A;  3MHH A;  4MSX A;  2KE1 A;  2VJE B;  2VJE A;  3U5N A;  1WFK A;  4NN2 A;  3KNV A;  2VJF A;  4IC3 A;  1HYI A;  2JMI A;  5FER A;  2C2L A;  5DKA A;  4N3W A;  3DQV R;  3PHD A;  5C11 A;  4YC9 A;  2DX8 A;  5B75 A;  3O36 A;  4AVX A;  2VPD A;  2VP7 A;  4O64 A;  2YHO A;  1DVP A;  4P5O B;  4ZQL A;  4MVT A;  4B86 C;  2LXP C;  1ZBD B;  4IC2 A;  4L7X A;  1WEQ A;  2D8S A;  2AN6 A;  2YYR A;  4F52 B;  3ASL A;  3O34 A;  1WGM A;  4WZ2 A;  2LQ6 A;  1WEP A;  2H0D B;  1WEE A;  1Z2Q A;  3N9L A;  5H9M A;  2LV9 A;  2KWJ A;  4R8P K;  4PPE A;  4GND A;  3GV4 A;  1X4J A;  5KH7 A;  1WIL A;  2YUC A;  2L75 A;  2RI7 A;  2C2V S;  1JM7 B;  4ZUX U;  2FSA A;  3IHP A;  2KIZ A;  4LJN A;  1FP0 A;  4Q6F A;  2MT5 A;  5H1V A;  2MD8 C;  2NAA A;  1X4U A;  2Y1N A;  5TAB A;  4B7Y C;  1WE9 A;  2VNF A;  5FB0 A;  3RPG B;  3U5P A;  4R2Y A;  5TBN A;  2CSZ A;  2KYU A;  4YAB A;  2HDP A;  1X4I A;  3FL2 A;  3HCU A;  5B79 A;  4W4U A;  1WEM A;  4WZ0 A;  4XI1 A;  3SHB A;  2M3H A;  4A49 A;  4I7C A;  4AYC B;  2FUU A;  3LRQ A;  5B78 A;  4AYC A;  3NG2 A;  2PUY A;  5LKT A;  1CHC A;  3U5M A;  1XWH A;  4LKA A;  3U5O A;  2YW8 A;  1N87 A;  4I7B A;  2QIZ A;  2M6M A;  3M63 A;  3T6R A;  3ZVZ B;  3T7L A;  4TKP B;  3C5K A;  2CKL B;  3N9M A;  2I50 A;  5D1L B;  4YBT A;  5G05 B;  3SOW A;  1WIM A;  1JOC A;  2JRJ A;  4YBS A;  2K4D A;  3L1Z B;  3QZV A;  5LKZ A;  2YRE A;  2IDA A;  2YU4 A;  2YHN A;  1WEW A;  3ZYQ A;  2VPG A;  3O35 A;  3M62 A;  2LGL A;  3RTR B;  2G45 A;  2VJF B;  3O37 A;  5FB1 A;  2EOD A;  1WEU A;  3O7A A;  2KWK A;  5G04 B;  3V43 A;  3HCS A;  4UP0 A;  2ECN A;  2F6J A;  2M85 A;  2XEU A;  4UI9 B;  2L5U A;  2MNY A;  4YAD A;  2YT5 A;  5EYA F;  3L1X A;  2ZET C;  1F62 A;  4YAX A;  3LQH A;  4A0C D;  3N9Q A;  4GNF A;  1WEN A;  1MM2 A;  1WEO A;  1WES A;  4LAD B;  2KU3 A;  1VYX A;  1VD4 A;  5B77 A;  2BAY A;  3HTK C;  2ECV A;  4V3K C;  5AIT A;  4PTB A;  2K17 A;  4C9Z A;  5TDW A;  2LN0 A;  3KV5 A;  4S3O C;  5D1K B;  5JG6 A;  2RSD A;  4FO9 A;  2MUM A;  2ECI A;  3HCT A;  2KGI A;  2YUR A;  3RPG C;  4FIP A;  2KR4 A;  2L80 A;  2ECW A;  2LGV A;  3KQI A;  3EB6 A;  4QF3 A;  4LLB A;  2VPB A;  1JM7 A;  1Z60 A;  1T1H A;  2HYE D;  2VPE A;  5H1T A;  2L0B A;  4N4F A;  1WEV A;  2QIC A;  2JMJ A;  2MIQ A;  4FJC A;  4V3L C;  5D1M B;  3N9O A;  2LXH C;  4CA1 A;  3O70 A;  2OXQ C;  3MHS A;  2EA6 A;  3ZVY A;  3ZPV E;  2KWO A;  4FK5 A;  3LQJ A;  1VFY A;  4CCG X;  2E6R A;  2CKL A;  2MNZ A;  3I2D A;  5DIN A;  5TDR A;  3VK6 A;  1G25 A;  4A4B A;  3DPL R;  1IYM A;  1BOR A;  1E4U A;  2YSJ A;  5C13 A;  1V87 A;  3N9P A;  4GNE A;  1Z6U A;  1LDJ B;  2K16 A;  5FEY A;  3O33 A;  4GNG A;  1FBV A;  4A4C A;  2ECG A;  4WA6 A;  2UZG A;  3GL6 A;  4YAT A; 
#chains in the Genus database with same CATH topology
 2F42 A;  4UP5 A;  2MA6 A;  3LQI A;  4AP4 A;  5K3Q A;  1K2F A;  4I7D A;  5B8D A;  4AUQ B;  4BBQ A;  3ZTG A;  2CT2 A;  2MD7 B;  1HYJ A;  4LK9 A;  3ZPV 1;  4GB0 A;  2CSY A;  5KH3 A;  3C6W A;  5TRB A;  2KWN A;  3SOX A;  2XB1 A;  2LGG A;  2PNX A;  2K1J A;  4L58 A;  1RMD A;  2ECT A;  3ZNI A;  1MM3 A;  2LGK A;  3KV6 A;  5KH9 A;  5H1U A;  2EGP A;  1LDK C;  2M1R A;  5AIU A;  2H0D A;  2G43 A;  5LKX A;  2F6N A;  3PUR A;  5B76 A;  4BHW A;  4S3O B;  3PUQ A;  1DCQ A;  4YBM A;  4OGC A;  4R7E A;  3FM8 C;  3SOU A;  2QJ0 A;  2MA5 A;  4QF2 A;  2YQM A;  2Y1M A;  2YQL A;  2JMD A;  5J3X A;  1U6G B;  3N9N A;  2L43 A;  2YSM A;  2E6S A;  2G6Q A;  3PLW A;  2LDR A;  3DWD A;  3EB5 A;  4WZ3 B;  2KFT A;  2KRE A;  5G0F A;  2KGG A;  4X3G A;  3M99 A;  5LKU A;  2DSM A;  4ZDT A;  2FUI A;  2LRI C;  3L11 A;  5LCW B;  5I3L A;  2ECJ A;  2Y43 A;  3MHH A;  4MSX A;  2KE1 A;  2VJE B;  2VJE A;  3U5N A;  1WFK A;  4NN2 A;  3KNV A;  2VJF A;  2FD4 A;  4IC3 A;  1HYI A;  3JUE A;  2XP0 A;  2JMI A;  5FER A;  2C2L A;  5DKA A;  4N3W A;  3DQV R;  3PHD A;  5C11 A;  4YC9 A;  2DX8 A;  5B75 A;  3O36 A;  4AVX A;  2VPD A;  3E2D A;  2VP7 A;  4O64 A;  2YHO A;  1DVP A;  4P5O B;  3FAN A;  4ZQL A;  4MVT A;  4B86 C;  2LXP C;  2YVR A;  1ZBD B;  4IC2 A;  4L7X A;  1WEQ A;  2D8S A;  4OGE A;  2AN6 A;  3M7K A;  2YYR A;  4F52 B;  3ASL A;  3O34 A;  1WGM A;  4WZ2 A;  2LQ6 A;  1WEP A;  2H0D B;  1WEE A;  1Z2Q A;  3LVQ E;  3N9L A;  5H9M A;  2LV9 A;  2KWJ A;  5SVY A;  4R8P K;  4PPE A;  4GND A;  3GV4 A;  1X4J A;  5KH7 A;  1WIL A;  2YUC A;  2L75 A;  3LDY A;  2RI7 A;  3Q1D A;  2C2V S;  1JM7 B;  4ZUX U;  2FSA A;  3IHP A;  2KIZ A;  4LJN A;  1FP0 A;  4Q6F A;  2MT5 A;  5H1V A;  2MD8 C;  3FAO A;  2NAA A;  1X4U A;  2Y1N A;  5TAB A;  2KKX A;  2D8U A;  4B7Y C;  1WE9 A;  2VNF A;  2CRW A;  5FB0 A;  3RPG B;  3U5P A;  2LAU A;  4R2Y A;  5TBN A;  2CSZ A;  2KYU A;  2HDP A;  4YAB A;  1X4I A;  3FL2 A;  3HCU A;  5B79 A;  2XOZ A;  4W4U A;  3FEH A;  1WEM A;  4WZ0 A;  4XI1 A;  3SHB A;  2M3H A;  4A49 A;  4I7C A;  4AYC B;  2FUU A;  3LRQ A;  5B78 A;  4AYC A;  3NG2 A;  2PUY A;  5LKT A;  1CHC A;  3U5M A;  2OWA A;  1XWH A;  4LKA A;  3U5O A;  2YW8 A;  1N87 A;  4I7B A;  2QIZ A;  2M6M A;  3M63 A;  2CON A;  3T6R A;  3ZVZ B;  3T7L A;  4TKP B;  3C5K A;  2DJA A;  2CKL B;  3N9M A;  2I50 A;  2L7P A;  3LJU X;  5D1L B;  2M13 A;  4YBT A;  2MKE A;  5G05 B;  3SOW A;  1WIM A;  1JOC A;  2JRJ A;  2XOC A;  4YBS A;  2K4D A;  3L1Z B;  3QZV A;  5LKZ A;  2YRE A;  2IDA A;  2YU4 A;  2YHN A;  5SVI A;  1WEW A;  3ZYQ A;  2VPG A;  3O35 A;  3M62 A;  2LGL A;  3RTR B;  2G45 A;  2VJF B;  3O37 A;  5FB1 A;  2EOD A;  1WEU A;  3O7A A;  2KWK A;  2JUN A;  5G04 B;  3V43 A;  3HCS A;  3T9K A;  4UP0 A;  2ECN A;  2F6J A;  2M85 A;  4Z0R A;  2XEU A;  3H7H A;  4UI9 B;  2L5U A;  2MNY A;  4YAD A;  2FFW A;  2YT5 A;  3DDT A;  5EYA F;  3L1X A;  3LVR E;  2P57 A;  2ZET C;  1F62 A;  2E61 A;  1MBM A;  4YAX A;  3LQH A;  4A0C D;  3N9Q A;  4GNF A;  1WEN A;  1MM2 A;  1WEO A;  1WES A;  4LAD B;  2KU3 A;  1VYX A;  1VD4 A;  5B77 A;  2BAY A;  3HTK C;  2ECV A;  4V3K C;  5AIT A;  4F1P A;  4PTB A;  2K17 A;  4C9Z A;  2CRR A;  5TDW A;  2LN0 A;  3KV5 A;  4S3O C;  5D1K B;  5JG6 A;  2RSD A;  4FO9 A;  2MUM A;  2ECI A;  3FJU B;  3HCT A;  2KGI A;  4H9D A;  2YUR A;  3RPG C;  4FIP A;  4QQ4 A;  2KR4 A;  2L80 A;  2ECW A;  2LGV A;  2B0O E;  3KQI A;  3EB6 A;  5SVI B;  4QF3 A;  4LLB A;  2VPB A;  5SVX A;  1JM7 A;  2CSV A;  1Z60 A;  1T1H A;  2HYE D;  2EXU A;  2VPE A;  5H1T A;  2L0B A;  4N4F A;  1WEV A;  2IQJ A;  2QIC A;  2JMJ A;  2MIQ A;  4FJC A;  4V3L C;  5D1M B;  4Z0O A;  2XOY A;  2KKY A;  3N9O A;  2LXH C;  4CA1 A;  3O70 A;  2OXQ C;  3MHS A;  2EA6 A;  3ZVY A;  2EGM A;  2KWO A;  3ZPV E;  4FK5 A;  3LQJ A;  1VFY A;  4CCG X;  2E6R A;  2CKL A;  2MNZ A;  3I2D A;  5DIN A;  5TDR A;  3VK6 A;  2JM3 A;  1G25 A;  3SUB A;  4A4B A;  3DPL R;  1IYM A;  1BOR A;  3KDE C;  1E4U A;  2YSJ A;  5C13 A;  1V87 A;  3N9P A;  4GNE A;  1Z6U A;  4O62 A;  1LDJ B;  2K16 A;  5FEY A;  3O33 A;  4GNG A;  2RR4 A;  1FBV A;  4A4C A;  3O47 A;  2ECG A;  4WA6 A;  2UZG A;  3GL6 A;  3MDB C;  4YAT A; 
#chains in the Genus database with same CATH homology
 2F42 A;  4UP5 A;  2MA6 A;  3LQI A;  4AP4 A;  1K2F A;  4I7D A;  5B8D A;  4AUQ B;  4BBQ A;  3ZTG A;  2CT2 A;  2MD7 B;  1HYJ A;  4LK9 A;  3ZPV 1;  4GB0 A;  2CSY A;  5KH3 A;  3C6W A;  5TRB A;  2KWN A;  3SOX A;  2XB1 A;  2LGG A;  2PNX A;  2K1J A;  4L58 A;  1RMD A;  2ECT A;  3ZNI A;  1MM3 A;  2LGK A;  3KV6 A;  5KH9 A;  5H1U A;  2EGP A;  1LDK C;  2M1R A;  5AIU A;  2H0D A;  2G43 A;  5LKX A;  2F6N A;  3PUR A;  5B76 A;  4BHW A;  4S3O B;  3PUQ A;  4YBM A;  4R7E A;  3SOU A;  2QJ0 A;  2MA5 A;  4QF2 A;  2YQM A;  2Y1M A;  2YQL A;  2JMD A;  5J3X A;  1U6G B;  3N9N A;  2L43 A;  2YSM A;  2E6S A;  2G6Q A;  2LDR A;  3EB5 A;  4WZ3 B;  2KFT A;  2KRE A;  5G0F A;  2KGG A;  4X3G A;  3M99 A;  5LKU A;  4ZDT A;  2FUI A;  2LRI C;  3L11 A;  5LCW B;  5I3L A;  2ECJ A;  2Y43 A;  3MHH A;  4MSX A;  2KE1 A;  2VJE B;  2VJE A;  3U5N A;  1WFK A;  4NN2 A;  3KNV A;  2VJF A;  4IC3 A;  1HYI A;  2JMI A;  5FER A;  2C2L A;  5DKA A;  4N3W A;  3DQV R;  3PHD A;  5C11 A;  4YC9 A;  2DX8 A;  5B75 A;  3O36 A;  4AVX A;  2VPD A;  2VP7 A;  4O64 A;  2YHO A;  1DVP A;  4P5O B;  4ZQL A;  4MVT A;  4B86 C;  2LXP C;  1ZBD B;  4IC2 A;  4L7X A;  1WEQ A;  2D8S A;  2AN6 A;  2YYR A;  4F52 B;  3ASL A;  3O34 A;  1WGM A;  4WZ2 A;  2LQ6 A;  1WEP A;  2H0D B;  1WEE A;  1Z2Q A;  3N9L A;  5H9M A;  2LV9 A;  2KWJ A;  4R8P K;  4PPE A;  4GND A;  3GV4 A;  1X4J A;  5KH7 A;  1WIL A;  2YUC A;  2L75 A;  2RI7 A;  2C2V S;  1JM7 B;  4ZUX U;  2FSA A;  3IHP A;  2KIZ A;  4LJN A;  1FP0 A;  4Q6F A;  2MT5 A;  5H1V A;  2MD8 C;  2NAA A;  1X4U A;  2Y1N A;  5TAB A;  4B7Y C;  1WE9 A;  2VNF A;  5FB0 A;  3RPG B;  3U5P A;  4R2Y A;  5TBN A;  2CSZ A;  2KYU A;  4YAB A;  2HDP A;  1X4I A;  3FL2 A;  3HCU A;  5B79 A;  4W4U A;  1WEM A;  4WZ0 A;  4XI1 A;  3SHB A;  2M3H A;  4A49 A;  4I7C A;  4AYC B;  2FUU A;  3LRQ A;  5B78 A;  4AYC A;  3NG2 A;  2PUY A;  5LKT A;  1CHC A;  3U5M A;  1XWH A;  4LKA A;  3U5O A;  2YW8 A;  1N87 A;  4I7B A;  2QIZ A;  2M6M A;  3M63 A;  3T6R A;  3ZVZ B;  3T7L A;  4TKP B;  3C5K A;  2CKL B;  3N9M A;  2I50 A;  5D1L B;  4YBT A;  5G05 B;  3SOW A;  1WIM A;  1JOC A;  2JRJ A;  4YBS A;  2K4D A;  3L1Z B;  3QZV A;  5LKZ A;  2YRE A;  2IDA A;  2YU4 A;  2YHN A;  1WEW A;  3ZYQ A;  2VPG A;  3O35 A;  3M62 A;  2LGL A;  3RTR B;  2G45 A;  2VJF B;  3O37 A;  5FB1 A;  2EOD A;  1WEU A;  3O7A A;  2KWK A;  5G04 B;  3V43 A;  3HCS A;  4UP0 A;  2ECN A;  2F6J A;  2M85 A;  2XEU A;  4UI9 B;  2L5U A;  2MNY A;  4YAD A;  2YT5 A;  5EYA F;  3L1X A;  2ZET C;  1F62 A;  4YAX A;  3LQH A;  4A0C D;  3N9Q A;  4GNF A;  1WEN A;  1MM2 A;  1WEO A;  1WES A;  4LAD B;  2KU3 A;  1VYX A;  1VD4 A;  5B77 A;  2BAY A;  3HTK C;  2ECV A;  4V3K C;  5AIT A;  4PTB A;  2K17 A;  4C9Z A;  5TDW A;  2LN0 A;  3KV5 A;  4S3O C;  5D1K B;  5JG6 A;  2RSD A;  4FO9 A;  2MUM A;  2ECI A;  3HCT A;  2KGI A;  2YUR A;  3RPG C;  4FIP A;  2KR4 A;  2L80 A;  2ECW A;  2LGV A;  3KQI A;  3EB6 A;  4QF3 A;  4LLB A;  2VPB A;  1JM7 A;  1Z60 A;  1T1H A;  2HYE D;  2VPE A;  5H1T A;  2L0B A;  4N4F A;  1WEV A;  2QIC A;  2JMJ A;  2MIQ A;  4FJC A;  4V3L C;  5D1M B;  3N9O A;  2LXH C;  4CA1 A;  3O70 A;  2OXQ C;  3MHS A;  2EA6 A;  3ZVY A;  3ZPV E;  2KWO A;  4FK5 A;  3LQJ A;  1VFY A;  4CCG X;  2E6R A;  2CKL A;  2MNZ A;  3I2D A;  5DIN A;  5TDR A;  3VK6 A;  1G25 A;  4A4B A;  3DPL R;  1IYM A;  1BOR A;  1E4U A;  2YSJ A;  5C13 A;  1V87 A;  3N9P A;  4GNE A;  1Z6U A;  1LDJ B;  2K16 A;  5FEY A;  3O33 A;  4GNG A;  1FBV A;  4A4C A;  2ECG A;  4WA6 A;  2UZG A;  3GL6 A;  4YAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...