2E6RA

Solution structure of the phd domain in smcy protein
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
92
structure length
92
Chain Sequence
GSSGSSGHSSAQFIDSYICQVCSRGDEDDKLLFCDGCDDNYHIFCLLPPLPEIPRGIWRCPKCILAECKQPPEAFGFEQATQEYSLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Jumonji/ARID domain-containing protein 1D
publication title Solution structure of the PHD domain in SmcY protein
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 7
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2006-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2e6rA00
4V3KC 2YW8A 2C2LA 4A49A 2CT2A 1LDJB 1WFKA 2MA6A 2QICA 3O33A 5B78A 4AUQB 3NG2A 4FJCA 3U5MA 2LGGA 2FUUA 2JMDA 5I3LA 4WZ2A 4BHWA 4L7XA 3PURA 1IYMA 3RPGB 4R2YA 5FEYA 3L1ZB 2YSMA 5LKXA 4B86C 3IHPA 5D1LB 4F52B 2LGVA 4IC2A 4YABA 3U5PA 1WEOA 2AN6A 4I7CA 2DX8A 2MUMA 2I50A 1WENA 1WIMA 4MSXA 3ZNIA 4X3GA 1VYXA 2KGGA 3O37A 5G0FA 3QZVA 2PNXA 1VD4A 3O36A 2HDPA 3O34A 5LKTA 3M99A 1BORA 2KWJA 5TDRA 5G05B 1E4UA 2NAAA 2ECWA 2RSDA 4R7EA 5TBNA 4V3LC 1WESA 2D8SA 4S3OB 4YBSA 3MHHA 2L75A 2KIZA 1HYJA 3O35A 3M63A 2LQ6A 2EA6A 1G25A 3C5KA 4YATA 3O70A 4AP4A 2F6JA 4IC3A 4CA1A 2M6MA 2VPEA 2KR4A 4LJNA 2L5UA 2PUYA 2MIQA 5J3XA 4FK5A 1HYIA 4QF2A 5H1UA 5C13A 1CHCA 2E6SA 5LKUA 2BAYA 3N9OA 2MD8C 3SOXA 3SOWA 4YC9A 2KREA 2K16A 4FIPA 5G04B 1MM2A 3LQHA 2CKLB 4GNFA 5H1VA 3N9PA 3N9LA 5TDWA 2F6NA 4BBQA 3L1XA 2K4DA 5B8DA 2YREA 4ZQLA 3O7AA 2ECIA 2FUIA 5DKAA 1WE9A 3L11A 4YBTA 2QIZA 1VFYA 4A0CD 2CKLA 1V87A 3SOUA 3DQVR 2LGKA 2EODA 1X4UA 2G6QA 3ZYQA 4LLBA 3GV4A 1XWHA 4GNEA 2VPGA 5C11A 2KE1A 1U6GB 4CCGX 1WEQA 2L43A 4MVTA 2KWOA 1K2FA 3T6RA 3VK6A 4FO9A 3V43A 1WEMA 4YBMA 2LV9A 4AVXA 1JM7B 2ECVA 2ECTA 1WGMA 2L80A 1FBVA 4UP5A 4QF3A 2L0BA 5FB0A 5KH9A 2YUCA 3KV5A 5AITA 2KFTA 4LADB 4N3WA 2JRJA 1X4JA 1JM7A 1FP0A 4A4BA 2MNZA 2YHNA 2KGIA 1RMDA 2YHOA 5AIUA 3LRQA 4GNGA 5TABA 5B79A 1LDKC 2H0DA 3EB6A 2VPDA 2HYED 1Z6UA 2LXPC 5KH7A 4AYCA 5H1TA 1WEPA 4A4CA 3PHDA 3ZVYA 2VJFA 4O64A 2KWNA 3ZPVE 4YAXA 3U5OA 1WILA 1Z2QA 4I7DA 2XEUA 4NN2A 2LXHC 2K17A 5FB1A 2OXQC 3RTRB 5EYAF 5B75A 4LKAA 3HTKC 5D1KB 2MNYA 3ZPV1 2CSYA 2FSAA 2VP7A 5FERA 2M1RA 2G45A 3KNVA 2Y1MA 4UP0A 4PTBA 2ZETC 3FL2A 2ECJA 2LN0A 2KYUA 3PUQA 1WEEA 2VJEA 4Q6FA 2YSJA 2KWKA 2CSZA 5B76A 4L58A 2ECNA 2LDRA 4P5OB 4B7YC 2YU4A 3ZTGA 3N9NA 4C9ZA 4WZ0A 3LQIA 5D1MB 4PPEA 3HCSA 2UZGA 2Y1NA 5H9MA 1ZBDB 4UI9B 2IDAA 3GL6A 3N9QA 3ZVZB 2G43A 1DVPA 2YQLA 4TKPB 2RI7A 4ZDTA 5B77A 4GB0A 3C6WA 2MA5A 2MD7B 4R8PK 5DINA 2VNFA 3MHSA 4I7BA 3RPGC 4ZUXU 4N4FA 2H0DB 2QJ0A 2Y43A 2LRIC 3HCUA 1WEWA 4AYCB 4XI1A 5KH3A 2VPBA 1F62A 2JMIA 1JOCA 3KV6A 2VJFB 2E6RA 3DPLR 2YQMA 3N9MA 4WZ3B 4WA6A 4LK9A 5JG6A 1T1HA 2KU3A 3KQIA 3T7LA 2M3HA 2YURA 4W4UA 1Z60A 3M62A 2YT5A 2M85A 3HCTA 2F42A 2XB1A 1WEVA 3U5NA 4GNDA 1X4IA 5LCWB 3EB5A 2K1JA 2C2VS 2MT5A 2EGPA 4YADA 3I2DA 3SHBA 2YYRA 3ASLA 1MM3A 4S3OC 2LGLA 2ECGA 2VJEB 2JMJA 5LKZA 3LQJA 5TRBA 1N87A 1WEUA
chains in the Genus database with same CATH superfamily
4V3KC 2YW8A 2C2LA 4A49A 2CT2A 1LDJB 1WFKA 2MA6A 2KKXA 2QICA 3O33A 2JM3A 5B78A 4AUQB 3NG2A 4FJCA 3U5MA 2LGGA 2FUUA 1MBMA 2JMDA 5I3LA 2L7PA 4WZ2A 1DCQA 4Z0RA 4BHWA 4L7XA 3PURA 1IYMA 3RPGB 3FEHA 4R2YA 5FEYA 3L1ZB 2YSMA 5LKXA 4B86C 3M7KA 3IHPA 5D1LB 4F52B 2LGVA 4IC2A 2MKEA 4YABA 3U5PA 1WEOA 2AN6A 4I7CA 2DX8A 2MUMA 2CRRA 2I50A 1WENA 1WIMA 3DWDA 4MSXA 3ZNIA 4X3GA 5SVIA 1VYXA 2KGGA 3O37A 5G0FA 3QZVA 2PNXA 1VD4A 3O36A 2HDPA 3MDBC 2P57A 3O34A 5LKTA 3M99A 1BORA 2KWJA 5TDRA 5G05B 1E4UA 2NAAA 2ECWA 2RSDA 3SUBA 4R7EA 5TBNA 4V3LC 1WESA 4OGEA 2D8SA 4S3OB 4YBSA 3MHHA 2L75A 2KIZA 2CSVA 1HYJA 3O35A 2XOYA 3M63A 2LQ6A 3Q1DA 2EA6A 4H9DA 1G25A 3C5KA 4YATA 3O70A 4AP4A 2F6JA 4IC3A 4QQ4A 4CA1A 2M6MA 2VPEA 2KR4A 3PLWA 4LJNA 2L5UA 2PUYA 2MIQA 5J3XA 4FK5A 1HYIA 4QF2A 5H1UA 5C13A 1CHCA 2E6SA 5LKUA 2BAYA 3N9OA 2MD8C 3SOXA 3SOWA 2YVRA 4YC9A 2KREA 2K16A 4FIPA 5G04B 1MM2A 3LQHA 2CKLB 2D8UA 4GNFA 5H1VA 3N9PA 3N9LA 5TDWA 2F6NA 4BBQA 3LDYA 3L1XA 2K4DA 5B8DA 2YREA 4ZQLA 3O7AA 2ECIA 3LVRE 2FUIA 5DKAA 1WE9A 3L11A 4YBTA 2QIZA 1VFYA 3T9KA 4A0CD 2CKLA 1V87A 3SOUA 3DQVR 2LGKA 2EODA 1X4UA 2G6QA 3ZYQA 4LLBA 3GV4A 1XWHA 3LJUX 4GNEA 2VPGA 5C11A 2KE1A 5SVIB 1U6GB 4CCGX 1WEQA 2L43A 4MVTA 2KWOA 1K2FA 3T6RA 3VK6A 3FAOA 3FM8C 4FO9A 2EGMA 3V43A 1WEMA 3LVQE 4YBMA 4O62A 2EXUA 2LV9A 4AVXA 2DSMA 1JM7B 2ECVA 2ECTA 1WGMA 2L80A 1FBVA 4UP5A 2OWAA 4QF3A 2L0BA 5FB0A 3FJUB 5KH9A 2YUCA 3KV5A 5AITA 2KFTA 4LADB 4N3WA 2JRJA 1X4JA 1JM7A 1FP0A 3H7HA 4A4BA 4Z0OA 2MNZA 2YHNA 2KGIA 1RMDA 2YHOA 5AIUA 3LRQA 4GNGA 5TABA 5B79A 1LDKC 2H0DA 2XOCA 3EB6A 2VPDA 2HYED 1Z6UA 2LXPC 5KH7A 4AYCA 5H1TA 2JUNA 1WEPA 4A4CA 2DJAA 3PHDA 3ZVYA 2VJFA 4O64A 2KWNA 3ZPVE 4YAXA 3U5OA 1WILA 1Z2QA 2M13A 4I7DA 2XEUA 4NN2A 3JUEA 2LXHC 2K17A 5FB1A 2OXQC 3RTRB 3DDTA 5EYAF 2XP0A 5B75A 4LKAA 3HTKC 5D1KB 2MNYA 3ZPV1 2CSYA 2FSAA 2VP7A 5FERA 2M1RA 2G45A 3KNVA 2Y1MA 4UP0A 4PTBA 2ZETC 3FL2A 2ECJA 2LN0A 2KYUA 3PUQA 4OGCA 1WEEA 2VJEA 2XOZA 4Q6FA 2YSJA 2KWKA 5SVYA 2CSZA 5B76A 2CRWA 4L58A 2ECNA 2LDRA 4P5OB 4B7YC 2YU4A 5SVXA 3ZTGA 3N9NA 4C9ZA 4WZ0A 3LQIA 5D1MB 2FFWA 2B0OE 4PPEA 3HCSA 2UZGA 2Y1NA 5H9MA 1ZBDB 4UI9B 2IDAA 3GL6A 3N9QA 3ZVZB 2G43A 1DVPA 2YQLA 4TKPB 2RI7A 4ZDTA 5B77A 4GB0A 3C6WA 2MA5A 2MD7B 4R8PK 3O47A 5DINA 2VNFA 3MHSA 4I7BA 3RPGC 4ZUXU 4N4FA 2H0DB 2QJ0A 2IQJA 2Y43A 2LRIC 3HCUA 1WEWA 4AYCB 4XI1A 2LAUA 5KH3A 2VPBA 3FANA 2JMIA 1F62A 1JOCA 3KV6A 2VJFB 2E6RA 3DPLR 2YQMA 3N9MA 3E2DA 4WZ3B 4WA6A 4LK9A 5JG6A 1T1HA 2KU3A 3KQIA 2CONA 3T7LA 2M3HA 2YURA 4W4UA 1Z60A 3M62A 2YT5A 2M85A 3HCTA 2F42A 2XB1A 1WEVA 3U5NA 4GNDA 1X4IA 5LCWB 3EB5A 2K1JA 2E61A 2C2VS 2RR4A 2MT5A 2EGPA 4YADA 2KKYA 3I2DA 3KDEC 4F1PA 3SHBA 2YYRA 5K3QA 3ASLA 1MM3A 4S3OC 2LGLA 2ECGA 2VJEB 2JMJA 5LKZA 3LQJA 5TRBA 2FD4A 1N87A 1WEUA
chains in the Genus database with same CATH topology
4V3KC 2YW8A 2C2LA 4A49A 2CT2A 1LDJB 1WFKA 2MA6A 2QICA 3O33A 5B78A 4AUQB 3NG2A 4FJCA 3U5MA 2LGGA 2FUUA 2JMDA 5I3LA 4WZ2A 4BHWA 4L7XA 3PURA 1IYMA 3RPGB 4R2YA 5FEYA 3L1ZB 2YSMA 5LKXA 4B86C 3IHPA 5D1LB 4F52B 2LGVA 4IC2A 4YABA 3U5PA 1WEOA 2AN6A 4I7CA 2DX8A 2MUMA 2I50A 1WENA 1WIMA 4MSXA 3ZNIA 4X3GA 1VYXA 2KGGA 3O37A 5G0FA 3QZVA 2PNXA 1VD4A 3O36A 2HDPA 3O34A 5LKTA 3M99A 1BORA 2KWJA 5TDRA 5G05B 1E4UA 2NAAA 2ECWA 2RSDA 4R7EA 5TBNA 4V3LC 1WESA 2D8SA 4S3OB 4YBSA 3MHHA 2L75A 2KIZA 1HYJA 3O35A 3M63A 2LQ6A 2EA6A 1G25A 3C5KA 4YATA 3O70A 4AP4A 2F6JA 4IC3A 4CA1A 2M6MA 2VPEA 2KR4A 4LJNA 2L5UA 2PUYA 2MIQA 5J3XA 4FK5A 1HYIA 4QF2A 5H1UA 5C13A 1CHCA 2E6SA 5LKUA 2BAYA 3N9OA 2MD8C 3SOXA 3SOWA 4YC9A 2KREA 2K16A 4FIPA 5G04B 1MM2A 3LQHA 2CKLB 4GNFA 5H1VA 3N9PA 3N9LA 5TDWA 2F6NA 4BBQA 3L1XA 2K4DA 5B8DA 2YREA 4ZQLA 3O7AA 2ECIA 2FUIA 5DKAA 1WE9A 3L11A 4YBTA 2QIZA 1VFYA 4A0CD 2CKLA 1V87A 3SOUA 3DQVR 2LGKA 2EODA 1X4UA 2G6QA 3ZYQA 4LLBA 3GV4A 1XWHA 4GNEA 2VPGA 5C11A 2KE1A 1U6GB 4CCGX 1WEQA 2L43A 4MVTA 2KWOA 1K2FA 3T6RA 3VK6A 4FO9A 3V43A 1WEMA 4YBMA 2LV9A 4AVXA 1JM7B 2ECVA 2ECTA 1WGMA 2L80A 1FBVA 4UP5A 4QF3A 2L0BA 5FB0A 5KH9A 2YUCA 3KV5A 5AITA 2KFTA 4LADB 4N3WA 2JRJA 1X4JA 1JM7A 1FP0A 4A4BA 2MNZA 2YHNA 2KGIA 1RMDA 2YHOA 5AIUA 3LRQA 4GNGA 5TABA 5B79A 1LDKC 2H0DA 3EB6A 2VPDA 2HYED 1Z6UA 2LXPC 5KH7A 4AYCA 5H1TA 1WEPA 4A4CA 3PHDA 3ZVYA 2VJFA 4O64A 2KWNA 3ZPVE 4YAXA 3U5OA 1WILA 1Z2QA 4I7DA 2XEUA 4NN2A 2LXHC 2K17A 5FB1A 2OXQC 3RTRB 5EYAF 5B75A 4LKAA 3HTKC 5D1KB 2MNYA 3ZPV1 2CSYA 2FSAA 2VP7A 5FERA 2M1RA 2G45A 3KNVA 2Y1MA 4UP0A 4PTBA 2ZETC 3FL2A 2ECJA 2LN0A 2KYUA 3PUQA 1WEEA 2VJEA 4Q6FA 2YSJA 2KWKA 2CSZA 5B76A 4L58A 2ECNA 2LDRA 4P5OB 4B7YC 2YU4A 3ZTGA 3N9NA 4C9ZA 4WZ0A 3LQIA 5D1MB 4PPEA 3HCSA 2UZGA 2Y1NA 5H9MA 1ZBDB 4UI9B 2IDAA 3GL6A 3N9QA 3ZVZB 2G43A 1DVPA 2YQLA 4TKPB 2RI7A 4ZDTA 5B77A 4GB0A 3C6WA 2MA5A 2MD7B 4R8PK 5DINA 2VNFA 3MHSA 4I7BA 3RPGC 4ZUXU 4N4FA 2H0DB 2QJ0A 2Y43A 2LRIC 3HCUA 1WEWA 4AYCB 4XI1A 5KH3A 2VPBA 1F62A 2JMIA 1JOCA 3KV6A 2VJFB 2E6RA 3DPLR 2YQMA 3N9MA 4WZ3B 4WA6A 4LK9A 5JG6A 1T1HA 2KU3A 3KQIA 3T7LA 2M3HA 2YURA 4W4UA 1Z60A 3M62A 2YT5A 2M85A 3HCTA 2F42A 2XB1A 1WEVA 3U5NA 4GNDA 1X4IA 5LCWB 3EB5A 2K1JA 2C2VS 2MT5A 2EGPA 4YADA 3I2DA 3SHBA 2YYRA 3ASLA 1MM3A 4S3OC 2LGLA 2ECGA 2VJEB 2JMJA 5LKZA 3LQJA 5TRBA 1N87A 1WEUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4V3K C;  2YW8 A;  2C2L A;  4A49 A;  2CT2 A;  1LDJ B;  1WFK A;  2MA6 A;  2QIC A;  3O33 A;  5B78 A;  4AUQ B;  3NG2 A;  4FJC A;  3U5M A;  2LGG A;  2FUU A;  2JMD A;  5I3L A;  4WZ2 A;  4BHW A;  4L7X A;  3PUR A;  1IYM A;  3RPG B;  4R2Y A;  5FEY A;  3L1Z B;  2YSM A;  5LKX A;  4B86 C;  3IHP A;  5D1L B;  4F52 B;  2LGV A;  4IC2 A;  4YAB A;  3U5P A;  1WEO A;  2AN6 A;  4I7C A;  2DX8 A;  2MUM A;  2I50 A;  1WEN A;  1WIM A;  4MSX A;  3ZNI A;  4X3G A;  1VYX A;  2KGG A;  3O37 A;  5G0F A;  3QZV A;  2PNX A;  1VD4 A;  3O36 A;  2HDP A;  3O34 A;  5LKT A;  3M99 A;  1BOR A;  2KWJ A;  5TDR A;  5G05 B;  1E4U A;  2NAA A;  2ECW A;  2RSD A;  4R7E A;  5TBN A;  4V3L C;  1WES A;  2D8S A;  4S3O B;  4YBS A;  3MHH A;  2L75 A;  2KIZ A;  1HYJ A;  3O35 A;  3M63 A;  2LQ6 A;  2EA6 A;  1G25 A;  3C5K A;  4YAT A;  3O70 A;  4AP4 A;  2F6J A;  4IC3 A;  4CA1 A;  2M6M A;  2VPE A;  2KR4 A;  4LJN A;  2L5U A;  2PUY A;  2MIQ A;  5J3X A;  4FK5 A;  1HYI A;  4QF2 A;  5H1U A;  5C13 A;  1CHC A;  2E6S A;  5LKU A;  2BAY A;  3N9O A;  2MD8 C;  3SOX A;  3SOW A;  4YC9 A;  2KRE A;  2K16 A;  4FIP A;  5G04 B;  1MM2 A;  3LQH A;  2CKL B;  4GNF A;  5H1V A;  3N9P A;  3N9L A;  5TDW A;  2F6N A;  4BBQ A;  3L1X A;  2K4D A;  5B8D A;  2YRE A;  4ZQL A;  3O7A A;  2ECI A;  2FUI A;  5DKA A;  1WE9 A;  3L11 A;  4YBT A;  2QIZ A;  1VFY A;  4A0C D;  2CKL A;  1V87 A;  3SOU A;  3DQV R;  2LGK A;  2EOD A;  1X4U A;  2G6Q A;  3ZYQ A;  4LLB A;  3GV4 A;  1XWH A;  4GNE A;  2VPG A;  5C11 A;  2KE1 A;  1U6G B;  4CCG X;  1WEQ A;  2L43 A;  4MVT A;  2KWO A;  1K2F A;  3T6R A;  3VK6 A;  4FO9 A;  3V43 A;  1WEM A;  4YBM A;  2LV9 A;  4AVX A;  1JM7 B;  2ECV A;  2ECT A;  1WGM A;  2L80 A;  1FBV A;  4UP5 A;  4QF3 A;  2L0B A;  5FB0 A;  5KH9 A;  2YUC A;  3KV5 A;  5AIT A;  2KFT A;  4LAD B;  4N3W A;  2JRJ A;  1X4J A;  1JM7 A;  1FP0 A;  4A4B A;  2MNZ A;  2YHN A;  2KGI A;  1RMD A;  2YHO A;  5AIU A;  3LRQ A;  4GNG A;  5TAB A;  5B79 A;  1LDK C;  2H0D A;  3EB6 A;  2VPD A;  2HYE D;  1Z6U A;  2LXP C;  5KH7 A;  4AYC A;  5H1T A;  1WEP A;  4A4C A;  3PHD A;  3ZVY A;  2VJF A;  4O64 A;  2KWN A;  3ZPV E;  4YAX A;  3U5O A;  1WIL A;  1Z2Q A;  4I7D A;  2XEU A;  4NN2 A;  2LXH C;  2K17 A;  5FB1 A;  2OXQ C;  3RTR B;  5EYA F;  5B75 A;  4LKA A;  3HTK C;  5D1K B;  2MNY A;  3ZPV 1;  2CSY A;  2FSA A;  2VP7 A;  5FER A;  2M1R A;  2G45 A;  3KNV A;  2Y1M A;  4UP0 A;  4PTB A;  2ZET C;  3FL2 A;  2ECJ A;  2LN0 A;  2KYU A;  3PUQ A;  1WEE A;  2VJE A;  4Q6F A;  2YSJ A;  2KWK A;  2CSZ A;  5B76 A;  4L58 A;  2ECN A;  2LDR A;  4P5O B;  4B7Y C;  2YU4 A;  3ZTG A;  3N9N A;  4C9Z A;  4WZ0 A;  3LQI A;  5D1M B;  4PPE A;  3HCS A;  2UZG A;  2Y1N A;  5H9M A;  1ZBD B;  4UI9 B;  2IDA A;  3GL6 A;  3N9Q A;  3ZVZ B;  2G43 A;  1DVP A;  2YQL A;  4TKP B;  2RI7 A;  4ZDT A;  5B77 A;  4GB0 A;  3C6W A;  2MA5 A;  2MD7 B;  4R8P K;  5DIN A;  2VNF A;  3MHS A;  4I7B A;  3RPG C;  4ZUX U;  4N4F A;  2H0D B;  2QJ0 A;  2Y43 A;  2LRI C;  3HCU A;  1WEW A;  4AYC B;  4XI1 A;  5KH3 A;  2VPB A;  1F62 A;  2JMI A;  1JOC A;  3KV6 A;  2VJF B;  2E6R A;  3DPL R;  2YQM A;  3N9M A;  4WZ3 B;  4WA6 A;  4LK9 A;  5JG6 A;  1T1H A;  2KU3 A;  3KQI A;  3T7L A;  2M3H A;  2YUR A;  4W4U A;  1Z60 A;  3M62 A;  2YT5 A;  2M85 A;  3HCT A;  2F42 A;  2XB1 A;  1WEV A;  3U5N A;  4GND A;  1X4I A;  5LCW B;  3EB5 A;  2K1J A;  2C2V S;  2MT5 A;  2EGP A;  4YAD A;  3I2D A;  3SHB A;  2YYR A;  3ASL A;  1MM3 A;  4S3O C;  2LGL A;  2ECG A;  2VJE B;  2JMJ A;  5LKZ A;  3LQJ A;  5TRB A;  1N87 A;  1WEU A; 
#chains in the Genus database with same CATH topology
 4V3K C;  2YW8 A;  2C2L A;  4A49 A;  2CT2 A;  1LDJ B;  1WFK A;  2MA6 A;  2KKX A;  2QIC A;  3O33 A;  2JM3 A;  5B78 A;  4AUQ B;  3NG2 A;  4FJC A;  3U5M A;  2LGG A;  2FUU A;  1MBM A;  2JMD A;  5I3L A;  2L7P A;  4WZ2 A;  1DCQ A;  4Z0R A;  4BHW A;  4L7X A;  3PUR A;  1IYM A;  3RPG B;  3FEH A;  4R2Y A;  5FEY A;  3L1Z B;  2YSM A;  5LKX A;  4B86 C;  3M7K A;  3IHP A;  5D1L B;  4F52 B;  2LGV A;  4IC2 A;  2MKE A;  4YAB A;  3U5P A;  1WEO A;  2AN6 A;  4I7C A;  2DX8 A;  2MUM A;  2CRR A;  2I50 A;  1WEN A;  1WIM A;  3DWD A;  4MSX A;  3ZNI A;  4X3G A;  5SVI A;  1VYX A;  2KGG A;  3O37 A;  5G0F A;  3QZV A;  2PNX A;  1VD4 A;  3O36 A;  2HDP A;  3MDB C;  2P57 A;  3O34 A;  5LKT A;  3M99 A;  1BOR A;  2KWJ A;  5TDR A;  5G05 B;  1E4U A;  2NAA A;  2ECW A;  2RSD A;  3SUB A;  4R7E A;  5TBN A;  4V3L C;  1WES A;  4OGE A;  2D8S A;  4S3O B;  4YBS A;  3MHH A;  2L75 A;  2KIZ A;  2CSV A;  1HYJ A;  3O35 A;  2XOY A;  3M63 A;  2LQ6 A;  3Q1D A;  2EA6 A;  4H9D A;  1G25 A;  3C5K A;  4YAT A;  3O70 A;  4AP4 A;  2F6J A;  4IC3 A;  4QQ4 A;  4CA1 A;  2M6M A;  2VPE A;  2KR4 A;  3PLW A;  4LJN A;  2L5U A;  2PUY A;  2MIQ A;  5J3X A;  4FK5 A;  1HYI A;  4QF2 A;  5H1U A;  5C13 A;  1CHC A;  2E6S A;  5LKU A;  2BAY A;  3N9O A;  2MD8 C;  3SOX A;  3SOW A;  2YVR A;  4YC9 A;  2KRE A;  2K16 A;  4FIP A;  5G04 B;  1MM2 A;  3LQH A;  2CKL B;  2D8U A;  4GNF A;  5H1V A;  3N9P A;  3N9L A;  5TDW A;  2F6N A;  4BBQ A;  3LDY A;  3L1X A;  2K4D A;  5B8D A;  2YRE A;  4ZQL A;  3O7A A;  2ECI A;  3LVR E;  2FUI A;  5DKA A;  1WE9 A;  3L11 A;  4YBT A;  2QIZ A;  1VFY A;  3T9K A;  4A0C D;  2CKL A;  1V87 A;  3SOU A;  3DQV R;  2LGK A;  2EOD A;  1X4U A;  2G6Q A;  3ZYQ A;  4LLB A;  3GV4 A;  1XWH A;  3LJU X;  4GNE A;  2VPG A;  5C11 A;  2KE1 A;  5SVI B;  1U6G B;  4CCG X;  1WEQ A;  2L43 A;  4MVT A;  2KWO A;  1K2F A;  3T6R A;  3VK6 A;  3FAO A;  3FM8 C;  4FO9 A;  2EGM A;  3V43 A;  1WEM A;  3LVQ E;  4YBM A;  4O62 A;  2EXU A;  2LV9 A;  4AVX A;  2DSM A;  1JM7 B;  2ECV A;  2ECT A;  1WGM A;  2L80 A;  1FBV A;  4UP5 A;  2OWA A;  4QF3 A;  2L0B A;  5FB0 A;  3FJU B;  5KH9 A;  2YUC A;  3KV5 A;  5AIT A;  2KFT A;  4LAD B;  4N3W A;  2JRJ A;  1X4J A;  1JM7 A;  1FP0 A;  3H7H A;  4A4B A;  4Z0O A;  2MNZ A;  2YHN A;  2KGI A;  1RMD A;  2YHO A;  5AIU A;  3LRQ A;  4GNG A;  5TAB A;  5B79 A;  1LDK C;  2H0D A;  2XOC A;  3EB6 A;  2VPD A;  2HYE D;  1Z6U A;  2LXP C;  5KH7 A;  4AYC A;  5H1T A;  2JUN A;  1WEP A;  4A4C A;  2DJA A;  3PHD A;  3ZVY A;  2VJF A;  4O64 A;  2KWN A;  3ZPV E;  4YAX A;  3U5O A;  1WIL A;  1Z2Q A;  2M13 A;  4I7D A;  2XEU A;  4NN2 A;  3JUE A;  2LXH C;  2K17 A;  5FB1 A;  2OXQ C;  3RTR B;  3DDT A;  5EYA F;  2XP0 A;  5B75 A;  4LKA A;  3HTK C;  5D1K B;  2MNY A;  3ZPV 1;  2CSY A;  2FSA A;  2VP7 A;  5FER A;  2M1R A;  2G45 A;  3KNV A;  2Y1M A;  4UP0 A;  4PTB A;  2ZET C;  3FL2 A;  2ECJ A;  2LN0 A;  2KYU A;  3PUQ A;  4OGC A;  1WEE A;  2VJE A;  2XOZ A;  4Q6F A;  2YSJ A;  2KWK A;  5SVY A;  2CSZ A;  5B76 A;  2CRW A;  4L58 A;  2ECN A;  2LDR A;  4P5O B;  4B7Y C;  2YU4 A;  5SVX A;  3ZTG A;  3N9N A;  4C9Z A;  4WZ0 A;  3LQI A;  5D1M B;  2FFW A;  2B0O E;  4PPE A;  3HCS A;  2UZG A;  2Y1N A;  5H9M A;  1ZBD B;  4UI9 B;  2IDA A;  3GL6 A;  3N9Q A;  3ZVZ B;  2G43 A;  1DVP A;  2YQL A;  4TKP B;  2RI7 A;  4ZDT A;  5B77 A;  4GB0 A;  3C6W A;  2MA5 A;  2MD7 B;  4R8P K;  3O47 A;  5DIN A;  2VNF A;  3MHS A;  4I7B A;  3RPG C;  4ZUX U;  4N4F A;  2H0D B;  2QJ0 A;  2IQJ A;  2Y43 A;  2LRI C;  3HCU A;  1WEW A;  4AYC B;  4XI1 A;  2LAU A;  5KH3 A;  2VPB A;  3FAN A;  2JMI A;  1F62 A;  1JOC A;  3KV6 A;  2VJF B;  2E6R A;  3DPL R;  2YQM A;  3N9M A;  3E2D A;  4WZ3 B;  4WA6 A;  4LK9 A;  5JG6 A;  1T1H A;  2KU3 A;  3KQI A;  2CON A;  3T7L A;  2M3H A;  2YUR A;  4W4U A;  1Z60 A;  3M62 A;  2YT5 A;  2M85 A;  3HCT A;  2F42 A;  2XB1 A;  1WEV A;  3U5N A;  4GND A;  1X4I A;  5LCW B;  3EB5 A;  2K1J A;  2E61 A;  2C2V S;  2RR4 A;  2MT5 A;  2EGP A;  4YAD A;  2KKY A;  3I2D A;  3KDE C;  4F1P A;  3SHB A;  2YYR A;  5K3Q A;  3ASL A;  1MM3 A;  4S3O C;  2LGL A;  2ECG A;  2VJE B;  2JMJ A;  5LKZ A;  3LQJ A;  5TRB A;  2FD4 A;  1N87 A;  1WEU A; 
#chains in the Genus database with same CATH homology
 4V3K C;  2YW8 A;  2C2L A;  4A49 A;  2CT2 A;  1LDJ B;  1WFK A;  2MA6 A;  2QIC A;  3O33 A;  5B78 A;  4AUQ B;  3NG2 A;  4FJC A;  3U5M A;  2LGG A;  2FUU A;  2JMD A;  5I3L A;  4WZ2 A;  4BHW A;  4L7X A;  3PUR A;  1IYM A;  3RPG B;  4R2Y A;  5FEY A;  3L1Z B;  2YSM A;  5LKX A;  4B86 C;  3IHP A;  5D1L B;  4F52 B;  2LGV A;  4IC2 A;  4YAB A;  3U5P A;  1WEO A;  2AN6 A;  4I7C A;  2DX8 A;  2MUM A;  2I50 A;  1WEN A;  1WIM A;  4MSX A;  3ZNI A;  4X3G A;  1VYX A;  2KGG A;  3O37 A;  5G0F A;  3QZV A;  2PNX A;  1VD4 A;  3O36 A;  2HDP A;  3O34 A;  5LKT A;  3M99 A;  1BOR A;  2KWJ A;  5TDR A;  5G05 B;  1E4U A;  2NAA A;  2ECW A;  2RSD A;  4R7E A;  5TBN A;  4V3L C;  1WES A;  2D8S A;  4S3O B;  4YBS A;  3MHH A;  2L75 A;  2KIZ A;  1HYJ A;  3O35 A;  3M63 A;  2LQ6 A;  2EA6 A;  1G25 A;  3C5K A;  4YAT A;  3O70 A;  4AP4 A;  2F6J A;  4IC3 A;  4CA1 A;  2M6M A;  2VPE A;  2KR4 A;  4LJN A;  2L5U A;  2PUY A;  2MIQ A;  5J3X A;  4FK5 A;  1HYI A;  4QF2 A;  5H1U A;  5C13 A;  1CHC A;  2E6S A;  5LKU A;  2BAY A;  3N9O A;  2MD8 C;  3SOX A;  3SOW A;  4YC9 A;  2KRE A;  2K16 A;  4FIP A;  5G04 B;  1MM2 A;  3LQH A;  2CKL B;  4GNF A;  5H1V A;  3N9P A;  3N9L A;  5TDW A;  2F6N A;  4BBQ A;  3L1X A;  2K4D A;  5B8D A;  2YRE A;  4ZQL A;  3O7A A;  2ECI A;  2FUI A;  5DKA A;  1WE9 A;  3L11 A;  4YBT A;  2QIZ A;  1VFY A;  4A0C D;  2CKL A;  1V87 A;  3SOU A;  3DQV R;  2LGK A;  2EOD A;  1X4U A;  2G6Q A;  3ZYQ A;  4LLB A;  3GV4 A;  1XWH A;  4GNE A;  2VPG A;  5C11 A;  2KE1 A;  1U6G B;  4CCG X;  1WEQ A;  2L43 A;  4MVT A;  2KWO A;  1K2F A;  3T6R A;  3VK6 A;  4FO9 A;  3V43 A;  1WEM A;  4YBM A;  2LV9 A;  4AVX A;  1JM7 B;  2ECV A;  2ECT A;  1WGM A;  2L80 A;  1FBV A;  4UP5 A;  4QF3 A;  2L0B A;  5FB0 A;  5KH9 A;  2YUC A;  3KV5 A;  5AIT A;  2KFT A;  4LAD B;  4N3W A;  2JRJ A;  1X4J A;  1JM7 A;  1FP0 A;  4A4B A;  2MNZ A;  2YHN A;  2KGI A;  1RMD A;  2YHO A;  5AIU A;  3LRQ A;  4GNG A;  5TAB A;  5B79 A;  1LDK C;  2H0D A;  3EB6 A;  2VPD A;  2HYE D;  1Z6U A;  2LXP C;  5KH7 A;  4AYC A;  5H1T A;  1WEP A;  4A4C A;  3PHD A;  3ZVY A;  2VJF A;  4O64 A;  2KWN A;  3ZPV E;  4YAX A;  3U5O A;  1WIL A;  1Z2Q A;  4I7D A;  2XEU A;  4NN2 A;  2LXH C;  2K17 A;  5FB1 A;  2OXQ C;  3RTR B;  5EYA F;  5B75 A;  4LKA A;  3HTK C;  5D1K B;  2MNY A;  3ZPV 1;  2CSY A;  2FSA A;  2VP7 A;  5FER A;  2M1R A;  2G45 A;  3KNV A;  2Y1M A;  4UP0 A;  4PTB A;  2ZET C;  3FL2 A;  2ECJ A;  2LN0 A;  2KYU A;  3PUQ A;  1WEE A;  2VJE A;  4Q6F A;  2YSJ A;  2KWK A;  2CSZ A;  5B76 A;  4L58 A;  2ECN A;  2LDR A;  4P5O B;  4B7Y C;  2YU4 A;  3ZTG A;  3N9N A;  4C9Z A;  4WZ0 A;  3LQI A;  5D1M B;  4PPE A;  3HCS A;  2UZG A;  2Y1N A;  5H9M A;  1ZBD B;  4UI9 B;  2IDA A;  3GL6 A;  3N9Q A;  3ZVZ B;  2G43 A;  1DVP A;  2YQL A;  4TKP B;  2RI7 A;  4ZDT A;  5B77 A;  4GB0 A;  3C6W A;  2MA5 A;  2MD7 B;  4R8P K;  5DIN A;  2VNF A;  3MHS A;  4I7B A;  3RPG C;  4ZUX U;  4N4F A;  2H0D B;  2QJ0 A;  2Y43 A;  2LRI C;  3HCU A;  1WEW A;  4AYC B;  4XI1 A;  5KH3 A;  2VPB A;  1F62 A;  2JMI A;  1JOC A;  3KV6 A;  2VJF B;  2E6R A;  3DPL R;  2YQM A;  3N9M A;  4WZ3 B;  4WA6 A;  4LK9 A;  5JG6 A;  1T1H A;  2KU3 A;  3KQI A;  3T7L A;  2M3H A;  2YUR A;  4W4U A;  1Z60 A;  3M62 A;  2YT5 A;  2M85 A;  3HCT A;  2F42 A;  2XB1 A;  1WEV A;  3U5N A;  4GND A;  1X4I A;  5LCW B;  3EB5 A;  2K1J A;  2C2V S;  2MT5 A;  2EGP A;  4YAD A;  3I2D A;  3SHB A;  2YYR A;  3ASL A;  1MM3 A;  4S3O C;  2LGL A;  2ECG A;  2VJE B;  2JMJ A;  5LKZ A;  3LQJ A;  5TRB A;  1N87 A;  1WEU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...