2H0DB

Structure of a bmi-1-ring1b polycomb group ubiquitin ligase complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
100
structure length
100
Chain Sequence
KTWELSLYELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Bmi-1-Ring1B Polycomb Group Ubiquitin Ligase Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein/ligase
molecule keywords B lymphoma Mo-MLV insertion region
total genus 18
structure length 100
sequence length 100
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2006-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2h0dB01
5H1UA 3FL2A 5KH9A 2YURA 4MVTA 2KFTA 5D1MB 1IYMA 1WIMA 5LKUA 5B79A 2RI7A 2VJFA 4PTBA 2K17A 4I7CA 2VNFA 2KWKA 4TKPB 3IHPA 2MUMA 2C2VS 1XWHA 3O70A 2FSAA 2YUCA 2KGGA 2LQ6A 4UI9B 4WA6A 2L5UA 1WEVA 2LXHC 3MHHA 3L1ZB 4AYCB 1WENA 4GNFA 4B86C 5D1LB 3LQHA 3SOWA 2KREA 1WFKA 2ECGA 1BORA 1Z6UA 2IDAA 2C2LA 3N9MA 1WE9A 1V87A 2M85A 2VPGA 4P5OB 2L0BA 4S3OB 3M63A 5B77A 2M6MA 4GB0A 2VJEA 5G05B 2H0DB 5JG6A 1U6GB 3HCSA 1WEPA 5B8DA 4YBSA 4YBMA 2KWOA 2RSDA 2KWJA 3EB5A 3O33A 1MM2A 2YREA 2VPBA 1VD4A 4YADA 2YU4A 3L1XA 3T7LA 2CSZA 4AUQB 1WILA 2CKLB 5H1VA 2VPEA 2E6RA 4NN2A 4AP4A 2YHOA 4BBQA 1F62A 3EB6A 2KR4A 5EYAF 4Q6FA 2Y1NA 2MNZA 5FERA 1JM7A 2YSJA 4IC3A 4ZQLA 3SHBA 1CHCA 3HCUA 4R2YA 5TABA 3ZPVE 2KIZA 4X3GA 4YATA 2MIQA 3KV6A 2KYUA 5I3LA 5AIUA 2L75A 5G0FA 4GNDA 5B76A 4WZ0A 1Z60A 2CKLA 3RPGB 2VP7A 2LDRA 3LQIA 5AITA 2G45A 4N4FA 2UZGA 3I2DA 2F6NA 4L7XA 4MSXA 4ZUXU 2ECVA 2ZETC 2ECIA 2CT2A 1WEQA 4N3WA 5C11A 4V3KC 4FO9A 4CA1A 2F42A 3LRQA 4FJCA 1WEOA 2OXQC 2Y43A 4B7YC 2KU3A 2PNXA 3SOXA 3C6WA 5J3XA 4XI1A 3O7AA 3O34A 2KWNA 2QICA 2VJFB 2QJ0A 3ZTGA 5LKXA 4YC9A 2YQMA 2KGIA 2I50A 5FB1A 5LCWB 2DX8A 2MD8C 4R7EA 1LDKC 4AYCA 5B78A 3ASLA 2LV9A 2EODA 1DVPA 5TBNA 4CCGX 2YQLA 4YABA 3HTKC 5KH3A 4LJNA 5H9MA 3GL6A 2G43A 4UP5A 3N9LA 5FEYA 2EA6A 5H1TA 2MA5A 2JRJA 4I7DA 4YAXA 3RPGC 1RMDA 2YT5A 4LKAA 1WEEA 1WGMA 3U5OA 2YHNA 1VYXA 5KH7A 2VJEB 5G04B 2XEUA 2MD7B 4ZDTA 4WZ3B 3RTRB 2LRIC 1HYIA 3N9PA 2ECTA 4BHWA 2JMDA 3QZVA 1X4IA 2MNYA 4IC2A 3M62A 1N87A 1FP0A 3U5PA 2LGVA 2ECNA 1WESA 2G6QA 2K4DA 3HCTA 1X4UA 3L11A 3O35A 2Y1MA 3ZVYA 3KV5A 4AVXA 3PHDA 4FIPA 2EGPA 4GNEA 4QF2A 1FBVA 5DKAA 2VPDA 2LN0A 3U5NA 1JM7B 4S3OC 1G25A 5LKTA 4A49A 4A0CD 2PUYA 2M3HA 4YBTA 1WEMA 2LGLA 4FK5A 4LADB 2F6JA 5FB0A 3NG2A 4QF3A 5TDRA 1MM3A 1WEWA 1WEUA 2LGGA 5TRBA 2HYED 4LLBA 2CSYA 2JMJA 2M1RA 3ZNIA 2H0DA 3PUQA 3KNVA 3N9NA 2QIZA 3KQIA 3O37A 3GV4A 2NAAA 2LXPC 4W4UA 2JMIA 4WZ2A 4L58A 2BAYA 2AN6A 3M99A 3V43A 5TDWA 1ZBDB 1Z2QA 4R8PK 2KE1A 4LK9A 1K2FA 2YSMA 3ZPV1 2LGKA 2L80A 3O36A 4PPEA 3PURA 1VFYA 1LDJB 3VK6A 3SOUA 4A4BA 2ECWA 2L43A 2MT5A 3DPLR 2HDPA 3ZYQA 4C9ZA 5C13A 4UP0A 3N9QA 1JOCA 5LKZA 3LQJA 3U5MA 4F52B 2K16A 3T6RA 4O64A 1HYJA 2YYRA 2XB1A 3ZVZB 5DINA 1E4UA 4A4CA 2FUIA 2ECJA 2MA6A 3N9OA 2D8SA 2FUUA 3DQVR 3C5KA 1T1HA 2YW8A 3MHSA 4GNGA 5B75A 4V3LC 2K1JA 2E6SA 4I7BA 1X4JA 5D1KB
chains in the Genus database with same CATH superfamily
5H1UA 3FL2A 5KH9A 2YURA 4OGCA 4MVTA 2KFTA 5D1MB 1IYMA 1WIMA 5LKUA 5B79A 2RI7A 2VJFA 3O47A 4PTBA 2K17A 4I7CA 2VNFA 2KWKA 4QQ4A 4TKPB 3IHPA 2MUMA 2C2VS 1XWHA 3O70A 2FSAA 5K3QA 2YUCA 2KGGA 2XOCA 2LQ6A 4UI9B 4WA6A 2L5UA 1WEVA 2LXHC 3MHHA 3L1ZB 4AYCB 1WENA 4GNFA 4B86C 5D1LB 3PLWA 2EGMA 3LQHA 3SOWA 2KREA 1WFKA 2ECGA 2XP0A 1BORA 1Z6UA 2IDAA 2C2LA 3N9MA 3LDYA 2JUNA 2KKXA 1WE9A 1V87A 2M85A 2VPGA 4P5OB 4OGEA 2L0BA 4S3OB 3M63A 5B77A 4O62A 2M6MA 2L7PA 4GB0A 2KKYA 2VJEA 5G05B 2H0DB 3LJUX 5JG6A 1U6GB 2MKEA 3HCSA 1WEPA 2EXUA 5B8DA 3LVQE 4YBSA 4YBMA 2KWOA 2RSDA 2KWJA 3M7KA 3EB5A 3O33A 1MM2A 2YREA 2VPBA 3SUBA 2IQJA 1VD4A 4YADA 2YU4A 3L1XA 3T7LA 2CSZA 3FANA 4AUQB 1WILA 2CKLB 5H1VA 2VPEA 2E6RA 4NN2A 4AP4A 3FAOA 2YHOA 4BBQA 1F62A 3EB6A 2KR4A 5EYAF 4Q6FA 2Y1NA 2MNZA 5FERA 1JM7A 2YSJA 4IC3A 4ZQLA 3SHBA 3DDTA 3LVRE 1CHCA 3HCUA 2FD4A 4R2YA 5TABA 3ZPVE 2KIZA 4X3GA 3KDEC 3E2DA 4YATA 2MIQA 3KV6A 2KYUA 5I3LA 5AIUA 2L75A 5G0FA 4GNDA 5B76A 4WZ0A 1Z60A 2CKLA 3RPGB 4Z0OA 2VP7A 2LDRA 3LQIA 5AITA 3FJUB 2G45A 4N4FA 2P57A 2E61A 2UZGA 2DJAA 4Z0RA 3I2DA 2F6NA 4L7XA 4MSXA 4ZUXU 2ECVA 2ZETC 2ECIA 2CT2A 1WEQA 4N3WA 5C11A 4V3KC 4FO9A 4CA1A 2F42A 3LRQA 2FFWA 4FJCA 1WEOA 2OXQC 2Y43A 4B7YC 2KU3A 2RR4A 2PNXA 3SOXA 3C6WA 5J3XA 3DWDA 4XI1A 2CONA 3O7AA 3O34A 2KWNA 2QICA 2VJFB 2QJ0A 3ZTGA 5LKXA 4YC9A 2YQMA 2KGIA 2I50A 5FB1A 5LCWB 2DX8A 2MD8C 4R7EA 1LDKC 4AYCA 5B78A 3T9KA 3ASLA 2LV9A 2CRWA 2EODA 1DVPA 4H9DA 5TBNA 4CCGX 2YQLA 4YABA 3HTKC 5KH3A 4LJNA 5H9MA 3GL6A 5SVYA 2G43A 4UP5A 3N9LA 5FEYA 2EA6A 5SVIB 5H1TA 2MA5A 2JRJA 4I7DA 4YAXA 3RPGC 1RMDA 2YT5A 4LKAA 1WEEA 1WGMA 3U5OA 2YHNA 1VYXA 5KH7A 2VJEB 5G04B 3MDBC 2XEUA 2MD7B 4ZDTA 4WZ3B 3RTRB 2LRIC 1HYIA 3N9PA 2ECTA 4BHWA 2CSVA 2JMDA 2XOYA 3QZVA 1X4IA 2MNYA 4IC2A 3M62A 1N87A 1FP0A 3U5PA 2LGVA 2M13A 2B0OE 2ECNA 1WESA 2G6QA 2K4DA 3FM8C 3HCTA 1X4UA 3L11A 3O35A 2Y1MA 3KV5A 3ZVYA 4AVXA 3H7HA 3PHDA 4FIPA 2EGPA 4GNEA 4QF2A 1FBVA 5DKAA 2VPDA 2LN0A 3U5NA 1JM7B 4S3OC 1G25A 5LKTA 4A49A 4A0CD 2PUYA 2M3HA 4YBTA 2JM3A 1WEMA 2LGLA 4LADB 4FK5A 2F6JA 5FB0A 2OWAA 3NG2A 4QF3A 5TDRA 3Q1DA 1MM3A 1WEWA 1WEUA 5SVXA 2LGGA 5TRBA 2HYED 4LLBA 2CSYA 2JMJA 2M1RA 3ZNIA 2H0DA 3PUQA 3KNVA 3N9NA 2QIZA 3KQIA 2DSMA 2D8UA 3GV4A 3O37A 2NAAA 3FEHA 1DCQA 2YVRA 2LXPC 4W4UA 2JMIA 4WZ2A 4L58A 2BAYA 2AN6A 3M99A 4F1PA 3V43A 5TDWA 1ZBDB 1Z2QA 4R8PK 2KE1A 4LK9A 2XOZA 1K2FA 2YSMA 3ZPV1 2LGKA 2L80A 3O36A 4PPEA 3PURA 1VFYA 1LDJB 3VK6A 1MBMA 3SOUA 4A4BA 2ECWA 2L43A 2MT5A 3DPLR 2HDPA 3ZYQA 4C9ZA 5C13A 4UP0A 3N9QA 1JOCA 5LKZA 3LQJA 3U5MA 4F52B 2K16A 3T6RA 4O64A 1HYJA 2YYRA 2XB1A 2CRRA 3ZVZB 5DINA 1E4UA 4A4CA 2FUIA 2ECJA 2MA6A 3N9OA 2D8SA 2FUUA 3DQVR 2LAUA 3C5KA 1T1HA 5SVIA 2YW8A 3MHSA 4GNGA 5B75A 4V3LC 3JUEA 2K1JA 2E6SA 4I7BA 1X4JA 5D1KB
chains in the Genus database with same CATH topology
5H1UA 3FL2A 5KH9A 2YURA 4MVTA 2KFTA 5D1MB 1IYMA 1WIMA 5LKUA 5B79A 2RI7A 2VJFA 4PTBA 2K17A 4I7CA 2VNFA 2KWKA 4TKPB 3IHPA 2MUMA 2C2VS 1XWHA 3O70A 2FSAA 2YUCA 2KGGA 2LQ6A 4UI9B 4WA6A 2L5UA 1WEVA 2LXHC 3MHHA 3L1ZB 4AYCB 1WENA 4GNFA 4B86C 5D1LB 3LQHA 3SOWA 2KREA 1WFKA 2ECGA 1BORA 1Z6UA 2IDAA 2C2LA 3N9MA 1WE9A 1V87A 2M85A 2VPGA 4P5OB 2L0BA 4S3OB 3M63A 5B77A 2M6MA 4GB0A 2VJEA 5G05B 2H0DB 5JG6A 1U6GB 3HCSA 1WEPA 5B8DA 4YBSA 4YBMA 2KWOA 2RSDA 2KWJA 3EB5A 3O33A 1MM2A 2YREA 2VPBA 1VD4A 4YADA 2YU4A 3L1XA 3T7LA 2CSZA 4AUQB 1WILA 2CKLB 5H1VA 2VPEA 2E6RA 4NN2A 4AP4A 2YHOA 4BBQA 1F62A 3EB6A 2KR4A 5EYAF 4Q6FA 2Y1NA 2MNZA 5FERA 1JM7A 2YSJA 4IC3A 4ZQLA 3SHBA 1CHCA 3HCUA 4R2YA 5TABA 3ZPVE 2KIZA 4X3GA 4YATA 2MIQA 3KV6A 2KYUA 5I3LA 5AIUA 2L75A 5G0FA 4GNDA 5B76A 4WZ0A 1Z60A 2CKLA 3RPGB 2VP7A 2LDRA 3LQIA 5AITA 2G45A 4N4FA 2UZGA 3I2DA 2F6NA 4L7XA 4MSXA 4ZUXU 2ECVA 2ZETC 2ECIA 2CT2A 1WEQA 4N3WA 5C11A 4V3KC 4FO9A 4CA1A 2F42A 3LRQA 4FJCA 1WEOA 2OXQC 2Y43A 4B7YC 2KU3A 2PNXA 3SOXA 3C6WA 5J3XA 4XI1A 3O7AA 3O34A 2KWNA 2QICA 2VJFB 2QJ0A 3ZTGA 5LKXA 4YC9A 2YQMA 2KGIA 2I50A 5FB1A 5LCWB 2DX8A 2MD8C 4R7EA 1LDKC 4AYCA 5B78A 3ASLA 2LV9A 2EODA 1DVPA 5TBNA 4CCGX 2YQLA 4YABA 3HTKC 5KH3A 4LJNA 5H9MA 3GL6A 2G43A 4UP5A 3N9LA 5FEYA 2EA6A 5H1TA 2MA5A 2JRJA 4I7DA 4YAXA 3RPGC 1RMDA 2YT5A 4LKAA 1WEEA 1WGMA 3U5OA 2YHNA 1VYXA 5KH7A 2VJEB 5G04B 2XEUA 2MD7B 4ZDTA 4WZ3B 3RTRB 2LRIC 1HYIA 3N9PA 2ECTA 4BHWA 2JMDA 3QZVA 1X4IA 2MNYA 4IC2A 3M62A 1N87A 1FP0A 3U5PA 2LGVA 2ECNA 1WESA 2G6QA 2K4DA 3HCTA 1X4UA 3L11A 3O35A 2Y1MA 3ZVYA 3KV5A 4AVXA 3PHDA 4FIPA 2EGPA 4GNEA 4QF2A 1FBVA 5DKAA 2VPDA 2LN0A 3U5NA 1JM7B 4S3OC 1G25A 5LKTA 4A49A 4A0CD 2PUYA 2M3HA 4YBTA 1WEMA 2LGLA 4FK5A 4LADB 2F6JA 5FB0A 3NG2A 4QF3A 5TDRA 1MM3A 1WEWA 1WEUA 2LGGA 5TRBA 2HYED 4LLBA 2CSYA 2JMJA 2M1RA 3ZNIA 2H0DA 3PUQA 3KNVA 3N9NA 2QIZA 3KQIA 3O37A 3GV4A 2NAAA 2LXPC 4W4UA 2JMIA 4WZ2A 4L58A 2BAYA 2AN6A 3M99A 3V43A 5TDWA 1ZBDB 1Z2QA 4R8PK 2KE1A 4LK9A 1K2FA 2YSMA 3ZPV1 2LGKA 2L80A 3O36A 4PPEA 3PURA 1VFYA 1LDJB 3VK6A 3SOUA 4A4BA 2ECWA 2L43A 2MT5A 3DPLR 2HDPA 3ZYQA 4C9ZA 5C13A 4UP0A 3N9QA 1JOCA 5LKZA 3LQJA 3U5MA 4F52B 2K16A 3T6RA 4O64A 1HYJA 2YYRA 2XB1A 3ZVZB 5DINA 1E4UA 4A4CA 2FUIA 2ECJA 2MA6A 3N9OA 2D8SA 2FUUA 3DQVR 3C5KA 1T1HA 2YW8A 3MHSA 4GNGA 5B75A 4V3LC 2K1JA 2E6SA 4I7BA 1X4JA 5D1KB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H1U A;  3FL2 A;  5KH9 A;  2YUR A;  4MVT A;  2KFT A;  5D1M B;  1IYM A;  1WIM A;  5LKU A;  5B79 A;  2RI7 A;  2VJF A;  4PTB A;  2K17 A;  4I7C A;  2VNF A;  2KWK A;  4TKP B;  3IHP A;  2MUM A;  2C2V S;  1XWH A;  3O70 A;  2FSA A;  2YUC A;  2KGG A;  2LQ6 A;  4UI9 B;  4WA6 A;  2L5U A;  1WEV A;  2LXH C;  3MHH A;  3L1Z B;  4AYC B;  1WEN A;  4GNF A;  4B86 C;  5D1L B;  3LQH A;  3SOW A;  2KRE A;  1WFK A;  2ECG A;  1BOR A;  1Z6U A;  2IDA A;  2C2L A;  3N9M A;  1WE9 A;  1V87 A;  2M85 A;  2VPG A;  4P5O B;  2L0B A;  4S3O B;  3M63 A;  5B77 A;  2M6M A;  4GB0 A;  2VJE A;  5G05 B;  2H0D B;  5JG6 A;  1U6G B;  3HCS A;  1WEP A;  5B8D A;  4YBS A;  4YBM A;  2KWO A;  2RSD A;  2KWJ A;  3EB5 A;  3O33 A;  1MM2 A;  2YRE A;  2VPB A;  1VD4 A;  4YAD A;  2YU4 A;  3L1X A;  3T7L A;  2CSZ A;  4AUQ B;  1WIL A;  2CKL B;  5H1V A;  2VPE A;  2E6R A;  4NN2 A;  4AP4 A;  2YHO A;  4BBQ A;  1F62 A;  3EB6 A;  2KR4 A;  5EYA F;  4Q6F A;  2Y1N A;  2MNZ A;  5FER A;  1JM7 A;  2YSJ A;  4IC3 A;  4ZQL A;  3SHB A;  1CHC A;  3HCU A;  4R2Y A;  5TAB A;  3ZPV E;  2KIZ A;  4X3G A;  4YAT A;  2MIQ A;  3KV6 A;  2KYU A;  5I3L A;  5AIU A;  2L75 A;  5G0F A;  4GND A;  5B76 A;  4WZ0 A;  1Z60 A;  2CKL A;  3RPG B;  2VP7 A;  2LDR A;  3LQI A;  5AIT A;  2G45 A;  4N4F A;  2UZG A;  3I2D A;  2F6N A;  4L7X A;  4MSX A;  4ZUX U;  2ECV A;  2ZET C;  2ECI A;  2CT2 A;  1WEQ A;  4N3W A;  5C11 A;  4V3K C;  4FO9 A;  4CA1 A;  2F42 A;  3LRQ A;  4FJC A;  1WEO A;  2OXQ C;  2Y43 A;  4B7Y C;  2KU3 A;  2PNX A;  3SOX A;  3C6W A;  5J3X A;  4XI1 A;  3O7A A;  3O34 A;  2KWN A;  2QIC A;  2VJF B;  2QJ0 A;  3ZTG A;  5LKX A;  4YC9 A;  2YQM A;  2KGI A;  2I50 A;  5FB1 A;  5LCW B;  2DX8 A;  2MD8 C;  4R7E A;  1LDK C;  4AYC A;  5B78 A;  3ASL A;  2LV9 A;  2EOD A;  1DVP A;  5TBN A;  4CCG X;  2YQL A;  4YAB A;  3HTK C;  5KH3 A;  4LJN A;  5H9M A;  3GL6 A;  2G43 A;  4UP5 A;  3N9L A;  5FEY A;  2EA6 A;  5H1T A;  2MA5 A;  2JRJ A;  4I7D A;  4YAX A;  3RPG C;  1RMD A;  2YT5 A;  4LKA A;  1WEE A;  1WGM A;  3U5O A;  2YHN A;  1VYX A;  5KH7 A;  2VJE B;  5G04 B;  2XEU A;  2MD7 B;  4ZDT A;  4WZ3 B;  3RTR B;  2LRI C;  1HYI A;  3N9P A;  2ECT A;  4BHW A;  2JMD A;  3QZV A;  1X4I A;  2MNY A;  4IC2 A;  3M62 A;  1N87 A;  1FP0 A;  3U5P A;  2LGV A;  2ECN A;  1WES A;  2G6Q A;  2K4D A;  3HCT A;  1X4U A;  3L11 A;  3O35 A;  2Y1M A;  3ZVY A;  3KV5 A;  4AVX A;  3PHD A;  4FIP A;  2EGP A;  4GNE A;  4QF2 A;  1FBV A;  5DKA A;  2VPD A;  2LN0 A;  3U5N A;  1JM7 B;  4S3O C;  1G25 A;  5LKT A;  4A49 A;  4A0C D;  2PUY A;  2M3H A;  4YBT A;  1WEM A;  2LGL A;  4FK5 A;  4LAD B;  2F6J A;  5FB0 A;  3NG2 A;  4QF3 A;  5TDR A;  1MM3 A;  1WEW A;  1WEU A;  2LGG A;  5TRB A;  2HYE D;  4LLB A;  2CSY A;  2JMJ A;  2M1R A;  3ZNI A;  2H0D A;  3PUQ A;  3KNV A;  3N9N A;  2QIZ A;  3KQI A;  3O37 A;  3GV4 A;  2NAA A;  2LXP C;  4W4U A;  2JMI A;  4WZ2 A;  4L58 A;  2BAY A;  2AN6 A;  3M99 A;  3V43 A;  5TDW A;  1ZBD B;  1Z2Q A;  4R8P K;  2KE1 A;  4LK9 A;  1K2F A;  2YSM A;  3ZPV 1;  2LGK A;  2L80 A;  3O36 A;  4PPE A;  3PUR A;  1VFY A;  1LDJ B;  3VK6 A;  3SOU A;  4A4B A;  2ECW A;  2L43 A;  2MT5 A;  3DPL R;  2HDP A;  3ZYQ A;  4C9Z A;  5C13 A;  4UP0 A;  3N9Q A;  1JOC A;  5LKZ A;  3LQJ A;  3U5M A;  4F52 B;  2K16 A;  3T6R A;  4O64 A;  1HYJ A;  2YYR A;  2XB1 A;  3ZVZ B;  5DIN A;  1E4U A;  4A4C A;  2FUI A;  2ECJ A;  2MA6 A;  3N9O A;  2D8S A;  2FUU A;  3DQV R;  3C5K A;  1T1H A;  2YW8 A;  3MHS A;  4GNG A;  5B75 A;  4V3L C;  2K1J A;  2E6S A;  4I7B A;  1X4J A;  5D1K B; 
#chains in the Genus database with same CATH topology
 5H1U A;  3FL2 A;  5KH9 A;  2YUR A;  4OGC A;  4MVT A;  2KFT A;  5D1M B;  1IYM A;  1WIM A;  5LKU A;  5B79 A;  2RI7 A;  2VJF A;  3O47 A;  4PTB A;  2K17 A;  4I7C A;  2VNF A;  2KWK A;  4QQ4 A;  4TKP B;  3IHP A;  2MUM A;  2C2V S;  1XWH A;  3O70 A;  2FSA A;  5K3Q A;  2YUC A;  2KGG A;  2XOC A;  2LQ6 A;  4UI9 B;  4WA6 A;  2L5U A;  1WEV A;  2LXH C;  3MHH A;  3L1Z B;  4AYC B;  1WEN A;  4GNF A;  4B86 C;  5D1L B;  3PLW A;  2EGM A;  3LQH A;  3SOW A;  2KRE A;  1WFK A;  2ECG A;  2XP0 A;  1BOR A;  1Z6U A;  2IDA A;  2C2L A;  3N9M A;  3LDY A;  2JUN A;  2KKX A;  1WE9 A;  1V87 A;  2M85 A;  2VPG A;  4P5O B;  4OGE A;  2L0B A;  4S3O B;  3M63 A;  5B77 A;  4O62 A;  2M6M A;  2L7P A;  4GB0 A;  2KKY A;  2VJE A;  5G05 B;  2H0D B;  3LJU X;  5JG6 A;  1U6G B;  2MKE A;  3HCS A;  1WEP A;  2EXU A;  5B8D A;  3LVQ E;  4YBS A;  4YBM A;  2KWO A;  2RSD A;  2KWJ A;  3M7K A;  3EB5 A;  3O33 A;  1MM2 A;  2YRE A;  2VPB A;  3SUB A;  2IQJ A;  1VD4 A;  4YAD A;  2YU4 A;  3L1X A;  3T7L A;  2CSZ A;  3FAN A;  4AUQ B;  1WIL A;  2CKL B;  5H1V A;  2VPE A;  2E6R A;  4NN2 A;  4AP4 A;  3FAO A;  2YHO A;  4BBQ A;  1F62 A;  3EB6 A;  2KR4 A;  5EYA F;  4Q6F A;  2Y1N A;  2MNZ A;  5FER A;  1JM7 A;  2YSJ A;  4IC3 A;  4ZQL A;  3SHB A;  3DDT A;  3LVR E;  1CHC A;  3HCU A;  2FD4 A;  4R2Y A;  5TAB A;  3ZPV E;  2KIZ A;  4X3G A;  3KDE C;  3E2D A;  4YAT A;  2MIQ A;  3KV6 A;  2KYU A;  5I3L A;  5AIU A;  2L75 A;  5G0F A;  4GND A;  5B76 A;  4WZ0 A;  1Z60 A;  2CKL A;  3RPG B;  4Z0O A;  2VP7 A;  2LDR A;  3LQI A;  5AIT A;  3FJU B;  2G45 A;  4N4F A;  2P57 A;  2E61 A;  2UZG A;  2DJA A;  4Z0R A;  3I2D A;  2F6N A;  4L7X A;  4MSX A;  4ZUX U;  2ECV A;  2ZET C;  2ECI A;  2CT2 A;  1WEQ A;  4N3W A;  5C11 A;  4V3K C;  4FO9 A;  4CA1 A;  2F42 A;  3LRQ A;  2FFW A;  4FJC A;  1WEO A;  2OXQ C;  2Y43 A;  4B7Y C;  2KU3 A;  2RR4 A;  2PNX A;  3SOX A;  3C6W A;  5J3X A;  3DWD A;  4XI1 A;  2CON A;  3O7A A;  3O34 A;  2KWN A;  2QIC A;  2VJF B;  2QJ0 A;  3ZTG A;  5LKX A;  4YC9 A;  2YQM A;  2KGI A;  2I50 A;  5FB1 A;  5LCW B;  2DX8 A;  2MD8 C;  4R7E A;  1LDK C;  4AYC A;  5B78 A;  3T9K A;  3ASL A;  2LV9 A;  2CRW A;  2EOD A;  1DVP A;  4H9D A;  5TBN A;  4CCG X;  2YQL A;  4YAB A;  3HTK C;  5KH3 A;  4LJN A;  5H9M A;  3GL6 A;  5SVY A;  2G43 A;  4UP5 A;  3N9L A;  5FEY A;  2EA6 A;  5SVI B;  5H1T A;  2MA5 A;  2JRJ A;  4I7D A;  4YAX A;  3RPG C;  1RMD A;  2YT5 A;  4LKA A;  1WEE A;  1WGM A;  3U5O A;  2YHN A;  1VYX A;  5KH7 A;  2VJE B;  5G04 B;  3MDB C;  2XEU A;  2MD7 B;  4ZDT A;  4WZ3 B;  3RTR B;  2LRI C;  1HYI A;  3N9P A;  2ECT A;  4BHW A;  2CSV A;  2JMD A;  2XOY A;  3QZV A;  1X4I A;  2MNY A;  4IC2 A;  3M62 A;  1N87 A;  1FP0 A;  3U5P A;  2LGV A;  2M13 A;  2B0O E;  2ECN A;  1WES A;  2G6Q A;  2K4D A;  3FM8 C;  3HCT A;  1X4U A;  3L11 A;  3O35 A;  2Y1M A;  3KV5 A;  3ZVY A;  4AVX A;  3H7H A;  3PHD A;  4FIP A;  2EGP A;  4GNE A;  4QF2 A;  1FBV A;  5DKA A;  2VPD A;  2LN0 A;  3U5N A;  1JM7 B;  4S3O C;  1G25 A;  5LKT A;  4A49 A;  4A0C D;  2PUY A;  2M3H A;  4YBT A;  2JM3 A;  1WEM A;  2LGL A;  4LAD B;  4FK5 A;  2F6J A;  5FB0 A;  2OWA A;  3NG2 A;  4QF3 A;  5TDR A;  3Q1D A;  1MM3 A;  1WEW A;  1WEU A;  5SVX A;  2LGG A;  5TRB A;  2HYE D;  4LLB A;  2CSY A;  2JMJ A;  2M1R A;  3ZNI A;  2H0D A;  3PUQ A;  3KNV A;  3N9N A;  2QIZ A;  3KQI A;  2DSM A;  2D8U A;  3GV4 A;  3O37 A;  2NAA A;  3FEH A;  1DCQ A;  2YVR A;  2LXP C;  4W4U A;  2JMI A;  4WZ2 A;  4L58 A;  2BAY A;  2AN6 A;  3M99 A;  4F1P A;  3V43 A;  5TDW A;  1ZBD B;  1Z2Q A;  4R8P K;  2KE1 A;  4LK9 A;  2XOZ A;  1K2F A;  2YSM A;  3ZPV 1;  2LGK A;  2L80 A;  3O36 A;  4PPE A;  3PUR A;  1VFY A;  1LDJ B;  3VK6 A;  1MBM A;  3SOU A;  4A4B A;  2ECW A;  2L43 A;  2MT5 A;  3DPL R;  2HDP A;  3ZYQ A;  4C9Z A;  5C13 A;  4UP0 A;  3N9Q A;  1JOC A;  5LKZ A;  3LQJ A;  3U5M A;  4F52 B;  2K16 A;  3T6R A;  4O64 A;  1HYJ A;  2YYR A;  2XB1 A;  2CRR A;  3ZVZ B;  5DIN A;  1E4U A;  4A4C A;  2FUI A;  2ECJ A;  2MA6 A;  3N9O A;  2D8S A;  2FUU A;  3DQV R;  2LAU A;  3C5K A;  1T1H A;  5SVI A;  2YW8 A;  3MHS A;  4GNG A;  5B75 A;  4V3L C;  3JUE A;  2K1J A;  2E6S A;  4I7B A;  1X4J A;  5D1K B; 
#chains in the Genus database with same CATH homology
 5H1U A;  3FL2 A;  5KH9 A;  2YUR A;  4MVT A;  2KFT A;  5D1M B;  1IYM A;  1WIM A;  5LKU A;  5B79 A;  2RI7 A;  2VJF A;  4PTB A;  2K17 A;  4I7C A;  2VNF A;  2KWK A;  4TKP B;  3IHP A;  2MUM A;  2C2V S;  1XWH A;  3O70 A;  2FSA A;  2YUC A;  2KGG A;  2LQ6 A;  4UI9 B;  4WA6 A;  2L5U A;  1WEV A;  2LXH C;  3MHH A;  3L1Z B;  4AYC B;  1WEN A;  4GNF A;  4B86 C;  5D1L B;  3LQH A;  3SOW A;  2KRE A;  1WFK A;  2ECG A;  1BOR A;  1Z6U A;  2IDA A;  2C2L A;  3N9M A;  1WE9 A;  1V87 A;  2M85 A;  2VPG A;  4P5O B;  2L0B A;  4S3O B;  3M63 A;  5B77 A;  2M6M A;  4GB0 A;  2VJE A;  5G05 B;  2H0D B;  5JG6 A;  1U6G B;  3HCS A;  1WEP A;  5B8D A;  4YBS A;  4YBM A;  2KWO A;  2RSD A;  2KWJ A;  3EB5 A;  3O33 A;  1MM2 A;  2YRE A;  2VPB A;  1VD4 A;  4YAD A;  2YU4 A;  3L1X A;  3T7L A;  2CSZ A;  4AUQ B;  1WIL A;  2CKL B;  5H1V A;  2VPE A;  2E6R A;  4NN2 A;  4AP4 A;  2YHO A;  4BBQ A;  1F62 A;  3EB6 A;  2KR4 A;  5EYA F;  4Q6F A;  2Y1N A;  2MNZ A;  5FER A;  1JM7 A;  2YSJ A;  4IC3 A;  4ZQL A;  3SHB A;  1CHC A;  3HCU A;  4R2Y A;  5TAB A;  3ZPV E;  2KIZ A;  4X3G A;  4YAT A;  2MIQ A;  3KV6 A;  2KYU A;  5I3L A;  5AIU A;  2L75 A;  5G0F A;  4GND A;  5B76 A;  4WZ0 A;  1Z60 A;  2CKL A;  3RPG B;  2VP7 A;  2LDR A;  3LQI A;  5AIT A;  2G45 A;  4N4F A;  2UZG A;  3I2D A;  2F6N A;  4L7X A;  4MSX A;  4ZUX U;  2ECV A;  2ZET C;  2ECI A;  2CT2 A;  1WEQ A;  4N3W A;  5C11 A;  4V3K C;  4FO9 A;  4CA1 A;  2F42 A;  3LRQ A;  4FJC A;  1WEO A;  2OXQ C;  2Y43 A;  4B7Y C;  2KU3 A;  2PNX A;  3SOX A;  3C6W A;  5J3X A;  4XI1 A;  3O7A A;  3O34 A;  2KWN A;  2QIC A;  2VJF B;  2QJ0 A;  3ZTG A;  5LKX A;  4YC9 A;  2YQM A;  2KGI A;  2I50 A;  5FB1 A;  5LCW B;  2DX8 A;  2MD8 C;  4R7E A;  1LDK C;  4AYC A;  5B78 A;  3ASL A;  2LV9 A;  2EOD A;  1DVP A;  5TBN A;  4CCG X;  2YQL A;  4YAB A;  3HTK C;  5KH3 A;  4LJN A;  5H9M A;  3GL6 A;  2G43 A;  4UP5 A;  3N9L A;  5FEY A;  2EA6 A;  5H1T A;  2MA5 A;  2JRJ A;  4I7D A;  4YAX A;  3RPG C;  1RMD A;  2YT5 A;  4LKA A;  1WEE A;  1WGM A;  3U5O A;  2YHN A;  1VYX A;  5KH7 A;  2VJE B;  5G04 B;  2XEU A;  2MD7 B;  4ZDT A;  4WZ3 B;  3RTR B;  2LRI C;  1HYI A;  3N9P A;  2ECT A;  4BHW A;  2JMD A;  3QZV A;  1X4I A;  2MNY A;  4IC2 A;  3M62 A;  1N87 A;  1FP0 A;  3U5P A;  2LGV A;  2ECN A;  1WES A;  2G6Q A;  2K4D A;  3HCT A;  1X4U A;  3L11 A;  3O35 A;  2Y1M A;  3ZVY A;  3KV5 A;  4AVX A;  3PHD A;  4FIP A;  2EGP A;  4GNE A;  4QF2 A;  1FBV A;  5DKA A;  2VPD A;  2LN0 A;  3U5N A;  1JM7 B;  4S3O C;  1G25 A;  5LKT A;  4A49 A;  4A0C D;  2PUY A;  2M3H A;  4YBT A;  1WEM A;  2LGL A;  4FK5 A;  4LAD B;  2F6J A;  5FB0 A;  3NG2 A;  4QF3 A;  5TDR A;  1MM3 A;  1WEW A;  1WEU A;  2LGG A;  5TRB A;  2HYE D;  4LLB A;  2CSY A;  2JMJ A;  2M1R A;  3ZNI A;  2H0D A;  3PUQ A;  3KNV A;  3N9N A;  2QIZ A;  3KQI A;  3O37 A;  3GV4 A;  2NAA A;  2LXP C;  4W4U A;  2JMI A;  4WZ2 A;  4L58 A;  2BAY A;  2AN6 A;  3M99 A;  3V43 A;  5TDW A;  1ZBD B;  1Z2Q A;  4R8P K;  2KE1 A;  4LK9 A;  1K2F A;  2YSM A;  3ZPV 1;  2LGK A;  2L80 A;  3O36 A;  4PPE A;  3PUR A;  1VFY A;  1LDJ B;  3VK6 A;  3SOU A;  4A4B A;  2ECW A;  2L43 A;  2MT5 A;  3DPL R;  2HDP A;  3ZYQ A;  4C9Z A;  5C13 A;  4UP0 A;  3N9Q A;  1JOC A;  5LKZ A;  3LQJ A;  3U5M A;  4F52 B;  2K16 A;  3T6R A;  4O64 A;  1HYJ A;  2YYR A;  2XB1 A;  3ZVZ B;  5DIN A;  1E4U A;  4A4C A;  2FUI A;  2ECJ A;  2MA6 A;  3N9O A;  2D8S A;  2FUU A;  3DQV R;  3C5K A;  1T1H A;  2YW8 A;  3MHS A;  4GNG A;  5B75 A;  4V3L C;  2K1J A;  2E6S A;  4I7B A;  1X4J A;  5D1K B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...