1WEVA

Solution structure of phd domain in protein np_082203
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
88
structure length
88
Chain Sequence
b'GSSGSSGADDFAMEMGLACVVCRQMTVASGNQLVECQECHNLYHQDCHKPQVTDKEVNDPRLVWYCARCTRQMKRMAQKNQKSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIKEN cDNA 1110020M19
publication title Solution structure of PHD domain in protein NP_082203
rcsb
source organism Mus musculus
molecule tags Gene regulation
total genus 9
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2004-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1wevA01
3SOUA 5KH3A 2DX8A 2KYUA 3RTRB 1JM7B 1F62A 4FK5A 2K1JA 4I7BA 5B76A 2YYRA 2LXHC 4YC9A 5G05B 3KNVA 4LJNA 2KREA 5C13A 2KWKA 4LKAA 1WEPA 2LXPC 5I3LA 5KH7A 3HCUA 3O36A 5H1UA 2YUCA 2Y1NA 4PPEA 1K2FA 4FO9A 5FB1A 5D1MB 5G0FA 4A4BA 2L5UA 3RPGB 4BHWA 2ECIA 2JRJA 5LKUA 2M6MA 4YADA 1WESA 5FB0A 3IHPA 2VPDA 2IDAA 2H0DA 3N9OA 3LRQA 5B8DA 2YSJA 4CA1A 2I50A 3ZPVE 4UI9B 2RSDA 2RI7A 3I2DA 3O34A 2L43A 2YU4A 4R8PK 3N9NA 3LQJA 2VPBA 4TKPB 1WEQA 2ECWA 3L1XA 2E6RA 4GNFA 5C11A 2KWNA 5DINA 2KU3A 2G43A 2ZETC 4S3OC 2Y43A 3ZVYA 4B86C 2YW8A 3C5KA 2AN6A 1WEEA 5LKXA 2D8SA 3HCSA 2L80A 1FP0A 1WEMA 2YQMA 1WFKA 4YABA 4AYCA 2LGGA 1U6GB 1HYIA 3KV6A 4WZ3B 2L75A 3MHHA 4I7DA 2M85A 2PNXA 5H9MA 3O33A 2QICA 1Z2QA 1ZBDB 5FERA 4CCGX 1Z6UA 2YQLA 4QF3A 2VNFA 4FIPA 2HYED 2YHOA 2KIZA 4PTBA 5B75A 2JMIA 4O64A 4AP4A 4A0CD 2EA6A 5B78A 2MA5A 2F6JA 1N87A 2HDPA 4V3LC 2KR4A 2FUIA 3M99A 3M63A 2CKLA 4X3GA 3L1ZB 4S3OB 5B77A 1WEOA 3T6RA 2VJFA 1VFYA 3ZPV1 5JG6A 2LV9A 5KH9A 3U5MA 2EGPA 3NG2A 1E4UA 3ZNIA 4YATA 4P5OB 4AYCB 3T7LA 1LDKC 2MT5A 3VK6A 3DPLR 2MA6A 3N9QA 2ECTA 5J3XA 3C6WA 1X4IA 2F42A 3EB6A 1WGMA 4V3KC 3LQIA 2XEUA 2C2VS 4GNDA 5LKZA 2VJEA 2G6QA 3N9LA 2BAYA 1CHCA 2MD8C 1BORA 5H1VA 2LGLA 2UZGA 4W4UA 3U5PA 3U5NA 4WZ2A 4LADB 4I7CA 4F52B 4UP5A 4FJCA 4XI1A 2OXQC 2KGGA 2YT5A 4QF2A 2MNYA 4ZQLA 2CSYA 4BBQA 3M62A 2JMJA 1WEUA 2KWJA 1WEVA 4AUQB 3PUQA 2VJFB 3KQIA 1FBVA 2PUYA 3MHSA 3QZVA 5TDRA 3SOXA 3ASLA 2VPGA 2KFTA 2CSZA 1JOCA 1LDJB 3O7AA 2H0DB 3GV4A 4WZ0A 2FUUA 2FSAA 1WENA 2CT2A 3N9MA 2E6SA 4MVTA 2MD7B 3PHDA 5G04B 2ECGA 2LQ6A 2Y1MA 2ECJA 5TABA 2EODA 1G25A 2K17A 4GNEA 4WA6A 4IC3A 3FL2A 2F6NA 5TRBA 2QJ0A 5H1TA 1MM2A 2C2LA 4L7XA 4MSXA 4A49A 1VD4A 2ECVA 3N9PA 4ZDTA 2K4DA 4L58A 4YAXA 2LRIC 3ZTGA 5D1LB 2VPEA 3SOWA 2ECNA 2MNZA 2NAAA 1VYXA 5DKAA 5LCWB 4AVXA 4Q6FA 4UP0A 2YURA 2MIQA 3O37A 4IC2A 1V87A 5FEYA 4GB0A 3O70A 2YREA 4YBSA 1X4JA 2M3HA 4A4CA 2LN0A 2XB1A 3PURA 5TBNA 5B79A 3U5OA 1WEWA 4N3WA 1JM7A 5AIUA 1WILA 3DQVR 2QIZA 3O35A 3HTKC 5AITA 4LLBA 1HYJA 4NN2A 1WE9A 3EB5A 2L0BA 2VP7A 2G45A 2M1RA 5EYAF 3SHBA 3KV5A 4C9ZA 2KWOA 3GL6A 2CKLB 3LQHA 1WIMA 2LGVA 4R7EA 5D1KB 4YBTA 4N4FA 2MUMA 2LGKA 3ZYQA 2YSMA 3RPGC 1MM3A 2K16A 1IYMA 4ZUXU 2YHNA 2KE1A 2JMDA 2LDRA 5TDWA 1Z60A 3HCTA 3ZVZB 4GNGA 2KGIA 3V43A 4B7YC 1RMDA 4R2YA 1T1HA 4YBMA 1XWHA 5LKTA 3L11A 2VJEB 1DVPA 1X4UA 4LK9A
chains in the Genus database with same CATH superfamily
3SOUA 5KH3A 2DX8A 2KYUA 3RTRB 1DCQA 3FAOA 1JM7B 1F62A 4FK5A 2K1JA 4I7BA 3FJUB 5B76A 2YYRA 5K3QA 2LXHC 4YC9A 5G05B 3KNVA 4LJNA 2KREA 5C13A 2KWKA 4LKAA 1WEPA 3JUEA 2LXPC 5I3LA 5KH7A 3HCUA 3O36A 5H1UA 2YUCA 2Y1NA 4PPEA 1K2FA 4FO9A 5FB1A 5D1MB 5G0FA 4A4BA 2L5UA 3RPGB 4BHWA 2ECIA 2JRJA 5LKUA 2M6MA 4YADA 1WESA 5FB0A 5SVIA 2XOYA 3IHPA 2VPDA 2IDAA 2H0DA 3N9OA 3LRQA 5B8DA 2YSJA 4CA1A 3KDEC 2I50A 3ZPVE 4UI9B 2RSDA 2RI7A 3LDYA 3I2DA 3O34A 2L43A 2YU4A 4R8PK 3N9NA 3LQJA 2VPBA 4TKPB 1WEQA 2ECWA 3L1XA 3MDBC 2E6RA 4GNFA 5C11A 2KWNA 5DINA 2KU3A 2G43A 3PLWA 2ZETC 4S3OC 2Y43A 3ZVYA 4B86C 2YW8A 3C5KA 2AN6A 5SVYA 1WEEA 5LKXA 2D8SA 3HCSA 4OGCA 2L80A 1FP0A 1WEMA 2YQMA 1WFKA 4YABA 4AYCA 2LGGA 1U6GB 1HYIA 3KV6A 2B0OE 4WZ3B 2L75A 5SVIB 2CONA 3MHHA 4I7DA 2M85A 4OGEA 2XP0A 2PNXA 5H9MA 3O33A 2QICA 1Z2QA 1ZBDB 5FERA 4CCGX 1Z6UA 2XOZA 2KKXA 2YQLA 4QF3A 2VNFA 3FANA 4O62A 4F1PA 4FIPA 2HYED 2YHOA 2KIZA 4PTBA 5B75A 2JMIA 3LVRE 2EGMA 4O64A 2FFWA 4AP4A 4A0CD 4Z0OA 2XOCA 2EA6A 5B78A 2MA5A 2F6JA 1N87A 2HDPA 4V3LC 2KR4A 2FUIA 2CSVA 3M99A 3M63A 2CKLA 2JM3A 4X3GA 3L1ZB 4S3OB 2EXUA 1WEOA 3T6RA 5B77A 2FD4A 2VJFA 1VFYA 3ZPV1 5JG6A 2LV9A 5KH9A 3U5MA 2EGPA 3NG2A 1E4UA 3ZNIA 4YATA 4P5OB 4AYCB 3T7LA 1LDKC 2MT5A 3FEHA 3VK6A 3DPLR 5SVXA 2MA6A 3N9QA 2ECTA 5J3XA 3C6WA 1X4IA 2F42A 3EB6A 1WGMA 3LQIA 4V3KC 2XEUA 2C2VS 4GNDA 4H9DA 5LKZA 2VJEA 2G6QA 3N9LA 2BAYA 1CHCA 2MD8C 2JUNA 1BORA 5H1VA 3O47A 2LGLA 2UZGA 4W4UA 3U5PA 2MKEA 3U5NA 4WZ2A 4LADB 4I7CA 4F52B 4UP5A 4FJCA 4XI1A 2OXQC 3DDTA 2KGGA 2YT5A 4QF2A 2MNYA 4ZQLA 2CSYA 4BBQA 2RR4A 3M62A 2JMJA 1WEUA 2KWJA 1WEVA 4AUQB 3PUQA 2VJFB 3KQIA 1FBVA 2PUYA 3MHSA 3QZVA 5TDRA 3SOXA 1MBMA 3ASLA 2VPGA 2KFTA 2CSZA 1JOCA 1LDJB 3O7AA 2H0DB 3GV4A 4WZ0A 2FUUA 2FSAA 1WENA 2CT2A 3N9MA 2E6SA 4MVTA 4QQ4A 2MD7B 3PHDA 5G04B 2ECGA 2LQ6A 2Y1MA 2ECJA 2LAUA 5TABA 2EODA 1G25A 2K17A 4GNEA 4WA6A 4IC3A 3FL2A 2F6NA 5TRBA 2QJ0A 5H1TA 1MM2A 2C2LA 4L7XA 4MSXA 4A49A 1VD4A 2ECVA 3N9PA 4ZDTA 2K4DA 4L58A 4YAXA 2LRIC 3ZTGA 5D1LB 2VPEA 3Q1DA 3SOWA 2ECNA 2MNZA 2NAAA 1VYXA 5DKAA 5LCWB 4AVXA 2IQJA 4Q6FA 4UP0A 2L7PA 2YURA 2MIQA 3O37A 4IC2A 1V87A 5FEYA 4GB0A 3O70A 2E61A 2YREA 2YVRA 4YBSA 1X4JA 2M3HA 4A4CA 2OWAA 2LN0A 2XB1A 3PURA 2DSMA 5TBNA 5B79A 2KKYA 3U5OA 1WEWA 3SUBA 4N3WA 1JM7A 5AIUA 1WILA 3DQVR 2QIZA 3O35A 3HTKC 3T9KA 5AITA 4LLBA 1HYJA 4NN2A 1WE9A 3EB5A 2L0BA 2VP7A 2G45A 2M1RA 2CRWA 5EYAF 3H7HA 3SHBA 3KV5A 4C9ZA 2KWOA 3GL6A 2CKLB 3LQHA 1WIMA 2LGVA 4R7EA 5D1KB 4YBTA 2CRRA 4N4FA 2P57A 2MUMA 2LGKA 3ZYQA 2YSMA 3RPGC 1MM3A 2K16A 3E2DA 1IYMA 4ZUXU 3FM8C 2YHNA 2M13A 2KE1A 2JMDA 2LDRA 5TDWA 1Z60A 3HCTA 3ZVZB 2D8UA 4GNGA 2KGIA 3V43A 4B7YC 1RMDA 4R2YA 1T1HA 4YBMA 1XWHA 5LKTA 3L11A 3LVQE 3M7KA 4Z0RA 3DWDA 2VJEB 1DVPA 3LJUX 2DJAA 1X4UA 4LK9A
chains in the Genus database with same CATH topology
3SOUA 5KH3A 2DX8A 2KYUA 3RTRB 1JM7B 1F62A 4FK5A 2K1JA 4I7BA 5B76A 2YYRA 2LXHC 4YC9A 5G05B 3KNVA 4LJNA 2KREA 5C13A 2KWKA 4LKAA 1WEPA 2LXPC 5I3LA 5KH7A 3HCUA 3O36A 5H1UA 2YUCA 2Y1NA 4PPEA 1K2FA 4FO9A 5FB1A 5D1MB 5G0FA 4A4BA 2L5UA 3RPGB 4BHWA 2ECIA 2JRJA 5LKUA 2M6MA 4YADA 1WESA 5FB0A 3IHPA 2VPDA 2IDAA 2H0DA 3N9OA 3LRQA 5B8DA 2YSJA 4CA1A 2I50A 3ZPVE 4UI9B 2RSDA 2RI7A 3I2DA 3O34A 2L43A 2YU4A 4R8PK 3N9NA 3LQJA 2VPBA 4TKPB 1WEQA 2ECWA 3L1XA 2E6RA 4GNFA 5C11A 2KWNA 5DINA 2KU3A 2G43A 2ZETC 4S3OC 2Y43A 3ZVYA 4B86C 2YW8A 3C5KA 2AN6A 1WEEA 5LKXA 2D8SA 3HCSA 2L80A 1FP0A 1WEMA 2YQMA 1WFKA 4YABA 4AYCA 2LGGA 1U6GB 1HYIA 3KV6A 4WZ3B 2L75A 3MHHA 4I7DA 2M85A 2PNXA 5H9MA 3O33A 2QICA 1Z2QA 1ZBDB 5FERA 4CCGX 1Z6UA 2YQLA 4QF3A 2VNFA 4FIPA 2HYED 2YHOA 2KIZA 4PTBA 5B75A 2JMIA 4O64A 4AP4A 4A0CD 2EA6A 5B78A 2MA5A 2F6JA 1N87A 2HDPA 4V3LC 2KR4A 2FUIA 3M99A 3M63A 2CKLA 4X3GA 3L1ZB 4S3OB 5B77A 1WEOA 3T6RA 2VJFA 1VFYA 3ZPV1 5JG6A 2LV9A 5KH9A 3U5MA 2EGPA 3NG2A 1E4UA 3ZNIA 4YATA 4P5OB 4AYCB 3T7LA 1LDKC 2MT5A 3VK6A 3DPLR 2MA6A 3N9QA 2ECTA 5J3XA 3C6WA 1X4IA 2F42A 3EB6A 1WGMA 4V3KC 3LQIA 2XEUA 2C2VS 4GNDA 5LKZA 2VJEA 2G6QA 3N9LA 2BAYA 1CHCA 2MD8C 1BORA 5H1VA 2LGLA 2UZGA 4W4UA 3U5PA 3U5NA 4WZ2A 4LADB 4I7CA 4F52B 4UP5A 4FJCA 4XI1A 2OXQC 2KGGA 2YT5A 4QF2A 2MNYA 4ZQLA 2CSYA 4BBQA 3M62A 2JMJA 1WEUA 2KWJA 1WEVA 4AUQB 3PUQA 2VJFB 3KQIA 1FBVA 2PUYA 3MHSA 3QZVA 5TDRA 3SOXA 3ASLA 2VPGA 2KFTA 2CSZA 1JOCA 1LDJB 3O7AA 2H0DB 3GV4A 4WZ0A 2FUUA 2FSAA 1WENA 2CT2A 3N9MA 2E6SA 4MVTA 2MD7B 3PHDA 5G04B 2ECGA 2LQ6A 2Y1MA 2ECJA 5TABA 2EODA 1G25A 2K17A 4GNEA 4WA6A 4IC3A 3FL2A 2F6NA 5TRBA 2QJ0A 5H1TA 1MM2A 2C2LA 4L7XA 4MSXA 4A49A 1VD4A 2ECVA 3N9PA 4ZDTA 2K4DA 4L58A 4YAXA 2LRIC 3ZTGA 5D1LB 2VPEA 3SOWA 2ECNA 2MNZA 2NAAA 1VYXA 5DKAA 5LCWB 4AVXA 4Q6FA 4UP0A 2YURA 2MIQA 3O37A 4IC2A 1V87A 5FEYA 4GB0A 3O70A 2YREA 4YBSA 1X4JA 2M3HA 4A4CA 2LN0A 2XB1A 3PURA 5TBNA 5B79A 3U5OA 1WEWA 4N3WA 1JM7A 5AIUA 1WILA 3DQVR 2QIZA 3O35A 3HTKC 5AITA 4LLBA 1HYJA 4NN2A 1WE9A 3EB5A 2L0BA 2VP7A 2G45A 2M1RA 5EYAF 3SHBA 3KV5A 4C9ZA 2KWOA 3GL6A 2CKLB 3LQHA 1WIMA 2LGVA 4R7EA 5D1KB 4YBTA 4N4FA 2MUMA 2LGKA 3ZYQA 2YSMA 3RPGC 1MM3A 2K16A 1IYMA 4ZUXU 2YHNA 2KE1A 2JMDA 2LDRA 5TDWA 1Z60A 3HCTA 3ZVZB 4GNGA 2KGIA 3V43A 4B7YC 1RMDA 4R2YA 1T1HA 4YBMA 1XWHA 5LKTA 3L11A 2VJEB 1DVPA 1X4UA 4LK9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SOU A;  5KH3 A;  2DX8 A;  2KYU A;  3RTR B;  1JM7 B;  1F62 A;  4FK5 A;  2K1J A;  4I7B A;  5B76 A;  2YYR A;  2LXH C;  4YC9 A;  5G05 B;  3KNV A;  4LJN A;  2KRE A;  5C13 A;  2KWK A;  4LKA A;  1WEP A;  2LXP C;  5I3L A;  5KH7 A;  3HCU A;  3O36 A;  5H1U A;  2YUC A;  2Y1N A;  4PPE A;  1K2F A;  4FO9 A;  5FB1 A;  5D1M B;  5G0F A;  4A4B A;  2L5U A;  3RPG B;  4BHW A;  2ECI A;  2JRJ A;  5LKU A;  2M6M A;  4YAD A;  1WES A;  5FB0 A;  3IHP A;  2VPD A;  2IDA A;  2H0D A;  3N9O A;  3LRQ A;  5B8D A;  2YSJ A;  4CA1 A;  2I50 A;  3ZPV E;  4UI9 B;  2RSD A;  2RI7 A;  3I2D A;  3O34 A;  2L43 A;  2YU4 A;  4R8P K;  3N9N A;  3LQJ A;  2VPB A;  4TKP B;  1WEQ A;  2ECW A;  3L1X A;  2E6R A;  4GNF A;  5C11 A;  2KWN A;  5DIN A;  2KU3 A;  2G43 A;  2ZET C;  4S3O C;  2Y43 A;  3ZVY A;  4B86 C;  2YW8 A;  3C5K A;  2AN6 A;  1WEE A;  5LKX A;  2D8S A;  3HCS A;  2L80 A;  1FP0 A;  1WEM A;  2YQM A;  1WFK A;  4YAB A;  4AYC A;  2LGG A;  1U6G B;  1HYI A;  3KV6 A;  4WZ3 B;  2L75 A;  3MHH A;  4I7D A;  2M85 A;  2PNX A;  5H9M A;  3O33 A;  2QIC A;  1Z2Q A;  1ZBD B;  5FER A;  4CCG X;  1Z6U A;  2YQL A;  4QF3 A;  2VNF A;  4FIP A;  2HYE D;  2YHO A;  2KIZ A;  4PTB A;  5B75 A;  2JMI A;  4O64 A;  4AP4 A;  4A0C D;  2EA6 A;  5B78 A;  2MA5 A;  2F6J A;  1N87 A;  2HDP A;  4V3L C;  2KR4 A;  2FUI A;  3M99 A;  3M63 A;  2CKL A;  4X3G A;  3L1Z B;  4S3O B;  5B77 A;  1WEO A;  3T6R A;  2VJF A;  1VFY A;  3ZPV 1;  5JG6 A;  2LV9 A;  5KH9 A;  3U5M A;  2EGP A;  3NG2 A;  1E4U A;  3ZNI A;  4YAT A;  4P5O B;  4AYC B;  3T7L A;  1LDK C;  2MT5 A;  3VK6 A;  3DPL R;  2MA6 A;  3N9Q A;  2ECT A;  5J3X A;  3C6W A;  1X4I A;  2F42 A;  3EB6 A;  1WGM A;  4V3K C;  3LQI A;  2XEU A;  2C2V S;  4GND A;  5LKZ A;  2VJE A;  2G6Q A;  3N9L A;  2BAY A;  1CHC A;  2MD8 C;  1BOR A;  5H1V A;  2LGL A;  2UZG A;  4W4U A;  3U5P A;  3U5N A;  4WZ2 A;  4LAD B;  4I7C A;  4F52 B;  4UP5 A;  4FJC A;  4XI1 A;  2OXQ C;  2KGG A;  2YT5 A;  4QF2 A;  2MNY A;  4ZQL A;  2CSY A;  4BBQ A;  3M62 A;  2JMJ A;  1WEU A;  2KWJ A;  1WEV A;  4AUQ B;  3PUQ A;  2VJF B;  3KQI A;  1FBV A;  2PUY A;  3MHS A;  3QZV A;  5TDR A;  3SOX A;  3ASL A;  2VPG A;  2KFT A;  2CSZ A;  1JOC A;  1LDJ B;  3O7A A;  2H0D B;  3GV4 A;  4WZ0 A;  2FUU A;  2FSA A;  1WEN A;  2CT2 A;  3N9M A;  2E6S A;  4MVT A;  2MD7 B;  3PHD A;  5G04 B;  2ECG A;  2LQ6 A;  2Y1M A;  2ECJ A;  5TAB A;  2EOD A;  1G25 A;  2K17 A;  4GNE A;  4WA6 A;  4IC3 A;  3FL2 A;  2F6N A;  5TRB A;  2QJ0 A;  5H1T A;  1MM2 A;  2C2L A;  4L7X A;  4MSX A;  4A49 A;  1VD4 A;  2ECV A;  3N9P A;  4ZDT A;  2K4D A;  4L58 A;  4YAX A;  2LRI C;  3ZTG A;  5D1L B;  2VPE A;  3SOW A;  2ECN A;  2MNZ A;  2NAA A;  1VYX A;  5DKA A;  5LCW B;  4AVX A;  4Q6F A;  4UP0 A;  2YUR A;  2MIQ A;  3O37 A;  4IC2 A;  1V87 A;  5FEY A;  4GB0 A;  3O70 A;  2YRE A;  4YBS A;  1X4J A;  2M3H A;  4A4C A;  2LN0 A;  2XB1 A;  3PUR A;  5TBN A;  5B79 A;  3U5O A;  1WEW A;  4N3W A;  1JM7 A;  5AIU A;  1WIL A;  3DQV R;  2QIZ A;  3O35 A;  3HTK C;  5AIT A;  4LLB A;  1HYJ A;  4NN2 A;  1WE9 A;  3EB5 A;  2L0B A;  2VP7 A;  2G45 A;  2M1R A;  5EYA F;  3SHB A;  3KV5 A;  4C9Z A;  2KWO A;  3GL6 A;  2CKL B;  3LQH A;  1WIM A;  2LGV A;  4R7E A;  5D1K B;  4YBT A;  4N4F A;  2MUM A;  2LGK A;  3ZYQ A;  2YSM A;  3RPG C;  1MM3 A;  2K16 A;  1IYM A;  4ZUX U;  2YHN A;  2KE1 A;  2JMD A;  2LDR A;  5TDW A;  1Z60 A;  3HCT A;  3ZVZ B;  4GNG A;  2KGI A;  3V43 A;  4B7Y C;  1RMD A;  4R2Y A;  1T1H A;  4YBM A;  1XWH A;  5LKT A;  3L11 A;  2VJE B;  1DVP A;  1X4U A;  4LK9 A; 
#chains in the Genus database with same CATH topology
 3SOU A;  5KH3 A;  2DX8 A;  2KYU A;  3RTR B;  1DCQ A;  3FAO A;  1JM7 B;  1F62 A;  4FK5 A;  2K1J A;  4I7B A;  3FJU B;  5B76 A;  2YYR A;  5K3Q A;  2LXH C;  4YC9 A;  5G05 B;  3KNV A;  4LJN A;  2KRE A;  5C13 A;  2KWK A;  4LKA A;  1WEP A;  3JUE A;  2LXP C;  5I3L A;  5KH7 A;  3HCU A;  3O36 A;  5H1U A;  2YUC A;  2Y1N A;  4PPE A;  1K2F A;  4FO9 A;  5FB1 A;  5D1M B;  5G0F A;  4A4B A;  2L5U A;  3RPG B;  4BHW A;  2ECI A;  2JRJ A;  5LKU A;  2M6M A;  4YAD A;  1WES A;  5FB0 A;  5SVI A;  2XOY A;  3IHP A;  2VPD A;  2IDA A;  2H0D A;  3N9O A;  3LRQ A;  5B8D A;  2YSJ A;  4CA1 A;  3KDE C;  2I50 A;  3ZPV E;  4UI9 B;  2RSD A;  2RI7 A;  3LDY A;  3I2D A;  3O34 A;  2L43 A;  2YU4 A;  4R8P K;  3N9N A;  3LQJ A;  2VPB A;  4TKP B;  1WEQ A;  2ECW A;  3L1X A;  3MDB C;  2E6R A;  4GNF A;  5C11 A;  2KWN A;  5DIN A;  2KU3 A;  2G43 A;  3PLW A;  2ZET C;  4S3O C;  2Y43 A;  3ZVY A;  4B86 C;  2YW8 A;  3C5K A;  2AN6 A;  5SVY A;  1WEE A;  5LKX A;  2D8S A;  3HCS A;  4OGC A;  2L80 A;  1FP0 A;  1WEM A;  2YQM A;  1WFK A;  4YAB A;  4AYC A;  2LGG A;  1U6G B;  1HYI A;  3KV6 A;  2B0O E;  4WZ3 B;  2L75 A;  5SVI B;  2CON A;  3MHH A;  4I7D A;  2M85 A;  4OGE A;  2XP0 A;  2PNX A;  5H9M A;  3O33 A;  2QIC A;  1Z2Q A;  1ZBD B;  5FER A;  4CCG X;  1Z6U A;  2XOZ A;  2KKX A;  2YQL A;  4QF3 A;  2VNF A;  3FAN A;  4O62 A;  4F1P A;  4FIP A;  2HYE D;  2YHO A;  2KIZ A;  4PTB A;  5B75 A;  2JMI A;  3LVR E;  2EGM A;  4O64 A;  2FFW A;  4AP4 A;  4A0C D;  4Z0O A;  2XOC A;  2EA6 A;  5B78 A;  2MA5 A;  2F6J A;  1N87 A;  2HDP A;  4V3L C;  2KR4 A;  2FUI A;  2CSV A;  3M99 A;  3M63 A;  2CKL A;  2JM3 A;  4X3G A;  3L1Z B;  4S3O B;  2EXU A;  1WEO A;  3T6R A;  5B77 A;  2FD4 A;  2VJF A;  1VFY A;  3ZPV 1;  5JG6 A;  2LV9 A;  5KH9 A;  3U5M A;  2EGP A;  3NG2 A;  1E4U A;  3ZNI A;  4YAT A;  4P5O B;  4AYC B;  3T7L A;  1LDK C;  2MT5 A;  3FEH A;  3VK6 A;  3DPL R;  5SVX A;  2MA6 A;  3N9Q A;  2ECT A;  5J3X A;  3C6W A;  1X4I A;  2F42 A;  3EB6 A;  1WGM A;  3LQI A;  4V3K C;  2XEU A;  2C2V S;  4GND A;  4H9D A;  5LKZ A;  2VJE A;  2G6Q A;  3N9L A;  2BAY A;  1CHC A;  2MD8 C;  2JUN A;  1BOR A;  5H1V A;  3O47 A;  2LGL A;  2UZG A;  4W4U A;  3U5P A;  2MKE A;  3U5N A;  4WZ2 A;  4LAD B;  4I7C A;  4F52 B;  4UP5 A;  4FJC A;  4XI1 A;  2OXQ C;  3DDT A;  2KGG A;  2YT5 A;  4QF2 A;  2MNY A;  4ZQL A;  2CSY A;  4BBQ A;  2RR4 A;  3M62 A;  2JMJ A;  1WEU A;  2KWJ A;  1WEV A;  4AUQ B;  3PUQ A;  2VJF B;  3KQI A;  1FBV A;  2PUY A;  3MHS A;  3QZV A;  5TDR A;  3SOX A;  1MBM A;  3ASL A;  2VPG A;  2KFT A;  2CSZ A;  1JOC A;  1LDJ B;  3O7A A;  2H0D B;  3GV4 A;  4WZ0 A;  2FUU A;  2FSA A;  1WEN A;  2CT2 A;  3N9M A;  2E6S A;  4MVT A;  4QQ4 A;  2MD7 B;  3PHD A;  5G04 B;  2ECG A;  2LQ6 A;  2Y1M A;  2ECJ A;  2LAU A;  5TAB A;  2EOD A;  1G25 A;  2K17 A;  4GNE A;  4WA6 A;  4IC3 A;  3FL2 A;  2F6N A;  5TRB A;  2QJ0 A;  5H1T A;  1MM2 A;  2C2L A;  4L7X A;  4MSX A;  4A49 A;  1VD4 A;  2ECV A;  3N9P A;  4ZDT A;  2K4D A;  4L58 A;  4YAX A;  2LRI C;  3ZTG A;  5D1L B;  2VPE A;  3Q1D A;  3SOW A;  2ECN A;  2MNZ A;  2NAA A;  1VYX A;  5DKA A;  5LCW B;  4AVX A;  2IQJ A;  4Q6F A;  4UP0 A;  2L7P A;  2YUR A;  2MIQ A;  3O37 A;  4IC2 A;  1V87 A;  5FEY A;  4GB0 A;  3O70 A;  2E61 A;  2YRE A;  2YVR A;  4YBS A;  1X4J A;  2M3H A;  4A4C A;  2OWA A;  2LN0 A;  2XB1 A;  3PUR A;  2DSM A;  5TBN A;  5B79 A;  2KKY A;  3U5O A;  1WEW A;  3SUB A;  4N3W A;  1JM7 A;  5AIU A;  1WIL A;  3DQV R;  2QIZ A;  3O35 A;  3HTK C;  3T9K A;  5AIT A;  4LLB A;  1HYJ A;  4NN2 A;  1WE9 A;  3EB5 A;  2L0B A;  2VP7 A;  2G45 A;  2M1R A;  2CRW A;  5EYA F;  3H7H A;  3SHB A;  3KV5 A;  4C9Z A;  2KWO A;  3GL6 A;  2CKL B;  3LQH A;  1WIM A;  2LGV A;  4R7E A;  5D1K B;  4YBT A;  2CRR A;  4N4F A;  2P57 A;  2MUM A;  2LGK A;  3ZYQ A;  2YSM A;  3RPG C;  1MM3 A;  2K16 A;  3E2D A;  1IYM A;  4ZUX U;  3FM8 C;  2YHN A;  2M13 A;  2KE1 A;  2JMD A;  2LDR A;  5TDW A;  1Z60 A;  3HCT A;  3ZVZ B;  2D8U A;  4GNG A;  2KGI A;  3V43 A;  4B7Y C;  1RMD A;  4R2Y A;  1T1H A;  4YBM A;  1XWH A;  5LKT A;  3L11 A;  3LVQ E;  3M7K A;  4Z0R A;  3DWD A;  2VJE B;  1DVP A;  3LJU X;  2DJA A;  1X4U A;  4LK9 A; 
#chains in the Genus database with same CATH homology
 3SOU A;  5KH3 A;  2DX8 A;  2KYU A;  3RTR B;  1JM7 B;  1F62 A;  4FK5 A;  2K1J A;  4I7B A;  5B76 A;  2YYR A;  2LXH C;  4YC9 A;  5G05 B;  3KNV A;  4LJN A;  2KRE A;  5C13 A;  2KWK A;  4LKA A;  1WEP A;  2LXP C;  5I3L A;  5KH7 A;  3HCU A;  3O36 A;  5H1U A;  2YUC A;  2Y1N A;  4PPE A;  1K2F A;  4FO9 A;  5FB1 A;  5D1M B;  5G0F A;  4A4B A;  2L5U A;  3RPG B;  4BHW A;  2ECI A;  2JRJ A;  5LKU A;  2M6M A;  4YAD A;  1WES A;  5FB0 A;  3IHP A;  2VPD A;  2IDA A;  2H0D A;  3N9O A;  3LRQ A;  5B8D A;  2YSJ A;  4CA1 A;  2I50 A;  3ZPV E;  4UI9 B;  2RSD A;  2RI7 A;  3I2D A;  3O34 A;  2L43 A;  2YU4 A;  4R8P K;  3N9N A;  3LQJ A;  2VPB A;  4TKP B;  1WEQ A;  2ECW A;  3L1X A;  2E6R A;  4GNF A;  5C11 A;  2KWN A;  5DIN A;  2KU3 A;  2G43 A;  2ZET C;  4S3O C;  2Y43 A;  3ZVY A;  4B86 C;  2YW8 A;  3C5K A;  2AN6 A;  1WEE A;  5LKX A;  2D8S A;  3HCS A;  2L80 A;  1FP0 A;  1WEM A;  2YQM A;  1WFK A;  4YAB A;  4AYC A;  2LGG A;  1U6G B;  1HYI A;  3KV6 A;  4WZ3 B;  2L75 A;  3MHH A;  4I7D A;  2M85 A;  2PNX A;  5H9M A;  3O33 A;  2QIC A;  1Z2Q A;  1ZBD B;  5FER A;  4CCG X;  1Z6U A;  2YQL A;  4QF3 A;  2VNF A;  4FIP A;  2HYE D;  2YHO A;  2KIZ A;  4PTB A;  5B75 A;  2JMI A;  4O64 A;  4AP4 A;  4A0C D;  2EA6 A;  5B78 A;  2MA5 A;  2F6J A;  1N87 A;  2HDP A;  4V3L C;  2KR4 A;  2FUI A;  3M99 A;  3M63 A;  2CKL A;  4X3G A;  3L1Z B;  4S3O B;  5B77 A;  1WEO A;  3T6R A;  2VJF A;  1VFY A;  3ZPV 1;  5JG6 A;  2LV9 A;  5KH9 A;  3U5M A;  2EGP A;  3NG2 A;  1E4U A;  3ZNI A;  4YAT A;  4P5O B;  4AYC B;  3T7L A;  1LDK C;  2MT5 A;  3VK6 A;  3DPL R;  2MA6 A;  3N9Q A;  2ECT A;  5J3X A;  3C6W A;  1X4I A;  2F42 A;  3EB6 A;  1WGM A;  4V3K C;  3LQI A;  2XEU A;  2C2V S;  4GND A;  5LKZ A;  2VJE A;  2G6Q A;  3N9L A;  2BAY A;  1CHC A;  2MD8 C;  1BOR A;  5H1V A;  2LGL A;  2UZG A;  4W4U A;  3U5P A;  3U5N A;  4WZ2 A;  4LAD B;  4I7C A;  4F52 B;  4UP5 A;  4FJC A;  4XI1 A;  2OXQ C;  2KGG A;  2YT5 A;  4QF2 A;  2MNY A;  4ZQL A;  2CSY A;  4BBQ A;  3M62 A;  2JMJ A;  1WEU A;  2KWJ A;  1WEV A;  4AUQ B;  3PUQ A;  2VJF B;  3KQI A;  1FBV A;  2PUY A;  3MHS A;  3QZV A;  5TDR A;  3SOX A;  3ASL A;  2VPG A;  2KFT A;  2CSZ A;  1JOC A;  1LDJ B;  3O7A A;  2H0D B;  3GV4 A;  4WZ0 A;  2FUU A;  2FSA A;  1WEN A;  2CT2 A;  3N9M A;  2E6S A;  4MVT A;  2MD7 B;  3PHD A;  5G04 B;  2ECG A;  2LQ6 A;  2Y1M A;  2ECJ A;  5TAB A;  2EOD A;  1G25 A;  2K17 A;  4GNE A;  4WA6 A;  4IC3 A;  3FL2 A;  2F6N A;  5TRB A;  2QJ0 A;  5H1T A;  1MM2 A;  2C2L A;  4L7X A;  4MSX A;  4A49 A;  1VD4 A;  2ECV A;  3N9P A;  4ZDT A;  2K4D A;  4L58 A;  4YAX A;  2LRI C;  3ZTG A;  5D1L B;  2VPE A;  3SOW A;  2ECN A;  2MNZ A;  2NAA A;  1VYX A;  5DKA A;  5LCW B;  4AVX A;  4Q6F A;  4UP0 A;  2YUR A;  2MIQ A;  3O37 A;  4IC2 A;  1V87 A;  5FEY A;  4GB0 A;  3O70 A;  2YRE A;  4YBS A;  1X4J A;  2M3H A;  4A4C A;  2LN0 A;  2XB1 A;  3PUR A;  5TBN A;  5B79 A;  3U5O A;  1WEW A;  4N3W A;  1JM7 A;  5AIU A;  1WIL A;  3DQV R;  2QIZ A;  3O35 A;  3HTK C;  5AIT A;  4LLB A;  1HYJ A;  4NN2 A;  1WE9 A;  3EB5 A;  2L0B A;  2VP7 A;  2G45 A;  2M1R A;  5EYA F;  3SHB A;  3KV5 A;  4C9Z A;  2KWO A;  3GL6 A;  2CKL B;  3LQH A;  1WIM A;  2LGV A;  4R7E A;  5D1K B;  4YBT A;  4N4F A;  2MUM A;  2LGK A;  3ZYQ A;  2YSM A;  3RPG C;  1MM3 A;  2K16 A;  1IYM A;  4ZUX U;  2YHN A;  2KE1 A;  2JMD A;  2LDR A;  5TDW A;  1Z60 A;  3HCT A;  3ZVZ B;  4GNG A;  2KGI A;  3V43 A;  4B7Y C;  1RMD A;  4R2Y A;  1T1H A;  4YBM A;  1XWH A;  5LKT A;  3L11 A;  2VJE B;  1DVP A;  1X4U A;  4LK9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...