2E6RA

Solution structure of the phd domain in smcy protein
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
92
structure length
92
Chain Sequence
b'GSSGSSGHSSAQFIDSYICQVCSRGDEDDKLLFCDGCDDNYHIFCLLPPLPEIPRGIWRCPKCILAECKQPPEAFGFEQATQEYSLSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Jumonji/ARID domain-containing protein 1D
publication title Solution structure of the PHD domain in SmcY protein
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 7
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2006-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2e6rA00
2M3HA 1X4UA 5B8DA 5FERA 2YUCA 1WEWA 2K16A 1Z2QA 2MT5A 2YSMA 2D8SA 2K17A 2XB1A 3N9QA 5B77A 3EB6A 3LQIA 5I3LA 2EGPA 4QF3A 4GNEA 4S3OC 2YW8A 5B75A 3PHDA 4QF2A 4LK9A 2DX8A 3LQHA 2FUUA 1V87A 5G0FA 3FL2A 3N9LA 2KWOA 1RMDA 2HDPA 4IC3A 2L75A 3DPLR 2MNZA 2LRIC 2E6SA 2VJEB 1XWHA 2ZETC 3KV5A 1WILA 2JMDA 4V3KC 5KH9A 1ZBDB 2KFTA 2CT2A 2H0DA 3T6RA 2LGKA 2YQLA 4WZ2A 3SOUA 1WFKA 4AP4A 5EYAF 5LKUA 4GB0A 2ECVA 3ZYQA 3HCUA 4N3WA 3ZVZB 1WGMA 5LKTA 4YC9A 2YURA 4GNDA 2KWJA 2F42A 3GV4A 5TBNA 1G25A 2RSDA 4LKAA 5B76A 2K4DA 3ZNIA 4P5OB 4YADA 4FK5A 1F62A 3SOXA 3U5MA 2ECJA 5C11A 5H9MA 2HYED 2ECTA 2YREA 5H1UA 2RI7A 1VD4A 2OXQC 2EA6A 2LN0A 3N9MA 2M85A 3T7LA 4UI9B 1WEPA 1FP0A 4YATA 5KH3A 3L1ZB 2H0DB 1WE9A 1X4JA 3O36A 2VJFA 4WZ3B 2XEUA 2MUMA 3O7AA 4PTBA 2ECNA 3U5OA 1MM3A 4ZQLA 2CSZA 2KWNA 3ZVYA 2LV9A 2E6RA 4FO9A 2G43A 3LQJA 5LKXA 2G6QA 1LDJB 2MNYA 4BHWA 2CKLA 4S3OB 3LRQA 1WENA 4CA1A 3DQVR 2C2VS 3NG2A 3HCTA 3RPGC 5G04B 1T1HA 2QICA 2F6NA 1LDKC 3SHBA 4Q6FA 4MSXA 2KU3A 3L11A 2VJFB 5AITA 4B7YC 3M62A 4I7CA 2F6JA 4W4UA 4ZUXU 5FB0A 3O34A 5DKAA 3ASLA 1WEMA 2ECIA 1WEOA 4YBTA 2KR4A 3U5PA 5TABA 2L0BA 3HTKC 2L80A 2YHOA 2FUIA 4N4FA 4I7DA 4MVTA 2LGVA 5H1VA 3PUQA 3L1XA 4L7XA 2MD8C 5B78A 1JM7A 5C13A 2PUYA 5D1MB 2CSYA 4LJNA 4BBQA 2KWKA 2VNFA 2ECGA 1K2FA 3O37A 5B79A 2YSJA 4PPEA 2VPDA 4UP0A 1X4IA 2QJ0A 3U5NA 2LDRA 4A4CA 1IYMA 5DINA 1CHCA 4YABA 1JOCA 2M6MA 2VPBA 3M99A 4YBMA 2KREA 2YYRA 5TDWA 4FIPA 4A0CD 4NN2A 5FEYA 4L58A 1JM7B 5H1TA 1WESA 2KIZA 3RTRB 3EB5A 3M63A 4R2YA 3C6WA 4B86C 2KGIA 2L5UA 1U6GB 4GNGA 3IHPA 2NAAA 3I2DA 3O33A 3N9PA 3RPGB 5D1KB 3MHSA 4F52B 4AUQB 1WEEA 1WEVA 2G45A 2L43A 2Y1NA 2YU4A 4GNFA 1VYXA 4YBSA 3V43A 1BORA 2YHNA 3QZVA 4A49A 4R7EA 1DVPA 1E4UA 1HYIA 2MA6A 2MA5A 3MHHA 2VPGA 3N9NA 1WEQA 3N9OA 4TKPB 2C2LA 2FSAA 2MIQA 4V3LC 5FB1A 2LGLA 2EODA 1N87A 2CKLB 4LADB 2IDAA 5J3XA 4AYCA 1Z60A 3C5KA 5LKZA 3ZTGA 4LLBA 2YQMA 4UP5A 2KYUA 2ECWA 3O35A 1VFYA 3SOWA 1WIMA 2QIZA 3PURA 3GL6A 1FBVA 2I50A 3O70A 5AIUA 4FJCA 2JMJA 2LQ6A 3KQIA 4R8PK 3ZPVE 3HCSA 2MD7B 1MM2A 2Y1MA 2LXHC 1WEUA 5LCWB 4A4BA 5JG6A 5TRBA 3KNVA 4I7BA 3VK6A 4CCGX 2JMIA 2Y43A 2LGGA 4IC2A 3KV6A 4AYCB 3ZPV1 4X3GA 4YAXA 4AVXA 5D1LB 4WZ0A 2JRJA 2M1RA 4XI1A 2K1JA 2KGGA 4ZDTA 1Z6UA 1HYJA 2AN6A 2VJEA 2PNXA 5G05B 2VP7A 4O64A 4WA6A 2UZGA 5TDRA 2LXPC 2BAYA 4C9ZA 2KE1A 5KH7A 2YT5A 2VPEA
chains in the Genus database with same CATH superfamily
2M3HA 1X4UA 5B8DA 5FERA 2YUCA 1WEWA 2K16A 1Z2QA 2MT5A 2YSMA 2D8SA 2K17A 2XB1A 3N9QA 4O62A 5B77A 3EB6A 3LQIA 5I3LA 2EGPA 4QF3A 4GNEA 4S3OC 2YW8A 5B75A 2B0OE 3PHDA 4QF2A 4LK9A 4QQ4A 3E2DA 3MDBC 2DX8A 3LQHA 2FUUA 1V87A 5G0FA 3FL2A 3N9LA 2KWOA 1RMDA 2HDPA 4IC3A 2L75A 3DPLR 2MNZA 2LRIC 2E6SA 2VJEB 1XWHA 2ZETC 3KV5A 1WILA 2JMDA 4V3KC 3KDEC 5KH9A 1ZBDB 2KFTA 2CT2A 2H0DA 3T6RA 2LGKA 2YQLA 4WZ2A 3SOUA 1WFKA 4AP4A 5EYAF 5LKUA 4GB0A 2ECVA 3ZYQA 3HCUA 4N3WA 3ZVZB 1WGMA 5LKTA 4YC9A 2YURA 4GNDA 2KWJA 2F42A 3GV4A 5TBNA 1G25A 2RSDA 4LKAA 5B76A 2K4DA 3ZNIA 4P5OB 4YADA 4FK5A 1F62A 2EXUA 3SOXA 3U5MA 2ECJA 2XOCA 5C11A 3LDYA 3JUEA 5H9MA 2HYED 2ECTA 2YVRA 2YREA 2CRWA 5H1UA 2RI7A 1VD4A 2OXQC 2EA6A 4F1PA 2P57A 2LN0A 2XOYA 3N9MA 4OGEA 5SVIB 2M85A 3T7LA 4UI9B 1WEPA 1FP0A 4YATA 5KH3A 3L1ZB 2H0DB 1WE9A 1X4JA 3O36A 2VJFA 4WZ3B 2XEUA 2MUMA 3O7AA 4PTBA 2ECNA 3U5OA 1MM3A 4ZQLA 2CSZA 2KWNA 3ZVYA 2LV9A 2E6RA 4FO9A 2G43A 3LQJA 2KKYA 5LKXA 2G6QA 1LDJB 2MNYA 2CSVA 4BHWA 2CKLA 2OWAA 4S3OB 3LRQA 1WENA 3FEHA 4CA1A 3DQVR 2C2VS 3NG2A 3HCTA 3RPGC 5G04B 3O47A 1T1HA 2QICA 2F6NA 1LDKC 3SHBA 4Q6FA 4MSXA 1MBMA 2EGMA 2KU3A 3L11A 2VJFB 5AITA 4B7YC 3M62A 4I7CA 2F6JA 3FJUB 4W4UA 4ZUXU 5FB0A 3O34A 5DKAA 3ASLA 2RR4A 2CONA 1WEMA 2ECIA 1WEOA 4YBTA 2KR4A 3U5PA 5TABA 2L0BA 3HTKC 2MKEA 2L80A 2YHOA 2FUIA 4N4FA 4I7DA 4MVTA 2LGVA 5H1VA 3PUQA 3L1XA 4L7XA 2MD8C 5B78A 1JM7A 5C13A 2PUYA 5D1MB 2CSYA 4LJNA 4BBQA 2KWKA 2DSMA 2VNFA 2ECGA 1K2FA 2L7PA 3O37A 5B79A 2YSJA 5K3QA 4PPEA 2VPDA 4UP0A 1X4IA 2CRRA 2QJ0A 3U5NA 2LDRA 4A4CA 1IYMA 5DINA 2M13A 1CHCA 4YABA 1JOCA 2M6MA 2VPBA 3M99A 4YBMA 2KREA 2YYRA 4Z0OA 3PLWA 5TDWA 2IQJA 5SVXA 4FIPA 2FFWA 4H9DA 4A0CD 3SUBA 4OGCA 2D8UA 4NN2A 5FEYA 3FANA 4L58A 1JM7B 5H1TA 1WESA 2KIZA 3RTRB 3EB5A 2LAUA 3M63A 3FAOA 4R2YA 3C6WA 4B86C 2KGIA 2L5UA 1U6GB 2JUNA 4GNGA 3IHPA 2NAAA 2KKXA 3I2DA 3DWDA 3M7KA 3O33A 3N9PA 3RPGB 5D1KB 3MHSA 4F52B 4AUQB 1WEEA 1WEVA 3Q1DA 2G45A 2L43A 2Y1NA 2YU4A 4GNFA 1VYXA 4YBSA 3V43A 3T9KA 1BORA 2YHNA 3QZVA 4A49A 4R7EA 4Z0RA 1DVPA 1E4UA 1HYIA 2MA6A 2DJAA 2MA5A 3MHHA 2VPGA 3N9NA 1WEQA 3N9OA 4TKPB 2C2LA 2FSAA 2MIQA 4V3LC 5FB1A 2LGLA 5SVYA 3LVQE 5SVIA 2EODA 1N87A 2CKLB 4LADB 2IDAA 5J3XA 4AYCA 1Z60A 3C5KA 5LKZA 3FM8C 3ZTGA 4LLBA 2E61A 2YQMA 4UP5A 2KYUA 2ECWA 3O35A 1VFYA 3SOWA 1WIMA 2QIZA 3PURA 3H7HA 3DDTA 3GL6A 1FBVA 2I50A 3O70A 5AIUA 4FJCA 2JMJA 2JM3A 2LQ6A 3KQIA 4R8PK 2FD4A 3LVRE 3ZPVE 3HCSA 2MD7B 1MM2A 2Y1MA 2LXHC 1WEUA 5LCWB 4A4BA 5JG6A 5TRBA 3KNVA 4I7BA 3VK6A 4CCGX 1DCQA 2JMIA 2Y43A 2LGGA 4IC2A 3KV6A 4AYCB 3ZPV1 4X3GA 4YAXA 4AVXA 5D1LB 4WZ0A 2JRJA 2M1RA 4XI1A 2K1JA 2KGGA 4ZDTA 1Z6UA 1HYJA 2XP0A 2AN6A 2VJEA 2PNXA 2XOZA 5G05B 3LJUX 2VP7A 4O64A 4WA6A 2UZGA 5TDRA 2LXPC 2BAYA 4C9ZA 2KE1A 5KH7A 2YT5A 2VPEA
chains in the Genus database with same CATH topology
2M3HA 1X4UA 5B8DA 5FERA 2YUCA 1WEWA 2K16A 1Z2QA 2MT5A 2YSMA 2D8SA 2K17A 2XB1A 3N9QA 5B77A 3EB6A 3LQIA 5I3LA 2EGPA 4QF3A 4GNEA 4S3OC 2YW8A 5B75A 3PHDA 4QF2A 4LK9A 2DX8A 3LQHA 2FUUA 1V87A 5G0FA 3FL2A 3N9LA 2KWOA 1RMDA 2HDPA 4IC3A 2L75A 3DPLR 2MNZA 2LRIC 2E6SA 2VJEB 1XWHA 2ZETC 3KV5A 1WILA 2JMDA 4V3KC 5KH9A 1ZBDB 2KFTA 2CT2A 2H0DA 3T6RA 2LGKA 2YQLA 4WZ2A 3SOUA 1WFKA 4AP4A 5EYAF 5LKUA 4GB0A 2ECVA 3ZYQA 3HCUA 4N3WA 3ZVZB 1WGMA 5LKTA 4YC9A 2YURA 4GNDA 2KWJA 2F42A 3GV4A 5TBNA 1G25A 2RSDA 4LKAA 5B76A 2K4DA 3ZNIA 4P5OB 4YADA 4FK5A 1F62A 3SOXA 3U5MA 2ECJA 5C11A 5H9MA 2HYED 2ECTA 2YREA 5H1UA 2RI7A 1VD4A 2OXQC 2EA6A 2LN0A 3N9MA 2M85A 3T7LA 4UI9B 1WEPA 1FP0A 4YATA 5KH3A 3L1ZB 2H0DB 1WE9A 1X4JA 3O36A 2VJFA 4WZ3B 2XEUA 2MUMA 3O7AA 4PTBA 2ECNA 3U5OA 1MM3A 4ZQLA 2CSZA 2KWNA 3ZVYA 2LV9A 2E6RA 4FO9A 2G43A 3LQJA 5LKXA 2G6QA 1LDJB 2MNYA 4BHWA 2CKLA 4S3OB 3LRQA 1WENA 4CA1A 3DQVR 2C2VS 3NG2A 3HCTA 3RPGC 5G04B 1T1HA 2QICA 2F6NA 1LDKC 3SHBA 4Q6FA 4MSXA 2KU3A 3L11A 2VJFB 5AITA 4B7YC 3M62A 4I7CA 2F6JA 4W4UA 4ZUXU 5FB0A 3O34A 5DKAA 3ASLA 1WEMA 2ECIA 1WEOA 4YBTA 2KR4A 3U5PA 5TABA 2L0BA 3HTKC 2L80A 2YHOA 2FUIA 4N4FA 4I7DA 4MVTA 2LGVA 5H1VA 3PUQA 3L1XA 4L7XA 2MD8C 5B78A 1JM7A 5C13A 2PUYA 5D1MB 2CSYA 4LJNA 4BBQA 2KWKA 2VNFA 2ECGA 1K2FA 3O37A 5B79A 2YSJA 4PPEA 2VPDA 4UP0A 1X4IA 2QJ0A 3U5NA 2LDRA 4A4CA 1IYMA 5DINA 1CHCA 4YABA 1JOCA 2M6MA 2VPBA 3M99A 4YBMA 2KREA 2YYRA 5TDWA 4FIPA 4A0CD 4NN2A 5FEYA 4L58A 1JM7B 5H1TA 1WESA 2KIZA 3RTRB 3EB5A 3M63A 4R2YA 3C6WA 4B86C 2KGIA 2L5UA 1U6GB 4GNGA 3IHPA 2NAAA 3I2DA 3O33A 3N9PA 3RPGB 5D1KB 3MHSA 4F52B 4AUQB 1WEEA 1WEVA 2G45A 2L43A 2Y1NA 2YU4A 4GNFA 1VYXA 4YBSA 3V43A 1BORA 2YHNA 3QZVA 4A49A 4R7EA 1DVPA 1E4UA 1HYIA 2MA6A 2MA5A 3MHHA 2VPGA 3N9NA 1WEQA 3N9OA 4TKPB 2C2LA 2FSAA 2MIQA 4V3LC 5FB1A 2LGLA 2EODA 1N87A 2CKLB 4LADB 2IDAA 5J3XA 4AYCA 1Z60A 3C5KA 5LKZA 3ZTGA 4LLBA 2YQMA 4UP5A 2KYUA 2ECWA 3O35A 1VFYA 3SOWA 1WIMA 2QIZA 3PURA 3GL6A 1FBVA 2I50A 3O70A 5AIUA 4FJCA 2JMJA 2LQ6A 3KQIA 4R8PK 3ZPVE 3HCSA 2MD7B 1MM2A 2Y1MA 2LXHC 1WEUA 5LCWB 4A4BA 5JG6A 5TRBA 3KNVA 4I7BA 3VK6A 4CCGX 2JMIA 2Y43A 2LGGA 4IC2A 3KV6A 4AYCB 3ZPV1 4X3GA 4YAXA 4AVXA 5D1LB 4WZ0A 2JRJA 2M1RA 4XI1A 2K1JA 2KGGA 4ZDTA 1Z6UA 1HYJA 2AN6A 2VJEA 2PNXA 5G05B 2VP7A 4O64A 4WA6A 2UZGA 5TDRA 2LXPC 2BAYA 4C9ZA 2KE1A 5KH7A 2YT5A 2VPEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M3H A;  1X4U A;  5B8D A;  5FER A;  2YUC A;  1WEW A;  2K16 A;  1Z2Q A;  2MT5 A;  2YSM A;  2D8S A;  2K17 A;  2XB1 A;  3N9Q A;  5B77 A;  3EB6 A;  3LQI A;  5I3L A;  2EGP A;  4QF3 A;  4GNE A;  4S3O C;  2YW8 A;  5B75 A;  3PHD A;  4QF2 A;  4LK9 A;  2DX8 A;  3LQH A;  2FUU A;  1V87 A;  5G0F A;  3FL2 A;  3N9L A;  2KWO A;  1RMD A;  2HDP A;  4IC3 A;  2L75 A;  3DPL R;  2MNZ A;  2LRI C;  2E6S A;  2VJE B;  1XWH A;  2ZET C;  3KV5 A;  1WIL A;  2JMD A;  4V3K C;  5KH9 A;  1ZBD B;  2KFT A;  2CT2 A;  2H0D A;  3T6R A;  2LGK A;  2YQL A;  4WZ2 A;  3SOU A;  1WFK A;  4AP4 A;  5EYA F;  5LKU A;  4GB0 A;  2ECV A;  3ZYQ A;  3HCU A;  4N3W A;  3ZVZ B;  1WGM A;  5LKT A;  4YC9 A;  2YUR A;  4GND A;  2KWJ A;  2F42 A;  3GV4 A;  5TBN A;  1G25 A;  2RSD A;  4LKA A;  5B76 A;  2K4D A;  3ZNI A;  4P5O B;  4YAD A;  4FK5 A;  1F62 A;  3SOX A;  3U5M A;  2ECJ A;  5C11 A;  5H9M A;  2HYE D;  2ECT A;  2YRE A;  5H1U A;  2RI7 A;  1VD4 A;  2OXQ C;  2EA6 A;  2LN0 A;  3N9M A;  2M85 A;  3T7L A;  4UI9 B;  1WEP A;  1FP0 A;  4YAT A;  5KH3 A;  3L1Z B;  2H0D B;  1WE9 A;  1X4J A;  3O36 A;  2VJF A;  4WZ3 B;  2XEU A;  2MUM A;  3O7A A;  4PTB A;  2ECN A;  3U5O A;  1MM3 A;  4ZQL A;  2CSZ A;  2KWN A;  3ZVY A;  2LV9 A;  2E6R A;  4FO9 A;  2G43 A;  3LQJ A;  5LKX A;  2G6Q A;  1LDJ B;  2MNY A;  4BHW A;  2CKL A;  4S3O B;  3LRQ A;  1WEN A;  4CA1 A;  3DQV R;  2C2V S;  3NG2 A;  3HCT A;  3RPG C;  5G04 B;  1T1H A;  2QIC A;  2F6N A;  1LDK C;  3SHB A;  4Q6F A;  4MSX A;  2KU3 A;  3L11 A;  2VJF B;  5AIT A;  4B7Y C;  3M62 A;  4I7C A;  2F6J A;  4W4U A;  4ZUX U;  5FB0 A;  3O34 A;  5DKA A;  3ASL A;  1WEM A;  2ECI A;  1WEO A;  4YBT A;  2KR4 A;  3U5P A;  5TAB A;  2L0B A;  3HTK C;  2L80 A;  2YHO A;  2FUI A;  4N4F A;  4I7D A;  4MVT A;  2LGV A;  5H1V A;  3PUQ A;  3L1X A;  4L7X A;  2MD8 C;  5B78 A;  1JM7 A;  5C13 A;  2PUY A;  5D1M B;  2CSY A;  4LJN A;  4BBQ A;  2KWK A;  2VNF A;  2ECG A;  1K2F A;  3O37 A;  5B79 A;  2YSJ A;  4PPE A;  2VPD A;  4UP0 A;  1X4I A;  2QJ0 A;  3U5N A;  2LDR A;  4A4C A;  1IYM A;  5DIN A;  1CHC A;  4YAB A;  1JOC A;  2M6M A;  2VPB A;  3M99 A;  4YBM A;  2KRE A;  2YYR A;  5TDW A;  4FIP A;  4A0C D;  4NN2 A;  5FEY A;  4L58 A;  1JM7 B;  5H1T A;  1WES A;  2KIZ A;  3RTR B;  3EB5 A;  3M63 A;  4R2Y A;  3C6W A;  4B86 C;  2KGI A;  2L5U A;  1U6G B;  4GNG A;  3IHP A;  2NAA A;  3I2D A;  3O33 A;  3N9P A;  3RPG B;  5D1K B;  3MHS A;  4F52 B;  4AUQ B;  1WEE A;  1WEV A;  2G45 A;  2L43 A;  2Y1N A;  2YU4 A;  4GNF A;  1VYX A;  4YBS A;  3V43 A;  1BOR A;  2YHN A;  3QZV A;  4A49 A;  4R7E A;  1DVP A;  1E4U A;  1HYI A;  2MA6 A;  2MA5 A;  3MHH A;  2VPG A;  3N9N A;  1WEQ A;  3N9O A;  4TKP B;  2C2L A;  2FSA A;  2MIQ A;  4V3L C;  5FB1 A;  2LGL A;  2EOD A;  1N87 A;  2CKL B;  4LAD B;  2IDA A;  5J3X A;  4AYC A;  1Z60 A;  3C5K A;  5LKZ A;  3ZTG A;  4LLB A;  2YQM A;  4UP5 A;  2KYU A;  2ECW A;  3O35 A;  1VFY A;  3SOW A;  1WIM A;  2QIZ A;  3PUR A;  3GL6 A;  1FBV A;  2I50 A;  3O70 A;  5AIU A;  4FJC A;  2JMJ A;  2LQ6 A;  3KQI A;  4R8P K;  3ZPV E;  3HCS A;  2MD7 B;  1MM2 A;  2Y1M A;  2LXH C;  1WEU A;  5LCW B;  4A4B A;  5JG6 A;  5TRB A;  3KNV A;  4I7B A;  3VK6 A;  4CCG X;  2JMI A;  2Y43 A;  2LGG A;  4IC2 A;  3KV6 A;  4AYC B;  3ZPV 1;  4X3G A;  4YAX A;  4AVX A;  5D1L B;  4WZ0 A;  2JRJ A;  2M1R A;  4XI1 A;  2K1J A;  2KGG A;  4ZDT A;  1Z6U A;  1HYJ A;  2AN6 A;  2VJE A;  2PNX A;  5G05 B;  2VP7 A;  4O64 A;  4WA6 A;  2UZG A;  5TDR A;  2LXP C;  2BAY A;  4C9Z A;  2KE1 A;  5KH7 A;  2YT5 A;  2VPE A; 
#chains in the Genus database with same CATH topology
 2M3H A;  1X4U A;  5B8D A;  5FER A;  2YUC A;  1WEW A;  2K16 A;  1Z2Q A;  2MT5 A;  2YSM A;  2D8S A;  2K17 A;  2XB1 A;  3N9Q A;  4O62 A;  5B77 A;  3EB6 A;  3LQI A;  5I3L A;  2EGP A;  4QF3 A;  4GNE A;  4S3O C;  2YW8 A;  5B75 A;  2B0O E;  3PHD A;  4QF2 A;  4LK9 A;  4QQ4 A;  3E2D A;  3MDB C;  2DX8 A;  3LQH A;  2FUU A;  1V87 A;  5G0F A;  3FL2 A;  3N9L A;  2KWO A;  1RMD A;  2HDP A;  4IC3 A;  2L75 A;  3DPL R;  2MNZ A;  2LRI C;  2E6S A;  2VJE B;  1XWH A;  2ZET C;  3KV5 A;  1WIL A;  2JMD A;  4V3K C;  3KDE C;  5KH9 A;  1ZBD B;  2KFT A;  2CT2 A;  2H0D A;  3T6R A;  2LGK A;  2YQL A;  4WZ2 A;  3SOU A;  1WFK A;  4AP4 A;  5EYA F;  5LKU A;  4GB0 A;  2ECV A;  3ZYQ A;  3HCU A;  4N3W A;  3ZVZ B;  1WGM A;  5LKT A;  4YC9 A;  2YUR A;  4GND A;  2KWJ A;  2F42 A;  3GV4 A;  5TBN A;  1G25 A;  2RSD A;  4LKA A;  5B76 A;  2K4D A;  3ZNI A;  4P5O B;  4YAD A;  4FK5 A;  1F62 A;  2EXU A;  3SOX A;  3U5M A;  2ECJ A;  2XOC A;  5C11 A;  3LDY A;  3JUE A;  5H9M A;  2HYE D;  2ECT A;  2YVR A;  2YRE A;  2CRW A;  5H1U A;  2RI7 A;  1VD4 A;  2OXQ C;  2EA6 A;  4F1P A;  2P57 A;  2LN0 A;  2XOY A;  3N9M A;  4OGE A;  5SVI B;  2M85 A;  3T7L A;  4UI9 B;  1WEP A;  1FP0 A;  4YAT A;  5KH3 A;  3L1Z B;  2H0D B;  1WE9 A;  1X4J A;  3O36 A;  2VJF A;  4WZ3 B;  2XEU A;  2MUM A;  3O7A A;  4PTB A;  2ECN A;  3U5O A;  1MM3 A;  4ZQL A;  2CSZ A;  2KWN A;  3ZVY A;  2LV9 A;  2E6R A;  4FO9 A;  2G43 A;  3LQJ A;  2KKY A;  5LKX A;  2G6Q A;  1LDJ B;  2MNY A;  2CSV A;  4BHW A;  2CKL A;  2OWA A;  4S3O B;  3LRQ A;  1WEN A;  3FEH A;  4CA1 A;  3DQV R;  2C2V S;  3NG2 A;  3HCT A;  3RPG C;  5G04 B;  3O47 A;  1T1H A;  2QIC A;  2F6N A;  1LDK C;  3SHB A;  4Q6F A;  4MSX A;  1MBM A;  2EGM A;  2KU3 A;  3L11 A;  2VJF B;  5AIT A;  4B7Y C;  3M62 A;  4I7C A;  2F6J A;  3FJU B;  4W4U A;  4ZUX U;  5FB0 A;  3O34 A;  5DKA A;  3ASL A;  2RR4 A;  2CON A;  1WEM A;  2ECI A;  1WEO A;  4YBT A;  2KR4 A;  3U5P A;  5TAB A;  2L0B A;  3HTK C;  2MKE A;  2L80 A;  2YHO A;  2FUI A;  4N4F A;  4I7D A;  4MVT A;  2LGV A;  5H1V A;  3PUQ A;  3L1X A;  4L7X A;  2MD8 C;  5B78 A;  1JM7 A;  5C13 A;  2PUY A;  5D1M B;  2CSY A;  4LJN A;  4BBQ A;  2KWK A;  2DSM A;  2VNF A;  2ECG A;  1K2F A;  2L7P A;  3O37 A;  5B79 A;  2YSJ A;  5K3Q A;  4PPE A;  2VPD A;  4UP0 A;  1X4I A;  2CRR A;  2QJ0 A;  3U5N A;  2LDR A;  4A4C A;  1IYM A;  5DIN A;  2M13 A;  1CHC A;  4YAB A;  1JOC A;  2M6M A;  2VPB A;  3M99 A;  4YBM A;  2KRE A;  2YYR A;  4Z0O A;  3PLW A;  5TDW A;  2IQJ A;  5SVX A;  4FIP A;  2FFW A;  4H9D A;  4A0C D;  3SUB A;  4OGC A;  2D8U A;  4NN2 A;  5FEY A;  3FAN A;  4L58 A;  1JM7 B;  5H1T A;  1WES A;  2KIZ A;  3RTR B;  3EB5 A;  2LAU A;  3M63 A;  3FAO A;  4R2Y A;  3C6W A;  4B86 C;  2KGI A;  2L5U A;  1U6G B;  2JUN A;  4GNG A;  3IHP A;  2NAA A;  2KKX A;  3I2D A;  3DWD A;  3M7K A;  3O33 A;  3N9P A;  3RPG B;  5D1K B;  3MHS A;  4F52 B;  4AUQ B;  1WEE A;  1WEV A;  3Q1D A;  2G45 A;  2L43 A;  2Y1N A;  2YU4 A;  4GNF A;  1VYX A;  4YBS A;  3V43 A;  3T9K A;  1BOR A;  2YHN A;  3QZV A;  4A49 A;  4R7E A;  4Z0R A;  1DVP A;  1E4U A;  1HYI A;  2MA6 A;  2DJA A;  2MA5 A;  3MHH A;  2VPG A;  3N9N A;  1WEQ A;  3N9O A;  4TKP B;  2C2L A;  2FSA A;  2MIQ A;  4V3L C;  5FB1 A;  2LGL A;  5SVY A;  3LVQ E;  5SVI A;  2EOD A;  1N87 A;  2CKL B;  4LAD B;  2IDA A;  5J3X A;  4AYC A;  1Z60 A;  3C5K A;  5LKZ A;  3FM8 C;  3ZTG A;  4LLB A;  2E61 A;  2YQM A;  4UP5 A;  2KYU A;  2ECW A;  3O35 A;  1VFY A;  3SOW A;  1WIM A;  2QIZ A;  3PUR A;  3H7H A;  3DDT A;  3GL6 A;  1FBV A;  2I50 A;  3O70 A;  5AIU A;  4FJC A;  2JMJ A;  2JM3 A;  2LQ6 A;  3KQI A;  4R8P K;  2FD4 A;  3LVR E;  3ZPV E;  3HCS A;  2MD7 B;  1MM2 A;  2Y1M A;  2LXH C;  1WEU A;  5LCW B;  4A4B A;  5JG6 A;  5TRB A;  3KNV A;  4I7B A;  3VK6 A;  4CCG X;  1DCQ A;  2JMI A;  2Y43 A;  2LGG A;  4IC2 A;  3KV6 A;  4AYC B;  3ZPV 1;  4X3G A;  4YAX A;  4AVX A;  5D1L B;  4WZ0 A;  2JRJ A;  2M1R A;  4XI1 A;  2K1J A;  2KGG A;  4ZDT A;  1Z6U A;  1HYJ A;  2XP0 A;  2AN6 A;  2VJE A;  2PNX A;  2XOZ A;  5G05 B;  3LJU X;  2VP7 A;  4O64 A;  4WA6 A;  2UZG A;  5TDR A;  2LXP C;  2BAY A;  4C9Z A;  2KE1 A;  5KH7 A;  2YT5 A;  2VPE A; 
#chains in the Genus database with same CATH homology
 2M3H A;  1X4U A;  5B8D A;  5FER A;  2YUC A;  1WEW A;  2K16 A;  1Z2Q A;  2MT5 A;  2YSM A;  2D8S A;  2K17 A;  2XB1 A;  3N9Q A;  5B77 A;  3EB6 A;  3LQI A;  5I3L A;  2EGP A;  4QF3 A;  4GNE A;  4S3O C;  2YW8 A;  5B75 A;  3PHD A;  4QF2 A;  4LK9 A;  2DX8 A;  3LQH A;  2FUU A;  1V87 A;  5G0F A;  3FL2 A;  3N9L A;  2KWO A;  1RMD A;  2HDP A;  4IC3 A;  2L75 A;  3DPL R;  2MNZ A;  2LRI C;  2E6S A;  2VJE B;  1XWH A;  2ZET C;  3KV5 A;  1WIL A;  2JMD A;  4V3K C;  5KH9 A;  1ZBD B;  2KFT A;  2CT2 A;  2H0D A;  3T6R A;  2LGK A;  2YQL A;  4WZ2 A;  3SOU A;  1WFK A;  4AP4 A;  5EYA F;  5LKU A;  4GB0 A;  2ECV A;  3ZYQ A;  3HCU A;  4N3W A;  3ZVZ B;  1WGM A;  5LKT A;  4YC9 A;  2YUR A;  4GND A;  2KWJ A;  2F42 A;  3GV4 A;  5TBN A;  1G25 A;  2RSD A;  4LKA A;  5B76 A;  2K4D A;  3ZNI A;  4P5O B;  4YAD A;  4FK5 A;  1F62 A;  3SOX A;  3U5M A;  2ECJ A;  5C11 A;  5H9M A;  2HYE D;  2ECT A;  2YRE A;  5H1U A;  2RI7 A;  1VD4 A;  2OXQ C;  2EA6 A;  2LN0 A;  3N9M A;  2M85 A;  3T7L A;  4UI9 B;  1WEP A;  1FP0 A;  4YAT A;  5KH3 A;  3L1Z B;  2H0D B;  1WE9 A;  1X4J A;  3O36 A;  2VJF A;  4WZ3 B;  2XEU A;  2MUM A;  3O7A A;  4PTB A;  2ECN A;  3U5O A;  1MM3 A;  4ZQL A;  2CSZ A;  2KWN A;  3ZVY A;  2LV9 A;  2E6R A;  4FO9 A;  2G43 A;  3LQJ A;  5LKX A;  2G6Q A;  1LDJ B;  2MNY A;  4BHW A;  2CKL A;  4S3O B;  3LRQ A;  1WEN A;  4CA1 A;  3DQV R;  2C2V S;  3NG2 A;  3HCT A;  3RPG C;  5G04 B;  1T1H A;  2QIC A;  2F6N A;  1LDK C;  3SHB A;  4Q6F A;  4MSX A;  2KU3 A;  3L11 A;  2VJF B;  5AIT A;  4B7Y C;  3M62 A;  4I7C A;  2F6J A;  4W4U A;  4ZUX U;  5FB0 A;  3O34 A;  5DKA A;  3ASL A;  1WEM A;  2ECI A;  1WEO A;  4YBT A;  2KR4 A;  3U5P A;  5TAB A;  2L0B A;  3HTK C;  2L80 A;  2YHO A;  2FUI A;  4N4F A;  4I7D A;  4MVT A;  2LGV A;  5H1V A;  3PUQ A;  3L1X A;  4L7X A;  2MD8 C;  5B78 A;  1JM7 A;  5C13 A;  2PUY A;  5D1M B;  2CSY A;  4LJN A;  4BBQ A;  2KWK A;  2VNF A;  2ECG A;  1K2F A;  3O37 A;  5B79 A;  2YSJ A;  4PPE A;  2VPD A;  4UP0 A;  1X4I A;  2QJ0 A;  3U5N A;  2LDR A;  4A4C A;  1IYM A;  5DIN A;  1CHC A;  4YAB A;  1JOC A;  2M6M A;  2VPB A;  3M99 A;  4YBM A;  2KRE A;  2YYR A;  5TDW A;  4FIP A;  4A0C D;  4NN2 A;  5FEY A;  4L58 A;  1JM7 B;  5H1T A;  1WES A;  2KIZ A;  3RTR B;  3EB5 A;  3M63 A;  4R2Y A;  3C6W A;  4B86 C;  2KGI A;  2L5U A;  1U6G B;  4GNG A;  3IHP A;  2NAA A;  3I2D A;  3O33 A;  3N9P A;  3RPG B;  5D1K B;  3MHS A;  4F52 B;  4AUQ B;  1WEE A;  1WEV A;  2G45 A;  2L43 A;  2Y1N A;  2YU4 A;  4GNF A;  1VYX A;  4YBS A;  3V43 A;  1BOR A;  2YHN A;  3QZV A;  4A49 A;  4R7E A;  1DVP A;  1E4U A;  1HYI A;  2MA6 A;  2MA5 A;  3MHH A;  2VPG A;  3N9N A;  1WEQ A;  3N9O A;  4TKP B;  2C2L A;  2FSA A;  2MIQ A;  4V3L C;  5FB1 A;  2LGL A;  2EOD A;  1N87 A;  2CKL B;  4LAD B;  2IDA A;  5J3X A;  4AYC A;  1Z60 A;  3C5K A;  5LKZ A;  3ZTG A;  4LLB A;  2YQM A;  4UP5 A;  2KYU A;  2ECW A;  3O35 A;  1VFY A;  3SOW A;  1WIM A;  2QIZ A;  3PUR A;  3GL6 A;  1FBV A;  2I50 A;  3O70 A;  5AIU A;  4FJC A;  2JMJ A;  2LQ6 A;  3KQI A;  4R8P K;  3ZPV E;  3HCS A;  2MD7 B;  1MM2 A;  2Y1M A;  2LXH C;  1WEU A;  5LCW B;  4A4B A;  5JG6 A;  5TRB A;  3KNV A;  4I7B A;  3VK6 A;  4CCG X;  2JMI A;  2Y43 A;  2LGG A;  4IC2 A;  3KV6 A;  4AYC B;  3ZPV 1;  4X3G A;  4YAX A;  4AVX A;  5D1L B;  4WZ0 A;  2JRJ A;  2M1R A;  4XI1 A;  2K1J A;  2KGG A;  4ZDT A;  1Z6U A;  1HYJ A;  2AN6 A;  2VJE A;  2PNX A;  5G05 B;  2VP7 A;  4O64 A;  4WA6 A;  2UZG A;  5TDR A;  2LXP C;  2BAY A;  4C9Z A;  2KE1 A;  5KH7 A;  2YT5 A;  2VPE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...