2H0DB

Structure of a bmi-1-ring1b polycomb group ubiquitin ligase complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
100
structure length
100
Chain Sequence
KTWELSLYELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords B lymphoma Mo-MLV insertion region
publication title Structure of a Bmi-1-Ring1B Polycomb Group Ubiquitin Ligase Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein/ligase
total genus 18
structure length 100
sequence length 100
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2006-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2h0dB01
2FUIA 2LN0A 4L7XA 1WEMA 2KU3A 2KWKA 2YURA 3HTKC 1VYXA 3ZVYA 2LV9A 3KV5A 5LKUA 2YHNA 2MNYA 2LQ6A 4FJCA 3N9PA 1VFYA 1WESA 2YU4A 4NN2A 1F62A 2LGGA 2PUYA 1JM7A 1ZBDB 1WEUA 1JM7B 1WEWA 3L1XA 2KGIA 2AN6A 4YBSA 2YSJA 2VJEB 2E6RA 3T6RA 3MHSA 3C5KA 3DQVR 3M99A 1WEEA 2HDPA 3M63A 2KR4A 2KYUA 2G6QA 2QIZA 4IC2A 4LK9A 1IYMA 5LKZA 5G0FA 4A4BA 3PHDA 5D1LB 1U6GB 2JMDA 2L75A 4GNDA 2FSAA 3FL2A 3NG2A 4CA1A 3IHPA 3HCUA 2MUMA 5LKTA 3VK6A 2KWNA 2RSDA 2CKLA 2UZGA 4UI9B 2K4DA 3N9NA 2CKLB 4CCGX 2PNXA 2YQLA 3GL6A 4I7DA 5B77A 2ECJA 4IC3A 3U5PA 2DX8A 3U5MA 3MHHA 4L58A 4V3KC 3LQIA 2LRIC 5C11A 1XWHA 4I7CA 1WEOA 2YYRA 5B75A 3O37A 2M85A 1WFKA 2ECWA 3LQHA 4YAXA 1LDKC 5G04B 2KWJA 1WGMA 2KE1A 3M62A 3O70A 4YADA 5KH9A 4Q6FA 5H1UA 1Z6UA 2EA6A 3L1ZB 2MT5A 2Y1MA 3HCTA 2LXHC 3LQJA 2K16A 4UP5A 1WENA 2YSMA 2MA6A 4WA6A 5G05B 1Z60A 4GB0A 2MA5A 4LKAA 4PPEA 1HYJA 2G45A 4A49A 4ZDTA 4O64A 1MM3A 2EODA 3ZNIA 4AYCB 5TRBA 5C13A 2QJ0A 2M3HA 2H0DB 2K1JA 4X3GA 2YQMA 2VJEA 2CSZA 2E6SA 3ZPVE 4GNEA 2F42A 5AITA 4BBQA 1X4JA 4B7YC 2MD8C 4ZUXU 2YUCA 3SOWA 2L80A 2FUUA 4FIPA 4B86C 5TDRA 1DVPA 3RTRB 3SOXA 3O33A 4R8PK 3RPGB 5D1MB 2HYED 3O7AA 1RMDA 5DKAA 3GV4A 5J3XA 5I3LA 2C2VS 2LGKA 2L5UA 4P5OB 2MIQA 2KGGA 4XI1A 3ZVZB 5D1KB 5H9MA 3I2DA 1WILA 5LCWB 5B76A 4W4UA 3EB5A 4QF2A 4ZQLA 4GNFA 2YREA 2C2LA 4YABA 3C6WA 3RPGC 5DINA 2KIZA 5FERA 2G43A 1K2FA 2VJFA 1FBVA 5H1VA 2VJFB 2Y43A 4GNGA 4FK5A 5LKXA 2D8SA 3QZVA 2YHOA 2ECNA 3N9MA 2JMIA 4UP0A 3L11A 2KFTA 3U5NA 1E4UA 4LADB 4N3WA 4WZ3B 4PTBA 2LXPC 3KQIA 2K17A 3EB6A 1WE9A 1CHCA 3ZYQA 1VD4A 1JOCA 2JRJA 2VPEA 5KH3A 4LLBA 2OXQC 3V43A 5B8DA 4AVXA 5AIUA 5TABA 3N9OA 4YC9A 3ZTGA 1T1HA 2ECTA 1Z2QA 5B78A 2M1RA 1N87A 2CSYA 4YATA 1BORA 3U5OA 3KNVA 4LJNA 3KV6A 4AYCA 2H0DA 2VPGA 2RI7A 1FP0A 2XEUA 5H1TA 2VPDA 4YBMA 4V3LC 3ASLA 2VPBA 5JG6A 1WEPA 4AUQB 1WEVA 2LGVA 1G25A 3SHBA 2L0BA 5TDWA 1X4IA 3N9QA 3O36A 5B79A 2VP7A 4I7BA 4WZ2A 3ZPV1 1MM2A 2YT5A 2LDRA 2VNFA 3LRQA 4WZ0A 3O34A 2XB1A 4TKPB 4R7EA 2ECVA 2F6NA 4A0CD 1WEQA 2NAAA 4AP4A 2MD7B 2KWOA 3DPLR 1HYIA 2M6MA 1X4UA 3SOUA 4QF3A 2MNZA 1V87A 3PURA 3O35A 4MVTA 2YW8A 4S3OB 4N4FA 2QICA 4FO9A 2I50A 2ECGA 2KREA 3PUQA 3N9LA 2IDAA 5TBNA 4MSXA 4R2YA 2BAYA 2L43A 3T7LA 2F6JA 2CT2A 2Y1NA 5FB1A 5KH7A 2JMJA 4BHWA 2EGPA 4S3OC 5FB0A 1LDJB 5FEYA 4YBTA 4C9ZA 2ZETC 2ECIA 2LGLA 1WIMA 4A4CA 5EYAF 4F52B 3HCSA
chains in the Genus database with same CATH superfamily
2FUIA 2LN0A 4L7XA 1WEMA 2KU3A 2KWKA 2YURA 3HTKC 1VYXA 5K3QA 3ZVYA 2D8UA 2LV9A 3KV5A 5LKUA 2YHNA 2MNYA 2LQ6A 4FJCA 3FM8C 2MKEA 1VFYA 3N9PA 1WESA 2YU4A 4NN2A 1F62A 2LGGA 2PUYA 1JM7A 1ZBDB 3FAOA 1WEUA 1JM7B 1WEWA 3L1XA 2XOCA 2KGIA 2AN6A 4YBSA 2YSJA 4QQ4A 2VJEB 2E6RA 3T6RA 3MHSA 3C5KA 3DQVR 3M99A 1WEEA 2HDPA 3LVRE 2KR4A 3M63A 2KYUA 2G6QA 2QIZA 4IC2A 4LK9A 1IYMA 4H9DA 5LKZA 5G0FA 2XP0A 5SVXA 4A4BA 3PHDA 5D1LB 1U6GB 2JMDA 2L75A 4GNDA 3JUEA 2FSAA 2M13A 3FL2A 3NG2A 4CA1A 3IHPA 3HCUA 2MUMA 5LKTA 1MBMA 3VK6A 4O62A 2KWNA 2RSDA 2CKLA 2UZGA 4UI9B 2K4DA 3N9NA 2CKLB 4CCGX 2PNXA 2YQLA 4Z0RA 3GL6A 4I7DA 3M7KA 5B77A 2ECJA 4IC3A 3U5PA 2DX8A 3U5MA 3MHHA 4L58A 4V3KC 3LQIA 2DJAA 2LRIC 4F1PA 5C11A 1XWHA 4I7CA 1WEOA 2YYRA 2RR4A 5B75A 3O37A 2M85A 1WFKA 2ECWA 2IQJA 3LQHA 4YAXA 1LDKC 5G04B 2KWJA 1WGMA 2CRWA 2KE1A 3M62A 3O70A 4YADA 5KH9A 4Q6FA 5H1UA 2EXUA 1Z6UA 2EA6A 3DDTA 3L1ZB 2MT5A 2Y1MA 3HCTA 2LXHC 3LQJA 2K16A 4UP5A 1WENA 2YSMA 3T9KA 2MA6A 4WA6A 5G05B 1Z60A 1DCQA 2XOYA 4GB0A 2MA5A 4LKAA 2KKXA 2FD4A 4PPEA 1HYJA 4OGCA 2G45A 4A49A 4ZDTA 4O64A 1MM3A 2EODA 3ZNIA 4AYCB 2CONA 5TRBA 5C13A 2QJ0A 2M3HA 2H0DB 4OGEA 2K1JA 4X3GA 2YQMA 2VJEA 2CSZA 3KDEC 2E6SA 3ZPVE 4GNEA 2F42A 5AITA 4BBQA 1X4JA 4B7YC 2JM3A 2MD8C 4ZUXU 2YUCA 3SOWA 2L80A 2FUUA 4FIPA 4B86C 5TDRA 1DVPA 3RTRB 3SOXA 3O33A 4R8PK 3DWDA 3RPGB 5D1MB 2HYED 3O7AA 1RMDA 3MDBC 5DKAA 3GV4A 5J3XA 3FANA 5I3LA 2DSMA 2C2VS 2LGKA 2L5UA 4P5OB 2MIQA 2KGGA 4XI1A 3ZVZB 5D1KB 5H9MA 3I2DA 1WILA 5LCWB 5B76A 4W4UA 3EB5A 4QF2A 4ZQLA 4GNFA 2YREA 2C2LA 4YABA 3C6WA 3RPGC 5DINA 2KIZA 5FERA 2G43A 1K2FA 3LJUX 2VJFA 1FBVA 5H1VA 3H7HA 2VJFB 2Y43A 4GNGA 4FK5A 5LKXA 2D8SA 3QZVA 2YHOA 2P57A 2ECNA 3N9MA 2JMIA 4UP0A 3L11A 2KFTA 5SVYA 3FEHA 3U5NA 1E4UA 4LADB 4N3WA 4WZ3B 4PTBA 2LXPC 3KQIA 2K17A 3EB6A 1WE9A 1CHCA 3ZYQA 1VD4A 1JOCA 2JRJA 2VPEA 5KH3A 2CRRA 4LLBA 2OXQC 3V43A 5B8DA 4AVXA 5AIUA 5TABA 2CSVA 3N9OA 4YC9A 3ZTGA 1T1HA 2ECTA 1Z2QA 5B78A 2M1RA 2LAUA 1N87A 2CSYA 4YATA 1BORA 3U5OA 3KNVA 4LJNA 3KV6A 4AYCA 2H0DA 2VPGA 2RI7A 1FP0A 2XEUA 5H1TA 2FFWA 2VPDA 2YVRA 4YBMA 4V3LC 2L7PA 3ASLA 2VPBA 5JG6A 1WEPA 2OWAA 4AUQB 1WEVA 2LGVA 3SUBA 1G25A 3SHBA 2L0BA 5TDWA 1X4IA 3N9QA 2XOZA 3O36A 5B79A 2VP7A 4I7BA 4Z0OA 4WZ2A 3ZPV1 1MM2A 2YT5A 2JUNA 2LDRA 2VNFA 3LRQA 4WZ0A 3O34A 2XB1A 3LVQE 4TKPB 4R7EA 2ECVA 2F6NA 4A0CD 1WEQA 2NAAA 4AP4A 2MD7B 2KWOA 3DPLR 1HYIA 2M6MA 2B0OE 1X4UA 3SOUA 4QF3A 2MNZA 1V87A 3PURA 3O47A 3O35A 4MVTA 2YW8A 4S3OB 4N4FA 2QICA 4FO9A 5SVIA 2I50A 2ECGA 2KREA 3PUQA 3N9LA 5SVIB 3PLWA 2IDAA 5TBNA 4MSXA 3Q1DA 2E61A 4R2YA 2BAYA 2L43A 3FJUB 3T7LA 2F6JA 2CT2A 3E2DA 2Y1NA 5FB1A 5KH7A 2JMJA 4BHWA 2EGPA 4S3OC 5FB0A 1LDJB 5FEYA 4YBTA 2KKYA 4C9ZA 2ZETC 2ECIA 2LGLA 1WIMA 4A4CA 5EYAF 4F52B 2EGMA 3LDYA 3HCSA
chains in the Genus database with same CATH topology
2FUIA 2LN0A 4L7XA 1WEMA 2KU3A 2KWKA 2YURA 3HTKC 1VYXA 3ZVYA 2LV9A 3KV5A 5LKUA 2YHNA 2MNYA 2LQ6A 4FJCA 3N9PA 1VFYA 1WESA 2YU4A 4NN2A 1F62A 2LGGA 2PUYA 1JM7A 1ZBDB 1WEUA 1JM7B 1WEWA 3L1XA 2KGIA 2AN6A 4YBSA 2YSJA 2VJEB 2E6RA 3T6RA 3MHSA 3C5KA 3DQVR 3M99A 1WEEA 2HDPA 3M63A 2KR4A 2KYUA 2G6QA 2QIZA 4IC2A 4LK9A 1IYMA 5LKZA 5G0FA 4A4BA 3PHDA 5D1LB 1U6GB 2JMDA 2L75A 4GNDA 2FSAA 3FL2A 3NG2A 4CA1A 3IHPA 3HCUA 2MUMA 5LKTA 3VK6A 2KWNA 2RSDA 2CKLA 2UZGA 4UI9B 2K4DA 3N9NA 2CKLB 4CCGX 2PNXA 2YQLA 3GL6A 4I7DA 5B77A 2ECJA 4IC3A 3U5PA 2DX8A 3U5MA 3MHHA 4L58A 4V3KC 3LQIA 2LRIC 5C11A 1XWHA 4I7CA 1WEOA 2YYRA 5B75A 3O37A 2M85A 1WFKA 2ECWA 3LQHA 4YAXA 1LDKC 5G04B 2KWJA 1WGMA 2KE1A 3M62A 3O70A 4YADA 5KH9A 4Q6FA 5H1UA 1Z6UA 2EA6A 3L1ZB 2MT5A 2Y1MA 3HCTA 2LXHC 3LQJA 2K16A 4UP5A 1WENA 2YSMA 2MA6A 4WA6A 5G05B 1Z60A 4GB0A 2MA5A 4LKAA 4PPEA 1HYJA 2G45A 4A49A 4ZDTA 4O64A 1MM3A 2EODA 3ZNIA 4AYCB 5TRBA 5C13A 2QJ0A 2M3HA 2H0DB 2K1JA 4X3GA 2YQMA 2VJEA 2CSZA 2E6SA 3ZPVE 4GNEA 2F42A 5AITA 4BBQA 1X4JA 4B7YC 2MD8C 4ZUXU 2YUCA 3SOWA 2L80A 2FUUA 4FIPA 4B86C 5TDRA 1DVPA 3RTRB 3SOXA 3O33A 4R8PK 3RPGB 5D1MB 2HYED 3O7AA 1RMDA 5DKAA 3GV4A 5J3XA 5I3LA 2C2VS 2LGKA 2L5UA 4P5OB 2MIQA 2KGGA 4XI1A 3ZVZB 5D1KB 5H9MA 3I2DA 1WILA 5LCWB 5B76A 4W4UA 3EB5A 4QF2A 4ZQLA 4GNFA 2YREA 2C2LA 4YABA 3C6WA 3RPGC 5DINA 2KIZA 5FERA 2G43A 1K2FA 2VJFA 1FBVA 5H1VA 2VJFB 2Y43A 4GNGA 4FK5A 5LKXA 2D8SA 3QZVA 2YHOA 2ECNA 3N9MA 2JMIA 4UP0A 3L11A 2KFTA 3U5NA 1E4UA 4LADB 4N3WA 4WZ3B 4PTBA 2LXPC 3KQIA 2K17A 3EB6A 1WE9A 1CHCA 3ZYQA 1VD4A 1JOCA 2JRJA 2VPEA 5KH3A 4LLBA 2OXQC 3V43A 5B8DA 4AVXA 5AIUA 5TABA 3N9OA 4YC9A 3ZTGA 1T1HA 2ECTA 1Z2QA 5B78A 2M1RA 1N87A 2CSYA 4YATA 1BORA 3U5OA 3KNVA 4LJNA 3KV6A 4AYCA 2H0DA 2VPGA 2RI7A 1FP0A 2XEUA 5H1TA 2VPDA 4YBMA 4V3LC 3ASLA 2VPBA 5JG6A 1WEPA 4AUQB 1WEVA 2LGVA 1G25A 3SHBA 2L0BA 5TDWA 1X4IA 3N9QA 3O36A 5B79A 2VP7A 4I7BA 4WZ2A 3ZPV1 1MM2A 2YT5A 2LDRA 2VNFA 3LRQA 4WZ0A 3O34A 2XB1A 4TKPB 4R7EA 2ECVA 2F6NA 4A0CD 1WEQA 2NAAA 4AP4A 2MD7B 2KWOA 3DPLR 1HYIA 2M6MA 1X4UA 3SOUA 4QF3A 2MNZA 1V87A 3PURA 3O35A 4MVTA 2YW8A 4S3OB 4N4FA 2QICA 4FO9A 2I50A 2ECGA 2KREA 3PUQA 3N9LA 2IDAA 5TBNA 4MSXA 4R2YA 2BAYA 2L43A 3T7LA 2F6JA 2CT2A 2Y1NA 5FB1A 5KH7A 2JMJA 4BHWA 2EGPA 4S3OC 5FB0A 1LDJB 5FEYA 4YBTA 4C9ZA 2ZETC 2ECIA 2LGLA 1WIMA 4A4CA 5EYAF 4F52B 3HCSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FUI A;  2LN0 A;  4L7X A;  1WEM A;  2KU3 A;  2KWK A;  2YUR A;  3HTK C;  1VYX A;  3ZVY A;  2LV9 A;  3KV5 A;  5LKU A;  2YHN A;  2MNY A;  2LQ6 A;  4FJC A;  3N9P A;  1VFY A;  1WES A;  2YU4 A;  4NN2 A;  1F62 A;  2LGG A;  2PUY A;  1JM7 A;  1ZBD B;  1WEU A;  1JM7 B;  1WEW A;  3L1X A;  2KGI A;  2AN6 A;  4YBS A;  2YSJ A;  2VJE B;  2E6R A;  3T6R A;  3MHS A;  3C5K A;  3DQV R;  3M99 A;  1WEE A;  2HDP A;  3M63 A;  2KR4 A;  2KYU A;  2G6Q A;  2QIZ A;  4IC2 A;  4LK9 A;  1IYM A;  5LKZ A;  5G0F A;  4A4B A;  3PHD A;  5D1L B;  1U6G B;  2JMD A;  2L75 A;  4GND A;  2FSA A;  3FL2 A;  3NG2 A;  4CA1 A;  3IHP A;  3HCU A;  2MUM A;  5LKT A;  3VK6 A;  2KWN A;  2RSD A;  2CKL A;  2UZG A;  4UI9 B;  2K4D A;  3N9N A;  2CKL B;  4CCG X;  2PNX A;  2YQL A;  3GL6 A;  4I7D A;  5B77 A;  2ECJ A;  4IC3 A;  3U5P A;  2DX8 A;  3U5M A;  3MHH A;  4L58 A;  4V3K C;  3LQI A;  2LRI C;  5C11 A;  1XWH A;  4I7C A;  1WEO A;  2YYR A;  5B75 A;  3O37 A;  2M85 A;  1WFK A;  2ECW A;  3LQH A;  4YAX A;  1LDK C;  5G04 B;  2KWJ A;  1WGM A;  2KE1 A;  3M62 A;  3O70 A;  4YAD A;  5KH9 A;  4Q6F A;  5H1U A;  1Z6U A;  2EA6 A;  3L1Z B;  2MT5 A;  2Y1M A;  3HCT A;  2LXH C;  3LQJ A;  2K16 A;  4UP5 A;  1WEN A;  2YSM A;  2MA6 A;  4WA6 A;  5G05 B;  1Z60 A;  4GB0 A;  2MA5 A;  4LKA A;  4PPE A;  1HYJ A;  2G45 A;  4A49 A;  4ZDT A;  4O64 A;  1MM3 A;  2EOD A;  3ZNI A;  4AYC B;  5TRB A;  5C13 A;  2QJ0 A;  2M3H A;  2H0D B;  2K1J A;  4X3G A;  2YQM A;  2VJE A;  2CSZ A;  2E6S A;  3ZPV E;  4GNE A;  2F42 A;  5AIT A;  4BBQ A;  1X4J A;  4B7Y C;  2MD8 C;  4ZUX U;  2YUC A;  3SOW A;  2L80 A;  2FUU A;  4FIP A;  4B86 C;  5TDR A;  1DVP A;  3RTR B;  3SOX A;  3O33 A;  4R8P K;  3RPG B;  5D1M B;  2HYE D;  3O7A A;  1RMD A;  5DKA A;  3GV4 A;  5J3X A;  5I3L A;  2C2V S;  2LGK A;  2L5U A;  4P5O B;  2MIQ A;  2KGG A;  4XI1 A;  3ZVZ B;  5D1K B;  5H9M A;  3I2D A;  1WIL A;  5LCW B;  5B76 A;  4W4U A;  3EB5 A;  4QF2 A;  4ZQL A;  4GNF A;  2YRE A;  2C2L A;  4YAB A;  3C6W A;  3RPG C;  5DIN A;  2KIZ A;  5FER A;  2G43 A;  1K2F A;  2VJF A;  1FBV A;  5H1V A;  2VJF B;  2Y43 A;  4GNG A;  4FK5 A;  5LKX A;  2D8S A;  3QZV A;  2YHO A;  2ECN A;  3N9M A;  2JMI A;  4UP0 A;  3L11 A;  2KFT A;  3U5N A;  1E4U A;  4LAD B;  4N3W A;  4WZ3 B;  4PTB A;  2LXP C;  3KQI A;  2K17 A;  3EB6 A;  1WE9 A;  1CHC A;  3ZYQ A;  1VD4 A;  1JOC A;  2JRJ A;  2VPE A;  5KH3 A;  4LLB A;  2OXQ C;  3V43 A;  5B8D A;  4AVX A;  5AIU A;  5TAB A;  3N9O A;  4YC9 A;  3ZTG A;  1T1H A;  2ECT A;  1Z2Q A;  5B78 A;  2M1R A;  1N87 A;  2CSY A;  4YAT A;  1BOR A;  3U5O A;  3KNV A;  4LJN A;  3KV6 A;  4AYC A;  2H0D A;  2VPG A;  2RI7 A;  1FP0 A;  2XEU A;  5H1T A;  2VPD A;  4YBM A;  4V3L C;  3ASL A;  2VPB A;  5JG6 A;  1WEP A;  4AUQ B;  1WEV A;  2LGV A;  1G25 A;  3SHB A;  2L0B A;  5TDW A;  1X4I A;  3N9Q A;  3O36 A;  5B79 A;  2VP7 A;  4I7B A;  4WZ2 A;  3ZPV 1;  1MM2 A;  2YT5 A;  2LDR A;  2VNF A;  3LRQ A;  4WZ0 A;  3O34 A;  2XB1 A;  4TKP B;  4R7E A;  2ECV A;  2F6N A;  4A0C D;  1WEQ A;  2NAA A;  4AP4 A;  2MD7 B;  2KWO A;  3DPL R;  1HYI A;  2M6M A;  1X4U A;  3SOU A;  4QF3 A;  2MNZ A;  1V87 A;  3PUR A;  3O35 A;  4MVT A;  2YW8 A;  4S3O B;  4N4F A;  2QIC A;  4FO9 A;  2I50 A;  2ECG A;  2KRE A;  3PUQ A;  3N9L A;  2IDA A;  5TBN A;  4MSX A;  4R2Y A;  2BAY A;  2L43 A;  3T7L A;  2F6J A;  2CT2 A;  2Y1N A;  5FB1 A;  5KH7 A;  2JMJ A;  4BHW A;  2EGP A;  4S3O C;  5FB0 A;  1LDJ B;  5FEY A;  4YBT A;  4C9Z A;  2ZET C;  2ECI A;  2LGL A;  1WIM A;  4A4C A;  5EYA F;  4F52 B;  3HCS A; 
#chains in the Genus database with same CATH topology
 2FUI A;  2LN0 A;  4L7X A;  1WEM A;  2KU3 A;  2KWK A;  2YUR A;  3HTK C;  1VYX A;  5K3Q A;  3ZVY A;  2D8U A;  2LV9 A;  3KV5 A;  5LKU A;  2YHN A;  2MNY A;  2LQ6 A;  4FJC A;  3FM8 C;  2MKE A;  1VFY A;  3N9P A;  1WES A;  2YU4 A;  4NN2 A;  1F62 A;  2LGG A;  2PUY A;  1JM7 A;  1ZBD B;  3FAO A;  1WEU A;  1JM7 B;  1WEW A;  3L1X A;  2XOC A;  2KGI A;  2AN6 A;  4YBS A;  2YSJ A;  4QQ4 A;  2VJE B;  2E6R A;  3T6R A;  3MHS A;  3C5K A;  3DQV R;  3M99 A;  1WEE A;  2HDP A;  3LVR E;  2KR4 A;  3M63 A;  2KYU A;  2G6Q A;  2QIZ A;  4IC2 A;  4LK9 A;  1IYM A;  4H9D A;  5LKZ A;  5G0F A;  2XP0 A;  5SVX A;  4A4B A;  3PHD A;  5D1L B;  1U6G B;  2JMD A;  2L75 A;  4GND A;  3JUE A;  2FSA A;  2M13 A;  3FL2 A;  3NG2 A;  4CA1 A;  3IHP A;  3HCU A;  2MUM A;  5LKT A;  1MBM A;  3VK6 A;  4O62 A;  2KWN A;  2RSD A;  2CKL A;  2UZG A;  4UI9 B;  2K4D A;  3N9N A;  2CKL B;  4CCG X;  2PNX A;  2YQL A;  4Z0R A;  3GL6 A;  4I7D A;  3M7K A;  5B77 A;  2ECJ A;  4IC3 A;  3U5P A;  2DX8 A;  3U5M A;  3MHH A;  4L58 A;  4V3K C;  3LQI A;  2DJA A;  2LRI C;  4F1P A;  5C11 A;  1XWH A;  4I7C A;  1WEO A;  2YYR A;  2RR4 A;  5B75 A;  3O37 A;  2M85 A;  1WFK A;  2ECW A;  2IQJ A;  3LQH A;  4YAX A;  1LDK C;  5G04 B;  2KWJ A;  1WGM A;  2CRW A;  2KE1 A;  3M62 A;  3O70 A;  4YAD A;  5KH9 A;  4Q6F A;  5H1U A;  2EXU A;  1Z6U A;  2EA6 A;  3DDT A;  3L1Z B;  2MT5 A;  2Y1M A;  3HCT A;  2LXH C;  3LQJ A;  2K16 A;  4UP5 A;  1WEN A;  2YSM A;  3T9K A;  2MA6 A;  4WA6 A;  5G05 B;  1Z60 A;  1DCQ A;  2XOY A;  4GB0 A;  2MA5 A;  4LKA A;  2KKX A;  2FD4 A;  4PPE A;  1HYJ A;  4OGC A;  2G45 A;  4A49 A;  4ZDT A;  4O64 A;  1MM3 A;  2EOD A;  3ZNI A;  4AYC B;  2CON A;  5TRB A;  5C13 A;  2QJ0 A;  2M3H A;  2H0D B;  4OGE A;  2K1J A;  4X3G A;  2YQM A;  2VJE A;  2CSZ A;  3KDE C;  2E6S A;  3ZPV E;  4GNE A;  2F42 A;  5AIT A;  4BBQ A;  1X4J A;  4B7Y C;  2JM3 A;  2MD8 C;  4ZUX U;  2YUC A;  3SOW A;  2L80 A;  2FUU A;  4FIP A;  4B86 C;  5TDR A;  1DVP A;  3RTR B;  3SOX A;  3O33 A;  4R8P K;  3DWD A;  3RPG B;  5D1M B;  2HYE D;  3O7A A;  1RMD A;  3MDB C;  5DKA A;  3GV4 A;  5J3X A;  3FAN A;  5I3L A;  2DSM A;  2C2V S;  2LGK A;  2L5U A;  4P5O B;  2MIQ A;  2KGG A;  4XI1 A;  3ZVZ B;  5D1K B;  5H9M A;  3I2D A;  1WIL A;  5LCW B;  5B76 A;  4W4U A;  3EB5 A;  4QF2 A;  4ZQL A;  4GNF A;  2YRE A;  2C2L A;  4YAB A;  3C6W A;  3RPG C;  5DIN A;  2KIZ A;  5FER A;  2G43 A;  1K2F A;  3LJU X;  2VJF A;  1FBV A;  5H1V A;  3H7H A;  2VJF B;  2Y43 A;  4GNG A;  4FK5 A;  5LKX A;  2D8S A;  3QZV A;  2YHO A;  2P57 A;  2ECN A;  3N9M A;  2JMI A;  4UP0 A;  3L11 A;  2KFT A;  5SVY A;  3FEH A;  3U5N A;  1E4U A;  4LAD B;  4N3W A;  4WZ3 B;  4PTB A;  2LXP C;  3KQI A;  2K17 A;  3EB6 A;  1WE9 A;  1CHC A;  3ZYQ A;  1VD4 A;  1JOC A;  2JRJ A;  2VPE A;  5KH3 A;  2CRR A;  4LLB A;  2OXQ C;  3V43 A;  5B8D A;  4AVX A;  5AIU A;  5TAB A;  2CSV A;  3N9O A;  4YC9 A;  3ZTG A;  1T1H A;  2ECT A;  1Z2Q A;  5B78 A;  2M1R A;  2LAU A;  1N87 A;  2CSY A;  4YAT A;  1BOR A;  3U5O A;  3KNV A;  4LJN A;  3KV6 A;  4AYC A;  2H0D A;  2VPG A;  2RI7 A;  1FP0 A;  2XEU A;  5H1T A;  2FFW A;  2VPD A;  2YVR A;  4YBM A;  4V3L C;  2L7P A;  3ASL A;  2VPB A;  5JG6 A;  1WEP A;  2OWA A;  4AUQ B;  1WEV A;  2LGV A;  3SUB A;  1G25 A;  3SHB A;  2L0B A;  5TDW A;  1X4I A;  3N9Q A;  2XOZ A;  3O36 A;  5B79 A;  2VP7 A;  4I7B A;  4Z0O A;  4WZ2 A;  3ZPV 1;  1MM2 A;  2YT5 A;  2JUN A;  2LDR A;  2VNF A;  3LRQ A;  4WZ0 A;  3O34 A;  2XB1 A;  3LVQ E;  4TKP B;  4R7E A;  2ECV A;  2F6N A;  4A0C D;  1WEQ A;  2NAA A;  4AP4 A;  2MD7 B;  2KWO A;  3DPL R;  1HYI A;  2M6M A;  2B0O E;  1X4U A;  3SOU A;  4QF3 A;  2MNZ A;  1V87 A;  3PUR A;  3O47 A;  3O35 A;  4MVT A;  2YW8 A;  4S3O B;  4N4F A;  2QIC A;  4FO9 A;  5SVI A;  2I50 A;  2ECG A;  2KRE A;  3PUQ A;  3N9L A;  5SVI B;  3PLW A;  2IDA A;  5TBN A;  4MSX A;  3Q1D A;  2E61 A;  4R2Y A;  2BAY A;  2L43 A;  3FJU B;  3T7L A;  2F6J A;  2CT2 A;  3E2D A;  2Y1N A;  5FB1 A;  5KH7 A;  2JMJ A;  4BHW A;  2EGP A;  4S3O C;  5FB0 A;  1LDJ B;  5FEY A;  4YBT A;  2KKY A;  4C9Z A;  2ZET C;  2ECI A;  2LGL A;  1WIM A;  4A4C A;  5EYA F;  4F52 B;  2EGM A;  3LDY A;  3HCS A; 
#chains in the Genus database with same CATH homology
 2FUI A;  2LN0 A;  4L7X A;  1WEM A;  2KU3 A;  2KWK A;  2YUR A;  3HTK C;  1VYX A;  3ZVY A;  2LV9 A;  3KV5 A;  5LKU A;  2YHN A;  2MNY A;  2LQ6 A;  4FJC A;  3N9P A;  1VFY A;  1WES A;  2YU4 A;  4NN2 A;  1F62 A;  2LGG A;  2PUY A;  1JM7 A;  1ZBD B;  1WEU A;  1JM7 B;  1WEW A;  3L1X A;  2KGI A;  2AN6 A;  4YBS A;  2YSJ A;  2VJE B;  2E6R A;  3T6R A;  3MHS A;  3C5K A;  3DQV R;  3M99 A;  1WEE A;  2HDP A;  3M63 A;  2KR4 A;  2KYU A;  2G6Q A;  2QIZ A;  4IC2 A;  4LK9 A;  1IYM A;  5LKZ A;  5G0F A;  4A4B A;  3PHD A;  5D1L B;  1U6G B;  2JMD A;  2L75 A;  4GND A;  2FSA A;  3FL2 A;  3NG2 A;  4CA1 A;  3IHP A;  3HCU A;  2MUM A;  5LKT A;  3VK6 A;  2KWN A;  2RSD A;  2CKL A;  2UZG A;  4UI9 B;  2K4D A;  3N9N A;  2CKL B;  4CCG X;  2PNX A;  2YQL A;  3GL6 A;  4I7D A;  5B77 A;  2ECJ A;  4IC3 A;  3U5P A;  2DX8 A;  3U5M A;  3MHH A;  4L58 A;  4V3K C;  3LQI A;  2LRI C;  5C11 A;  1XWH A;  4I7C A;  1WEO A;  2YYR A;  5B75 A;  3O37 A;  2M85 A;  1WFK A;  2ECW A;  3LQH A;  4YAX A;  1LDK C;  5G04 B;  2KWJ A;  1WGM A;  2KE1 A;  3M62 A;  3O70 A;  4YAD A;  5KH9 A;  4Q6F A;  5H1U A;  1Z6U A;  2EA6 A;  3L1Z B;  2MT5 A;  2Y1M A;  3HCT A;  2LXH C;  3LQJ A;  2K16 A;  4UP5 A;  1WEN A;  2YSM A;  2MA6 A;  4WA6 A;  5G05 B;  1Z60 A;  4GB0 A;  2MA5 A;  4LKA A;  4PPE A;  1HYJ A;  2G45 A;  4A49 A;  4ZDT A;  4O64 A;  1MM3 A;  2EOD A;  3ZNI A;  4AYC B;  5TRB A;  5C13 A;  2QJ0 A;  2M3H A;  2H0D B;  2K1J A;  4X3G A;  2YQM A;  2VJE A;  2CSZ A;  2E6S A;  3ZPV E;  4GNE A;  2F42 A;  5AIT A;  4BBQ A;  1X4J A;  4B7Y C;  2MD8 C;  4ZUX U;  2YUC A;  3SOW A;  2L80 A;  2FUU A;  4FIP A;  4B86 C;  5TDR A;  1DVP A;  3RTR B;  3SOX A;  3O33 A;  4R8P K;  3RPG B;  5D1M B;  2HYE D;  3O7A A;  1RMD A;  5DKA A;  3GV4 A;  5J3X A;  5I3L A;  2C2V S;  2LGK A;  2L5U A;  4P5O B;  2MIQ A;  2KGG A;  4XI1 A;  3ZVZ B;  5D1K B;  5H9M A;  3I2D A;  1WIL A;  5LCW B;  5B76 A;  4W4U A;  3EB5 A;  4QF2 A;  4ZQL A;  4GNF A;  2YRE A;  2C2L A;  4YAB A;  3C6W A;  3RPG C;  5DIN A;  2KIZ A;  5FER A;  2G43 A;  1K2F A;  2VJF A;  1FBV A;  5H1V A;  2VJF B;  2Y43 A;  4GNG A;  4FK5 A;  5LKX A;  2D8S A;  3QZV A;  2YHO A;  2ECN A;  3N9M A;  2JMI A;  4UP0 A;  3L11 A;  2KFT A;  3U5N A;  1E4U A;  4LAD B;  4N3W A;  4WZ3 B;  4PTB A;  2LXP C;  3KQI A;  2K17 A;  3EB6 A;  1WE9 A;  1CHC A;  3ZYQ A;  1VD4 A;  1JOC A;  2JRJ A;  2VPE A;  5KH3 A;  4LLB A;  2OXQ C;  3V43 A;  5B8D A;  4AVX A;  5AIU A;  5TAB A;  3N9O A;  4YC9 A;  3ZTG A;  1T1H A;  2ECT A;  1Z2Q A;  5B78 A;  2M1R A;  1N87 A;  2CSY A;  4YAT A;  1BOR A;  3U5O A;  3KNV A;  4LJN A;  3KV6 A;  4AYC A;  2H0D A;  2VPG A;  2RI7 A;  1FP0 A;  2XEU A;  5H1T A;  2VPD A;  4YBM A;  4V3L C;  3ASL A;  2VPB A;  5JG6 A;  1WEP A;  4AUQ B;  1WEV A;  2LGV A;  1G25 A;  3SHB A;  2L0B A;  5TDW A;  1X4I A;  3N9Q A;  3O36 A;  5B79 A;  2VP7 A;  4I7B A;  4WZ2 A;  3ZPV 1;  1MM2 A;  2YT5 A;  2LDR A;  2VNF A;  3LRQ A;  4WZ0 A;  3O34 A;  2XB1 A;  4TKP B;  4R7E A;  2ECV A;  2F6N A;  4A0C D;  1WEQ A;  2NAA A;  4AP4 A;  2MD7 B;  2KWO A;  3DPL R;  1HYI A;  2M6M A;  1X4U A;  3SOU A;  4QF3 A;  2MNZ A;  1V87 A;  3PUR A;  3O35 A;  4MVT A;  2YW8 A;  4S3O B;  4N4F A;  2QIC A;  4FO9 A;  2I50 A;  2ECG A;  2KRE A;  3PUQ A;  3N9L A;  2IDA A;  5TBN A;  4MSX A;  4R2Y A;  2BAY A;  2L43 A;  3T7L A;  2F6J A;  2CT2 A;  2Y1N A;  5FB1 A;  5KH7 A;  2JMJ A;  4BHW A;  2EGP A;  4S3O C;  5FB0 A;  1LDJ B;  5FEY A;  4YBT A;  4C9Z A;  2ZET C;  2ECI A;  2LGL A;  1WIM A;  4A4C A;  5EYA F;  4F52 B;  3HCS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...