2H0DB

Structure of a bmi-1-ring1b polycomb group ubiquitin ligase complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
100
structure length
100
Chain Sequence
KTWELSLYELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein/ligase
molecule keywords B lymphoma Mo-MLV insertion region
publication title Structure of a Bmi-1-Ring1B Polycomb Group Ubiquitin Ligase Complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 100
sequence length 100
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2006-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2h0dB01
4R7EA 2D8SA 2K17A 1Z6UA 2LGGA 5G0FA 2KFTA 2ECIA 2KWOA 1FP0A 2AN6A 2LXHC 1LDJB 4AVXA 2JMIA 4WZ0A 5AIUA 2MNZA 4FO9A 5TBNA 3T7LA 2FUUA 2JMJA 4LKAA 2YQLA 2FUIA 3O7AA 2OXQC 5DINA 3M63A 3O35A 2KU3A 4MSXA 3ZPVE 4R2YA 5J3XA 4PTBA 5LKZA 3HCTA 2ECVA 3I2DA 2H0DB 2YSMA 4WZ2A 3FL2A 4YBTA 2KGIA 2YW8A 2KYUA 2VNFA 1U6GB 4GB0A 2KGGA 3MHSA 5B8DA 3GV4A 2PUYA 3KQIA 2L43A 2HDPA 4I7BA 4ZDTA 3DPLR 5H1UA 2K16A 2YREA 3NG2A 1WEPA 2JRJA 4O64A 1X4JA 2F6NA 4CA1A 3SOUA 2I50A 2VPEA 2MUMA 2KR4A 3DQVR 3GL6A 2M3HA 2KIZA 4L58A 3HTKC 5B79A 3ZNIA 2F42A 2G6QA 4YADA 4GNFA 3LQJA 4PPEA 4ZUXU 4UI9B 1K2FA 1JOCA 3N9QA 3QZVA 1WEVA 3KV5A 5C13A 1WIMA 2MA5A 3L1XA 3T6RA 5FERA 2EGPA 1RMDA 5FEYA 1T1HA 3SHBA 2ECNA 1MM3A 3U5NA 3O34A 3ZTGA 2ECGA 2E6RA 2CSYA 4Q6FA 4B7YC 1DVPA 2QIZA 2LGKA 5AITA 1V87A 2LN0A 3EB6A 4LJNA 2ECWA 5G05B 4NN2A 2VPBA 1WEOA 5D1MB 2M85A 1WEQA 3N9OA 4C9ZA 2Y43A 4X3GA 4MVTA 4GNEA 1WEWA 2LQ6A 2EODA 1WESA 1BORA 2Y1NA 2LRIC 1Z60A 2G43A 3L11A 3LQHA 3PUQA 4N4FA 2LGVA 4W4UA 4AYCA 4YC9A 5I3LA 5C11A 4AP4A 4IC3A 4AUQB 2QICA 5FB1A 2LDRA 2YURA 2LXPC 3HCUA 2LGLA 4LLBA 2MIQA 5LKXA 1JM7A 2MT5A 2PNXA 2L0BA 4YBMA 5JG6A 4A49A 3M99A 2FSAA 2VJEA 2VJFA 5EYAF 3N9LA 4UP5A 4QF2A 4V3KC 1VYXA 4V3LC 3V43A 2UZGA 4YATA 3IHPA 4FK5A 2G45A 1HYIA 2C2LA 5TRBA 1E4UA 5H1TA 2ZETC 4BBQA 5B76A 2YQMA 4F52B 2XB1A 4CCGX 4S3OC 1WE9A 1HYJA 4I7CA 3KNVA 3N9PA 5FB0A 4N3WA 2L80A 4XI1A 3PURA 2K1JA 2YUCA 4WA6A 2BAYA 3O33A 3KV6A 1G25A 3N9NA 1WEMA 2YYRA 5KH3A 2F6JA 2CKLA 2DX8A 2YSJA 3U5PA 2QJ0A 3SOXA 2CSZA 2HYED 5G04B 4I7DA 2KE1A 3ZPV1 2RSDA 4LADB 5LCWB 4YAXA 2C2VS 3N9MA 2EA6A 5LKUA 2YHOA 5H1VA 3ZVZB 3O70A 1ZBDB 2IDAA 5D1LB 3M62A 3RPGC 4AYCB 3C5KA 5B77A 2E6SA 1FBVA 3O37A 2K4DA 4S3OB 5B78A 2Y1MA 1IYMA 1WFKA 3EB5A 1JM7B 4B86C 5TDWA 5D1KB 2VJEB 3C6WA 2VJFB 3RTRB 2VPGA 5TABA 4QF3A 1X4UA 2MD7B 2MNYA 4TKPB 4GNDA 5TDRA 4A4CA 2JMDA 3O36A 2L5UA 2NAAA 2VPDA 4FIPA 2MA6A 4A4BA 4GNGA 3U5MA 1WEUA 3LRQA 4IC2A 4YABA 2M1RA 1WGMA 3MHHA 2LV9A 1XWHA 2VP7A 4UP0A 3L1ZB 3PHDA 1X4IA 3U5OA 1Z2QA 4R8PK 2H0DA 4YBSA 3RPGB 1WILA 1VD4A 1WEEA 2L75A 2MD8C 5DKAA 4WZ3B 2CKLB 5H9MA 2M6MA 1LDKC 2RI7A 4P5OB 4BHWA 5KH9A 2YT5A 1CHCA 4FJCA 1WENA 3HCSA 1N87A 4A0CD 2KWJA 2YHNA 2KWKA 4ZQLA 2KREA 2ECJA 3ZYQA 2YU4A 4LK9A 3LQIA 3SOWA 3ZVYA 2XEUA 3ASLA 5B75A 4L7XA 1MM2A 3VK6A 5KH7A 2KWNA 2ECTA 1VFYA 5LKTA 2CT2A 1F62A
chains in the Genus database with same CATH superfamily
4R7EA 2D8SA 2XOZA 2K17A 3LDYA 3FM8C 1Z6UA 3O47A 2LGGA 5G0FA 2KFTA 2ECIA 2KWOA 1FP0A 2AN6A 2LXHC 1LDJB 2DSMA 4AVXA 2JMIA 2IQJA 4WZ0A 5AIUA 2MNZA 4FO9A 3DWDA 5TBNA 3T7LA 2FUUA 2JMJA 4LKAA 2YQLA 2FUIA 3O7AA 2OXQC 3M63A 5DINA 3O35A 2KU3A 4MSXA 3ZPVE 4R2YA 5J3XA 3E2DA 2CRWA 4PTBA 5LKZA 3HCTA 2ECVA 3I2DA 2H0DB 2YSMA 3LJUX 2EGMA 4WZ2A 3FL2A 4YBTA 2KGIA 2YW8A 2KYUA 2E61A 3LVRE 2VNFA 1U6GB 4GB0A 2KGGA 3MHSA 5B8DA 3GV4A 2PUYA 3KQIA 2L43A 2HDPA 4I7BA 4ZDTA 1MBMA 3DPLR 5H1UA 2K16A 2YREA 3NG2A 1WEPA 3JUEA 2JRJA 4O64A 1X4JA 2F6NA 4CA1A 3SOUA 2KKYA 2I50A 2VPEA 2MUMA 2KR4A 3DQVR 3GL6A 2M3HA 3MDBC 2KIZA 4L58A 2RR4A 3HTKC 5B79A 3ZNIA 2B0OE 2FD4A 2F42A 2G6QA 4YADA 5K3QA 4GNFA 3LQJA 4PPEA 4ZUXU 4UI9B 1K2FA 1JOCA 2XOYA 3N9QA 3QZVA 1WEVA 3KV5A 5C13A 1WIMA 2MA5A 3L1XA 3T6RA 5FERA 2LAUA 2EGPA 1RMDA 5FEYA 1T1HA 4F1PA 3SHBA 2ECNA 2OWAA 1MM3A 3U5NA 3O34A 3ZTGA 2ECGA 2E6RA 2CSYA 2XOCA 3FAOA 4Q6FA 2CSVA 3T9KA 4B7YC 2CRRA 1DVPA 2QIZA 2LGKA 5AITA 1V87A 2LN0A 3EB6A 4LJNA 2ECWA 2MKEA 5G05B 4NN2A 2VPBA 1WEOA 5D1MB 3LVQE 2M85A 1WEQA 3N9OA 4C9ZA 4OGEA 2CONA 2Y43A 4X3GA 4MVTA 4GNEA 3H7HA 1WEWA 2FFWA 2LQ6A 2EODA 1WESA 1BORA 2Y1NA 2LRIC 3M7KA 1Z60A 2G43A 3L11A 3LQHA 3PUQA 4N4FA 2LGVA 4W4UA 4AYCA 4YC9A 5I3LA 5C11A 4AP4A 4IC3A 4AUQB 2QICA 5FB1A 2LDRA 2YURA 2LXPC 3HCUA 2LGLA 4LLBA 2MIQA 5LKXA 1JM7A 2MT5A 3KDEC 2PNXA 2L0BA 4YBMA 5JG6A 4OGCA 4A49A 3M99A 4Z0OA 2FSAA 3DDTA 2VJEA 2VJFA 5EYAF 3N9LA 4O62A 4UP5A 4QF2A 4V3KC 2YVRA 1VYXA 5SVXA 4V3LC 3V43A 2UZGA 2JM3A 4YATA 3IHPA 4FK5A 2G45A 1HYIA 2C2LA 5TRBA 1E4UA 5H1TA 2ZETC 4BBQA 2P57A 5B76A 2YQMA 4F52B 2XB1A 4CCGX 4S3OC 1WE9A 1HYJA 4I7CA 3KNVA 3N9PA 5FB0A 4N3WA 2L80A 4XI1A 3PURA 2K1JA 5SVIA 2YUCA 4WA6A 2BAYA 3O33A 3KV6A 1G25A 3N9NA 1WEMA 2YYRA 5KH3A 2F6JA 2CKLA 2DX8A 2YSJA 3U5PA 2QJ0A 3SOXA 2CSZA 4QQ4A 2HYED 2KKXA 5G04B 3PLWA 3FANA 4I7DA 2KE1A 3ZPV1 2RSDA 4LADB 5LCWB 2XP0A 4YAXA 2C2VS 1DCQA 3N9MA 2EA6A 5LKUA 2YHOA 5H1VA 3ZVZB 3O70A 1ZBDB 2L7PA 2IDAA 5D1LB 2EXUA 3M62A 3RPGC 4AYCB 3C5KA 5B77A 4Z0RA 2E6SA 1FBVA 3O37A 2K4DA 4S3OB 5B78A 2Y1MA 4H9DA 1IYMA 1WFKA 3EB5A 1JM7B 4B86C 5TDWA 5D1KB 2M13A 2VJEB 3C6WA 2VJFB 3RTRB 2VPGA 5TABA 4QF3A 1X4UA 2MD7B 2MNYA 3FJUB 4TKPB 4GNDA 5TDRA 4A4CA 2JMDA 3O36A 2L5UA 2DJAA 2NAAA 2VPDA 4FIPA 2MA6A 4A4BA 4GNGA 3U5MA 1WEUA 3LRQA 4IC2A 4YABA 2M1RA 1WGMA 3MHHA 2LV9A 1XWHA 2JUNA 2VP7A 5SVYA 4UP0A 2D8UA 3L1ZB 3PHDA 1X4IA 3U5OA 1Z2QA 4R8PK 2H0DA 5SVIB 4YBSA 3RPGB 1WILA 1VD4A 3Q1DA 1WEEA 3SUBA 2L75A 2MD8C 5DKAA 4WZ3B 3FEHA 2CKLB 5H9MA 2M6MA 1LDKC 2RI7A 4P5OB 4BHWA 5KH9A 2YT5A 1CHCA 4FJCA 1WENA 3HCSA 1N87A 4A0CD 2KWJA 2YHNA 2KWKA 4ZQLA 2KREA 2ECJA 3ZYQA 2YU4A 4LK9A 3LQIA 3SOWA 3ZVYA 2XEUA 3ASLA 5B75A 4L7XA 1MM2A 3VK6A 5KH7A 2KWNA 2ECTA 1VFYA 5LKTA 2CT2A 1F62A
chains in the Genus database with same CATH topology
4R7EA 2D8SA 2K17A 1Z6UA 2LGGA 5G0FA 2KFTA 2ECIA 2KWOA 1FP0A 2AN6A 2LXHC 1LDJB 4AVXA 2JMIA 4WZ0A 5AIUA 2MNZA 4FO9A 5TBNA 3T7LA 2FUUA 2JMJA 4LKAA 2YQLA 2FUIA 3O7AA 2OXQC 5DINA 3M63A 3O35A 2KU3A 4MSXA 3ZPVE 4R2YA 5J3XA 4PTBA 5LKZA 3HCTA 2ECVA 3I2DA 2H0DB 2YSMA 4WZ2A 3FL2A 4YBTA 2KGIA 2YW8A 2KYUA 2VNFA 1U6GB 4GB0A 2KGGA 3MHSA 5B8DA 3GV4A 2PUYA 3KQIA 2L43A 2HDPA 4I7BA 4ZDTA 3DPLR 5H1UA 2K16A 2YREA 3NG2A 1WEPA 2JRJA 4O64A 1X4JA 2F6NA 4CA1A 3SOUA 2I50A 2VPEA 2MUMA 2KR4A 3DQVR 3GL6A 2M3HA 2KIZA 4L58A 3HTKC 5B79A 3ZNIA 2F42A 2G6QA 4YADA 4GNFA 3LQJA 4PPEA 4ZUXU 4UI9B 1K2FA 1JOCA 3N9QA 3QZVA 1WEVA 3KV5A 5C13A 1WIMA 2MA5A 3L1XA 3T6RA 5FERA 2EGPA 1RMDA 5FEYA 1T1HA 3SHBA 2ECNA 1MM3A 3U5NA 3O34A 3ZTGA 2ECGA 2E6RA 2CSYA 4Q6FA 4B7YC 1DVPA 2QIZA 2LGKA 5AITA 1V87A 2LN0A 3EB6A 4LJNA 2ECWA 5G05B 4NN2A 2VPBA 1WEOA 5D1MB 2M85A 1WEQA 3N9OA 4C9ZA 2Y43A 4X3GA 4MVTA 4GNEA 1WEWA 2LQ6A 2EODA 1WESA 1BORA 2Y1NA 2LRIC 1Z60A 2G43A 3L11A 3LQHA 3PUQA 4N4FA 2LGVA 4W4UA 4AYCA 4YC9A 5I3LA 5C11A 4AP4A 4IC3A 4AUQB 2QICA 5FB1A 2LDRA 2YURA 2LXPC 3HCUA 2LGLA 4LLBA 2MIQA 5LKXA 1JM7A 2MT5A 2PNXA 2L0BA 4YBMA 5JG6A 4A49A 3M99A 2FSAA 2VJEA 2VJFA 5EYAF 3N9LA 4UP5A 4QF2A 4V3KC 1VYXA 4V3LC 3V43A 2UZGA 4YATA 3IHPA 4FK5A 2G45A 1HYIA 2C2LA 5TRBA 1E4UA 5H1TA 2ZETC 4BBQA 5B76A 2YQMA 4F52B 2XB1A 4CCGX 4S3OC 1WE9A 1HYJA 4I7CA 3KNVA 3N9PA 5FB0A 4N3WA 2L80A 4XI1A 3PURA 2K1JA 2YUCA 4WA6A 2BAYA 3O33A 3KV6A 1G25A 3N9NA 1WEMA 2YYRA 5KH3A 2F6JA 2CKLA 2DX8A 2YSJA 3U5PA 2QJ0A 3SOXA 2CSZA 2HYED 5G04B 4I7DA 2KE1A 3ZPV1 2RSDA 4LADB 5LCWB 4YAXA 2C2VS 3N9MA 2EA6A 5LKUA 2YHOA 5H1VA 3ZVZB 3O70A 1ZBDB 2IDAA 5D1LB 3M62A 3RPGC 4AYCB 3C5KA 5B77A 2E6SA 1FBVA 3O37A 2K4DA 4S3OB 5B78A 2Y1MA 1IYMA 1WFKA 3EB5A 1JM7B 4B86C 5TDWA 5D1KB 2VJEB 3C6WA 2VJFB 3RTRB 2VPGA 5TABA 4QF3A 1X4UA 2MD7B 2MNYA 4TKPB 4GNDA 5TDRA 4A4CA 2JMDA 3O36A 2L5UA 2NAAA 2VPDA 4FIPA 2MA6A 4A4BA 4GNGA 3U5MA 1WEUA 3LRQA 4IC2A 4YABA 2M1RA 1WGMA 3MHHA 2LV9A 1XWHA 2VP7A 4UP0A 3L1ZB 3PHDA 1X4IA 3U5OA 1Z2QA 4R8PK 2H0DA 4YBSA 3RPGB 1WILA 1VD4A 1WEEA 2L75A 2MD8C 5DKAA 4WZ3B 2CKLB 5H9MA 2M6MA 1LDKC 2RI7A 4P5OB 4BHWA 5KH9A 2YT5A 1CHCA 4FJCA 1WENA 3HCSA 1N87A 4A0CD 2KWJA 2YHNA 2KWKA 4ZQLA 2KREA 2ECJA 3ZYQA 2YU4A 4LK9A 3LQIA 3SOWA 3ZVYA 2XEUA 3ASLA 5B75A 4L7XA 1MM2A 3VK6A 5KH7A 2KWNA 2ECTA 1VFYA 5LKTA 2CT2A 1F62A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R7E A;  2D8S A;  2K17 A;  1Z6U A;  2LGG A;  5G0F A;  2KFT A;  2ECI A;  2KWO A;  1FP0 A;  2AN6 A;  2LXH C;  1LDJ B;  4AVX A;  2JMI A;  4WZ0 A;  5AIU A;  2MNZ A;  4FO9 A;  5TBN A;  3T7L A;  2FUU A;  2JMJ A;  4LKA A;  2YQL A;  2FUI A;  3O7A A;  2OXQ C;  5DIN A;  3M63 A;  3O35 A;  2KU3 A;  4MSX A;  3ZPV E;  4R2Y A;  5J3X A;  4PTB A;  5LKZ A;  3HCT A;  2ECV A;  3I2D A;  2H0D B;  2YSM A;  4WZ2 A;  3FL2 A;  4YBT A;  2KGI A;  2YW8 A;  2KYU A;  2VNF A;  1U6G B;  4GB0 A;  2KGG A;  3MHS A;  5B8D A;  3GV4 A;  2PUY A;  3KQI A;  2L43 A;  2HDP A;  4I7B A;  4ZDT A;  3DPL R;  5H1U A;  2K16 A;  2YRE A;  3NG2 A;  1WEP A;  2JRJ A;  4O64 A;  1X4J A;  2F6N A;  4CA1 A;  3SOU A;  2I50 A;  2VPE A;  2MUM A;  2KR4 A;  3DQV R;  3GL6 A;  2M3H A;  2KIZ A;  4L58 A;  3HTK C;  5B79 A;  3ZNI A;  2F42 A;  2G6Q A;  4YAD A;  4GNF A;  3LQJ A;  4PPE A;  4ZUX U;  4UI9 B;  1K2F A;  1JOC A;  3N9Q A;  3QZV A;  1WEV A;  3KV5 A;  5C13 A;  1WIM A;  2MA5 A;  3L1X A;  3T6R A;  5FER A;  2EGP A;  1RMD A;  5FEY A;  1T1H A;  3SHB A;  2ECN A;  1MM3 A;  3U5N A;  3O34 A;  3ZTG A;  2ECG A;  2E6R A;  2CSY A;  4Q6F A;  4B7Y C;  1DVP A;  2QIZ A;  2LGK A;  5AIT A;  1V87 A;  2LN0 A;  3EB6 A;  4LJN A;  2ECW A;  5G05 B;  4NN2 A;  2VPB A;  1WEO A;  5D1M B;  2M85 A;  1WEQ A;  3N9O A;  4C9Z A;  2Y43 A;  4X3G A;  4MVT A;  4GNE A;  1WEW A;  2LQ6 A;  2EOD A;  1WES A;  1BOR A;  2Y1N A;  2LRI C;  1Z60 A;  2G43 A;  3L11 A;  3LQH A;  3PUQ A;  4N4F A;  2LGV A;  4W4U A;  4AYC A;  4YC9 A;  5I3L A;  5C11 A;  4AP4 A;  4IC3 A;  4AUQ B;  2QIC A;  5FB1 A;  2LDR A;  2YUR A;  2LXP C;  3HCU A;  2LGL A;  4LLB A;  2MIQ A;  5LKX A;  1JM7 A;  2MT5 A;  2PNX A;  2L0B A;  4YBM A;  5JG6 A;  4A49 A;  3M99 A;  2FSA A;  2VJE A;  2VJF A;  5EYA F;  3N9L A;  4UP5 A;  4QF2 A;  4V3K C;  1VYX A;  4V3L C;  3V43 A;  2UZG A;  4YAT A;  3IHP A;  4FK5 A;  2G45 A;  1HYI A;  2C2L A;  5TRB A;  1E4U A;  5H1T A;  2ZET C;  4BBQ A;  5B76 A;  2YQM A;  4F52 B;  2XB1 A;  4CCG X;  4S3O C;  1WE9 A;  1HYJ A;  4I7C A;  3KNV A;  3N9P A;  5FB0 A;  4N3W A;  2L80 A;  4XI1 A;  3PUR A;  2K1J A;  2YUC A;  4WA6 A;  2BAY A;  3O33 A;  3KV6 A;  1G25 A;  3N9N A;  1WEM A;  2YYR A;  5KH3 A;  2F6J A;  2CKL A;  2DX8 A;  2YSJ A;  3U5P A;  2QJ0 A;  3SOX A;  2CSZ A;  2HYE D;  5G04 B;  4I7D A;  2KE1 A;  3ZPV 1;  2RSD A;  4LAD B;  5LCW B;  4YAX A;  2C2V S;  3N9M A;  2EA6 A;  5LKU A;  2YHO A;  5H1V A;  3ZVZ B;  3O70 A;  1ZBD B;  2IDA A;  5D1L B;  3M62 A;  3RPG C;  4AYC B;  3C5K A;  5B77 A;  2E6S A;  1FBV A;  3O37 A;  2K4D A;  4S3O B;  5B78 A;  2Y1M A;  1IYM A;  1WFK A;  3EB5 A;  1JM7 B;  4B86 C;  5TDW A;  5D1K B;  2VJE B;  3C6W A;  2VJF B;  3RTR B;  2VPG A;  5TAB A;  4QF3 A;  1X4U A;  2MD7 B;  2MNY A;  4TKP B;  4GND A;  5TDR A;  4A4C A;  2JMD A;  3O36 A;  2L5U A;  2NAA A;  2VPD A;  4FIP A;  2MA6 A;  4A4B A;  4GNG A;  3U5M A;  1WEU A;  3LRQ A;  4IC2 A;  4YAB A;  2M1R A;  1WGM A;  3MHH A;  2LV9 A;  1XWH A;  2VP7 A;  4UP0 A;  3L1Z B;  3PHD A;  1X4I A;  3U5O A;  1Z2Q A;  4R8P K;  2H0D A;  4YBS A;  3RPG B;  1WIL A;  1VD4 A;  1WEE A;  2L75 A;  2MD8 C;  5DKA A;  4WZ3 B;  2CKL B;  5H9M A;  2M6M A;  1LDK C;  2RI7 A;  4P5O B;  4BHW A;  5KH9 A;  2YT5 A;  1CHC A;  4FJC A;  1WEN A;  3HCS A;  1N87 A;  4A0C D;  2KWJ A;  2YHN A;  2KWK A;  4ZQL A;  2KRE A;  2ECJ A;  3ZYQ A;  2YU4 A;  4LK9 A;  3LQI A;  3SOW A;  3ZVY A;  2XEU A;  3ASL A;  5B75 A;  4L7X A;  1MM2 A;  3VK6 A;  5KH7 A;  2KWN A;  2ECT A;  1VFY A;  5LKT A;  2CT2 A;  1F62 A; 
#chains in the Genus database with same CATH topology
 4R7E A;  2D8S A;  2XOZ A;  2K17 A;  3LDY A;  3FM8 C;  1Z6U A;  3O47 A;  2LGG A;  5G0F A;  2KFT A;  2ECI A;  2KWO A;  1FP0 A;  2AN6 A;  2LXH C;  1LDJ B;  2DSM A;  4AVX A;  2JMI A;  2IQJ A;  4WZ0 A;  5AIU A;  2MNZ A;  4FO9 A;  3DWD A;  5TBN A;  3T7L A;  2FUU A;  2JMJ A;  4LKA A;  2YQL A;  2FUI A;  3O7A A;  2OXQ C;  3M63 A;  5DIN A;  3O35 A;  2KU3 A;  4MSX A;  3ZPV E;  4R2Y A;  5J3X A;  3E2D A;  2CRW A;  4PTB A;  5LKZ A;  3HCT A;  2ECV A;  3I2D A;  2H0D B;  2YSM A;  3LJU X;  2EGM A;  4WZ2 A;  3FL2 A;  4YBT A;  2KGI A;  2YW8 A;  2KYU A;  2E61 A;  3LVR E;  2VNF A;  1U6G B;  4GB0 A;  2KGG A;  3MHS A;  5B8D A;  3GV4 A;  2PUY A;  3KQI A;  2L43 A;  2HDP A;  4I7B A;  4ZDT A;  1MBM A;  3DPL R;  5H1U A;  2K16 A;  2YRE A;  3NG2 A;  1WEP A;  3JUE A;  2JRJ A;  4O64 A;  1X4J A;  2F6N A;  4CA1 A;  3SOU A;  2KKY A;  2I50 A;  2VPE A;  2MUM A;  2KR4 A;  3DQV R;  3GL6 A;  2M3H A;  3MDB C;  2KIZ A;  4L58 A;  2RR4 A;  3HTK C;  5B79 A;  3ZNI A;  2B0O E;  2FD4 A;  2F42 A;  2G6Q A;  4YAD A;  5K3Q A;  4GNF A;  3LQJ A;  4PPE A;  4ZUX U;  4UI9 B;  1K2F A;  1JOC A;  2XOY A;  3N9Q A;  3QZV A;  1WEV A;  3KV5 A;  5C13 A;  1WIM A;  2MA5 A;  3L1X A;  3T6R A;  5FER A;  2LAU A;  2EGP A;  1RMD A;  5FEY A;  1T1H A;  4F1P A;  3SHB A;  2ECN A;  2OWA A;  1MM3 A;  3U5N A;  3O34 A;  3ZTG A;  2ECG A;  2E6R A;  2CSY A;  2XOC A;  3FAO A;  4Q6F A;  2CSV A;  3T9K A;  4B7Y C;  2CRR A;  1DVP A;  2QIZ A;  2LGK A;  5AIT A;  1V87 A;  2LN0 A;  3EB6 A;  4LJN A;  2ECW A;  2MKE A;  5G05 B;  4NN2 A;  2VPB A;  1WEO A;  5D1M B;  3LVQ E;  2M85 A;  1WEQ A;  3N9O A;  4C9Z A;  4OGE A;  2CON A;  2Y43 A;  4X3G A;  4MVT A;  4GNE A;  3H7H A;  1WEW A;  2FFW A;  2LQ6 A;  2EOD A;  1WES A;  1BOR A;  2Y1N A;  2LRI C;  3M7K A;  1Z60 A;  2G43 A;  3L11 A;  3LQH A;  3PUQ A;  4N4F A;  2LGV A;  4W4U A;  4AYC A;  4YC9 A;  5I3L A;  5C11 A;  4AP4 A;  4IC3 A;  4AUQ B;  2QIC A;  5FB1 A;  2LDR A;  2YUR A;  2LXP C;  3HCU A;  2LGL A;  4LLB A;  2MIQ A;  5LKX A;  1JM7 A;  2MT5 A;  3KDE C;  2PNX A;  2L0B A;  4YBM A;  5JG6 A;  4OGC A;  4A49 A;  3M99 A;  4Z0O A;  2FSA A;  3DDT A;  2VJE A;  2VJF A;  5EYA F;  3N9L A;  4O62 A;  4UP5 A;  4QF2 A;  4V3K C;  2YVR A;  1VYX A;  5SVX A;  4V3L C;  3V43 A;  2UZG A;  2JM3 A;  4YAT A;  3IHP A;  4FK5 A;  2G45 A;  1HYI A;  2C2L A;  5TRB A;  1E4U A;  5H1T A;  2ZET C;  4BBQ A;  2P57 A;  5B76 A;  2YQM A;  4F52 B;  2XB1 A;  4CCG X;  4S3O C;  1WE9 A;  1HYJ A;  4I7C A;  3KNV A;  3N9P A;  5FB0 A;  4N3W A;  2L80 A;  4XI1 A;  3PUR A;  2K1J A;  5SVI A;  2YUC A;  4WA6 A;  2BAY A;  3O33 A;  3KV6 A;  1G25 A;  3N9N A;  1WEM A;  2YYR A;  5KH3 A;  2F6J A;  2CKL A;  2DX8 A;  2YSJ A;  3U5P A;  2QJ0 A;  3SOX A;  2CSZ A;  4QQ4 A;  2HYE D;  2KKX A;  5G04 B;  3PLW A;  3FAN A;  4I7D A;  2KE1 A;  3ZPV 1;  2RSD A;  4LAD B;  5LCW B;  2XP0 A;  4YAX A;  2C2V S;  1DCQ A;  3N9M A;  2EA6 A;  5LKU A;  2YHO A;  5H1V A;  3ZVZ B;  3O70 A;  1ZBD B;  2L7P A;  2IDA A;  5D1L B;  2EXU A;  3M62 A;  3RPG C;  4AYC B;  3C5K A;  5B77 A;  4Z0R A;  2E6S A;  1FBV A;  3O37 A;  2K4D A;  4S3O B;  5B78 A;  2Y1M A;  4H9D A;  1IYM A;  1WFK A;  3EB5 A;  1JM7 B;  4B86 C;  5TDW A;  5D1K B;  2M13 A;  2VJE B;  3C6W A;  2VJF B;  3RTR B;  2VPG A;  5TAB A;  4QF3 A;  1X4U A;  2MD7 B;  2MNY A;  3FJU B;  4TKP B;  4GND A;  5TDR A;  4A4C A;  2JMD A;  3O36 A;  2L5U A;  2DJA A;  2NAA A;  2VPD A;  4FIP A;  2MA6 A;  4A4B A;  4GNG A;  3U5M A;  1WEU A;  3LRQ A;  4IC2 A;  4YAB A;  2M1R A;  1WGM A;  3MHH A;  2LV9 A;  1XWH A;  2JUN A;  2VP7 A;  5SVY A;  4UP0 A;  2D8U A;  3L1Z B;  3PHD A;  1X4I A;  3U5O A;  1Z2Q A;  4R8P K;  2H0D A;  5SVI B;  4YBS A;  3RPG B;  1WIL A;  1VD4 A;  3Q1D A;  1WEE A;  3SUB A;  2L75 A;  2MD8 C;  5DKA A;  4WZ3 B;  3FEH A;  2CKL B;  5H9M A;  2M6M A;  1LDK C;  2RI7 A;  4P5O B;  4BHW A;  5KH9 A;  2YT5 A;  1CHC A;  4FJC A;  1WEN A;  3HCS A;  1N87 A;  4A0C D;  2KWJ A;  2YHN A;  2KWK A;  4ZQL A;  2KRE A;  2ECJ A;  3ZYQ A;  2YU4 A;  4LK9 A;  3LQI A;  3SOW A;  3ZVY A;  2XEU A;  3ASL A;  5B75 A;  4L7X A;  1MM2 A;  3VK6 A;  5KH7 A;  2KWN A;  2ECT A;  1VFY A;  5LKT A;  2CT2 A;  1F62 A; 
#chains in the Genus database with same CATH homology
 4R7E A;  2D8S A;  2K17 A;  1Z6U A;  2LGG A;  5G0F A;  2KFT A;  2ECI A;  2KWO A;  1FP0 A;  2AN6 A;  2LXH C;  1LDJ B;  4AVX A;  2JMI A;  4WZ0 A;  5AIU A;  2MNZ A;  4FO9 A;  5TBN A;  3T7L A;  2FUU A;  2JMJ A;  4LKA A;  2YQL A;  2FUI A;  3O7A A;  2OXQ C;  5DIN A;  3M63 A;  3O35 A;  2KU3 A;  4MSX A;  3ZPV E;  4R2Y A;  5J3X A;  4PTB A;  5LKZ A;  3HCT A;  2ECV A;  3I2D A;  2H0D B;  2YSM A;  4WZ2 A;  3FL2 A;  4YBT A;  2KGI A;  2YW8 A;  2KYU A;  2VNF A;  1U6G B;  4GB0 A;  2KGG A;  3MHS A;  5B8D A;  3GV4 A;  2PUY A;  3KQI A;  2L43 A;  2HDP A;  4I7B A;  4ZDT A;  3DPL R;  5H1U A;  2K16 A;  2YRE A;  3NG2 A;  1WEP A;  2JRJ A;  4O64 A;  1X4J A;  2F6N A;  4CA1 A;  3SOU A;  2I50 A;  2VPE A;  2MUM A;  2KR4 A;  3DQV R;  3GL6 A;  2M3H A;  2KIZ A;  4L58 A;  3HTK C;  5B79 A;  3ZNI A;  2F42 A;  2G6Q A;  4YAD A;  4GNF A;  3LQJ A;  4PPE A;  4ZUX U;  4UI9 B;  1K2F A;  1JOC A;  3N9Q A;  3QZV A;  1WEV A;  3KV5 A;  5C13 A;  1WIM A;  2MA5 A;  3L1X A;  3T6R A;  5FER A;  2EGP A;  1RMD A;  5FEY A;  1T1H A;  3SHB A;  2ECN A;  1MM3 A;  3U5N A;  3O34 A;  3ZTG A;  2ECG A;  2E6R A;  2CSY A;  4Q6F A;  4B7Y C;  1DVP A;  2QIZ A;  2LGK A;  5AIT A;  1V87 A;  2LN0 A;  3EB6 A;  4LJN A;  2ECW A;  5G05 B;  4NN2 A;  2VPB A;  1WEO A;  5D1M B;  2M85 A;  1WEQ A;  3N9O A;  4C9Z A;  2Y43 A;  4X3G A;  4MVT A;  4GNE A;  1WEW A;  2LQ6 A;  2EOD A;  1WES A;  1BOR A;  2Y1N A;  2LRI C;  1Z60 A;  2G43 A;  3L11 A;  3LQH A;  3PUQ A;  4N4F A;  2LGV A;  4W4U A;  4AYC A;  4YC9 A;  5I3L A;  5C11 A;  4AP4 A;  4IC3 A;  4AUQ B;  2QIC A;  5FB1 A;  2LDR A;  2YUR A;  2LXP C;  3HCU A;  2LGL A;  4LLB A;  2MIQ A;  5LKX A;  1JM7 A;  2MT5 A;  2PNX A;  2L0B A;  4YBM A;  5JG6 A;  4A49 A;  3M99 A;  2FSA A;  2VJE A;  2VJF A;  5EYA F;  3N9L A;  4UP5 A;  4QF2 A;  4V3K C;  1VYX A;  4V3L C;  3V43 A;  2UZG A;  4YAT A;  3IHP A;  4FK5 A;  2G45 A;  1HYI A;  2C2L A;  5TRB A;  1E4U A;  5H1T A;  2ZET C;  4BBQ A;  5B76 A;  2YQM A;  4F52 B;  2XB1 A;  4CCG X;  4S3O C;  1WE9 A;  1HYJ A;  4I7C A;  3KNV A;  3N9P A;  5FB0 A;  4N3W A;  2L80 A;  4XI1 A;  3PUR A;  2K1J A;  2YUC A;  4WA6 A;  2BAY A;  3O33 A;  3KV6 A;  1G25 A;  3N9N A;  1WEM A;  2YYR A;  5KH3 A;  2F6J A;  2CKL A;  2DX8 A;  2YSJ A;  3U5P A;  2QJ0 A;  3SOX A;  2CSZ A;  2HYE D;  5G04 B;  4I7D A;  2KE1 A;  3ZPV 1;  2RSD A;  4LAD B;  5LCW B;  4YAX A;  2C2V S;  3N9M A;  2EA6 A;  5LKU A;  2YHO A;  5H1V A;  3ZVZ B;  3O70 A;  1ZBD B;  2IDA A;  5D1L B;  3M62 A;  3RPG C;  4AYC B;  3C5K A;  5B77 A;  2E6S A;  1FBV A;  3O37 A;  2K4D A;  4S3O B;  5B78 A;  2Y1M A;  1IYM A;  1WFK A;  3EB5 A;  1JM7 B;  4B86 C;  5TDW A;  5D1K B;  2VJE B;  3C6W A;  2VJF B;  3RTR B;  2VPG A;  5TAB A;  4QF3 A;  1X4U A;  2MD7 B;  2MNY A;  4TKP B;  4GND A;  5TDR A;  4A4C A;  2JMD A;  3O36 A;  2L5U A;  2NAA A;  2VPD A;  4FIP A;  2MA6 A;  4A4B A;  4GNG A;  3U5M A;  1WEU A;  3LRQ A;  4IC2 A;  4YAB A;  2M1R A;  1WGM A;  3MHH A;  2LV9 A;  1XWH A;  2VP7 A;  4UP0 A;  3L1Z B;  3PHD A;  1X4I A;  3U5O A;  1Z2Q A;  4R8P K;  2H0D A;  4YBS A;  3RPG B;  1WIL A;  1VD4 A;  1WEE A;  2L75 A;  2MD8 C;  5DKA A;  4WZ3 B;  2CKL B;  5H9M A;  2M6M A;  1LDK C;  2RI7 A;  4P5O B;  4BHW A;  5KH9 A;  2YT5 A;  1CHC A;  4FJC A;  1WEN A;  3HCS A;  1N87 A;  4A0C D;  2KWJ A;  2YHN A;  2KWK A;  4ZQL A;  2KRE A;  2ECJ A;  3ZYQ A;  2YU4 A;  4LK9 A;  3LQI A;  3SOW A;  3ZVY A;  2XEU A;  3ASL A;  5B75 A;  4L7X A;  1MM2 A;  3VK6 A;  5KH7 A;  2KWN A;  2ECT A;  1VFY A;  5LKT A;  2CT2 A;  1F62 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...