1V87A

Solution structure of the ring-h2 finger domain of mouse deltex protein 2
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
114
structure length
114
Chain Sequence
b'GSSGSSGEPEQVIRKYTEELKVAPEEDCIICMEKLAVASGYSDMTDSKALGPMVVGRLTKCSHAFHLLCLLAMYCNGNKDGSLQCPSCKTIYGEKTGTQPWGKMEVFRSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Deltex protein 2
publication title Solution Structure of the Ring-H2 Finger Domain of Mouse Deltex Protein 2
rcsb
source organism Mus musculus
molecule tags Metal binding protein
total genus 14
structure length 114
sequence length 114
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2003-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1v87A01
3O34A 2MD7B 3KV6A 1WEMA 3DQVR 2VPBA 2MUMA 2KWNA 5B78A 4LJNA 5B76A 2K1JA 2LXPC 4B7YC 2K4DA 2G6QA 1MM2A 2OXQC 5C13A 2G45A 4AYCA 5B77A 4A4CA 2YREA 2YSJA 3SOUA 2CSYA 3QZVA 2C2VS 4LKAA 4ZQLA 3ZVZB 3N9LA 5C11A 3N9PA 3U5OA 5LKUA 1MM3A 5LKXA 2XEUA 5B75A 3GL6A 2YHNA 3O36A 5KH9A 4FK5A 1Z60A 4B86C 2M85A 2YUCA 1WEEA 3MHHA 2Y1NA 5D1LB 2HDPA 4GNFA 1X4UA 5G0FA 2L0BA 3ZPV1 3C6WA 3PUQA 2MNZA 4BHWA 3O70A 2Y1MA 3IHPA 3M99A 2KYUA 3RPGC 5EYAF 3LQJA 4PPEA 4YBTA 2CKLA 5FB1A 2FSAA 2QJ0A 3V43A 2M6MA 2ECTA 4ZUXU 3I2DA 4YADA 2VJFA 4FJCA 3T7LA 1LDKC 1V87A 3RPGB 2QIZA 2MIQA 1WILA 2K17A 1HYIA 3NG2A 2ECGA 1WEPA 5G04B 4WZ0A 4AYCB 2UZGA 4WZ3B 2FUIA 1N87A 2VP7A 1ZBDB 3L1ZB 4TKPB 2KGIA 5KH3A 2K16A 2RI7A 4WZ2A 2M1RA 4A49A 5DKAA 3HCTA 3U5PA 2PUYA 4O64A 2Y43A 4I7BA 4CCGX 4UP5A 4LADB 3VK6A 2JMIA 2F6NA 2C2LA 3L11A 3ZNIA 3C5KA 4L7XA 1BORA 4F52B 3LRQA 2F42A 5B8DA 3O37A 2PNXA 4YATA 5H1VA 2FUUA 2CKLB 1WFKA 3KV5A 4AUQB 3ZTGA 3PHDA 4NN2A 2JRJA 5TDWA 3U5NA 2MA5A 2VJFB 5LKTA 2EA6A 5FB0A 3SOXA 4AP4A 5H1TA 4LK9A 3GV4A 4CA1A 3SHBA 2ECVA 2EGPA 2I50A 2LGVA 1F62A 2ECNA 4YC9A 2MA6A 2CT2A 3HCSA 1G25A 2ECJA 1E4UA 2KE1A 5FERA 4R8PK 2VJEA 1RMDA 2MT5A 3ZVYA 4YABA 5H1UA 2ZETC 5TDRA 4A4BA 3N9MA 2E6RA 4I7DA 5D1MB 2YSMA 4AVXA 1WIMA 5JG6A 4R7EA 3RTRB 2ECIA 2YW8A 2L5UA 4ZDTA 5B79A 1VYXA 2AN6A 1VD4A 1WEWA 1IYMA 3O33A 4LLBA 5KH7A 1HYJA 5LKZA 3L1XA 2F6JA 5G05B 2VPEA 2LDRA 4BBQA 1JM7A 2KWOA 2KREA 2G43A 4FIPA 3LQHA 5J3XA 4PTBA 3M63A 4P5OB 2YQLA 1T1HA 5TRBA 2YURA 4QF3A 2LGKA 1WEVA 2DX8A 1CHCA 2YT5A 4GNGA 4QF2A 4R2YA 4IC3A 3PURA 3M62A 4YBMA 2YYRA 2H0DA 2ECWA 2LN0A 2BAYA 2L75A 1VFYA 1U6GB 3LQIA 2LRIC 2EODA 4X3GA 3EB5A 2XB1A 2L80A 3KQIA 3ASLA 1WENA 2JMDA 2QICA 3HCUA 3MHSA 4W4UA 2VJEB 5DINA 2LGLA 4GNEA 4YAXA 4I7CA 1DVPA 4S3OC 2M3HA 2VPGA 1X4IA 2MD8C 3N9NA 3KNVA 5TBNA 1X4JA 1FBVA 4C9ZA 1WGMA 4L58A 1JM7B 4UP0A 4S3OB 2LGGA 1XWHA 2L43A 5TABA 5FEYA 3ZPVE 3HTKC 3O35A 5LCWB 1WESA 4A0CD 2JMJA 4GNDA 3DPLR 4MVTA 1Z2QA 2RSDA 2LQ6A 3ZYQA 2YHOA 2KR4A 3EB6A 4V3LC 5AIUA 2CSZA 2NAAA 3N9QA 2H0DB 4FO9A 4YBSA 4MSXA 2E6SA 2VNFA 2KWJA 1WEUA 4Q6FA 3T6RA 4XI1A 1FP0A 5I3LA 2HYED 1WEOA 3SOWA 1LDJB 2YQMA 3O7AA 2KGGA 4UI9B 2LXHC 4N3WA 1K2FA 2KIZA 4WA6A 1WE9A 2D8SA 5D1KB 4GB0A 3U5MA 1WEQA 5AITA 4IC2A 2MNYA 5H9MA 2LV9A 2VPDA 1JOCA 2YU4A 2IDAA 2KU3A 2KFTA 4N4FA 2KWKA 3FL2A 1Z6UA 3N9OA 4V3KC
chains in the Genus database with same CATH superfamily
3O34A 2MD7B 3KV6A 1WEMA 3DQVR 5SVIB 2VPBA 2MUMA 2KWNA 5SVYA 2XOYA 5B78A 4LJNA 5B76A 3H7HA 2K1JA 2LXPC 5K3QA 4B7YC 2K4DA 2G6QA 1MM2A 2OXQC 5C13A 2G45A 2CONA 4AYCA 5B77A 4A4CA 2YREA 2YSJA 3SOUA 2CSYA 3QZVA 2C2VS 4LKAA 4ZQLA 3ZVZB 3N9LA 5C11A 3N9PA 3U5OA 5LKUA 1MM3A 2LAUA 5LKXA 2XEUA 5B75A 3GL6A 5SVIA 2YHNA 3O36A 5KH9A 4FK5A 1Z60A 4B86C 2M85A 2YUCA 1WEEA 3MHHA 2Y1NA 5D1LB 2HDPA 4GNFA 1X4UA 5G0FA 2L0BA 3ZPV1 3C6WA 3PUQA 2MNZA 4BHWA 3O70A 2Y1MA 3IHPA 2JUNA 3M99A 2KYUA 3RPGC 5EYAF 3PLWA 3LQJA 4PPEA 4YBTA 2CKLA 5FB1A 2FSAA 2QJ0A 3V43A 2M6MA 2ECTA 4ZUXU 3I2DA 4YADA 1DCQA 3FEHA 2VJFA 4FJCA 3FAOA 3T7LA 1LDKC 1V87A 3RPGB 3O47A 2QIZA 2MIQA 1WILA 2K17A 1HYIA 3NG2A 2ECGA 1WEPA 5G04B 4WZ0A 4AYCB 2XOZA 2UZGA 4WZ3B 2FUIA 1N87A 2VP7A 1ZBDB 3L1ZB 4TKPB 2KGIA 5KH3A 2K16A 2RI7A 4WZ2A 2M1RA 4A49A 5DKAA 3HCTA 3U5PA 2PUYA 2DJAA 4O64A 2B0OE 2Y43A 4I7BA 4CCGX 4UP5A 4LADB 3VK6A 3LDYA 2CRWA 2JMIA 2F6NA 3FANA 2C2LA 2RR4A 3L11A 3ZNIA 2M13A 3C5KA 4L7XA 1BORA 4F52B 3LRQA 2L7PA 2F42A 5B8DA 3LVRE 3O37A 2PNXA 4YATA 5H1VA 2FUUA 1MBMA 2CKLB 1WFKA 3KV5A 4AUQB 3ZTGA 3PHDA 4NN2A 2JRJA 2XP0A 5TDWA 3U5NA 2MA5A 2VJFB 5LKTA 2EA6A 2CRRA 5FB0A 3SOXA 4AP4A 5H1TA 3LVQE 4LK9A 3GV4A 4CA1A 3SHBA 2ECVA 2EGPA 2I50A 2E61A 3MDBC 2LGVA 1F62A 2ECNA 4YC9A 2MA6A 3Q1DA 2CT2A 3HCSA 1G25A 2ECJA 2EGMA 1E4UA 2KE1A 5FERA 4R8PK 2VJEA 1RMDA 2MT5A 3ZVYA 4YABA 5H1UA 2ZETC 5TDRA 4A4BA 3N9MA 2IQJA 3E2DA 2E6RA 4I7DA 2FD4A 5D1MB 3SUBA 2YSMA 3T9KA 4AVXA 1WIMA 5SVXA 5JG6A 4R7EA 3RTRB 2ECIA 2YW8A 2L5UA 4ZDTA 5B79A 4Z0RA 1VYXA 2AN6A 1VD4A 1WEWA 1IYMA 3O33A 4LLBA 5KH7A 1HYJA 5LKZA 3L1XA 2F6JA 5G05B 2VPEA 2LDRA 4BBQA 1JM7A 2KWOA 2KREA 2G43A 4FIPA 2KKYA 3LQHA 5J3XA 4PTBA 3M63A 4P5OB 2YQLA 1T1HA 5TRBA 2OWAA 2YURA 2KKXA 4QF3A 2LGKA 1WEVA 2DX8A 1CHCA 3DWDA 2YT5A 2XOCA 4GNGA 4QF2A 4R2YA 4IC3A 3PURA 3M62A 2CSVA 4YBMA 2YVRA 2YYRA 2H0DA 2ECWA 2LN0A 2BAYA 2L75A 1VFYA 1U6GB 3LQIA 2LRIC 2EODA 4X3GA 3EB5A 2XB1A 2L80A 3KQIA 2D8UA 3FM8C 3ASLA 1WENA 2JMDA 3KDEC 2DSMA 2QICA 3HCUA 3MHSA 4W4UA 2MKEA 2VJEB 5DINA 2LGLA 4GNEA 4YAXA 4I7CA 1DVPA 2EXUA 2P57A 4S3OC 2M3HA 2VPGA 4QQ4A 1X4IA 4OGEA 2MD8C 3FJUB 3N9NA 3KNVA 5TBNA 1X4JA 1FBVA 4C9ZA 1WGMA 4L58A 1JM7B 4Z0OA 3DDTA 4UP0A 4S3OB 2LGGA 1XWHA 2L43A 5TABA 5FEYA 3ZPVE 2JM3A 3HTKC 3O35A 5LCWB 1WESA 4H9DA 4A0CD 2JMJA 4GNDA 3DPLR 4MVTA 1Z2QA 2RSDA 2LQ6A 3ZYQA 2YHOA 2KR4A 3EB6A 4V3LC 5AIUA 2CSZA 2NAAA 3JUEA 4O62A 4F1PA 3N9QA 2H0DB 4FO9A 4YBSA 4MSXA 2E6SA 2VNFA 2KWJA 1WEUA 4Q6FA 3T6RA 4XI1A 1FP0A 5I3LA 2HYED 1WEOA 3SOWA 1LDJB 2YQMA 3O7AA 2KGGA 4UI9B 2LXHC 4N3WA 1K2FA 2KIZA 4WA6A 1WE9A 2FFWA 2D8SA 5D1KB 4GB0A 3U5MA 1WEQA 5AITA 4IC2A 2MNYA 5H9MA 2LV9A 2VPDA 1JOCA 2YU4A 4OGCA 3LJUX 2IDAA 3M7KA 2KU3A 2KFTA 4N4FA 2KWKA 3FL2A 1Z6UA 3N9OA 4V3KC
chains in the Genus database with same CATH topology
3O34A 2MD7B 3KV6A 1WEMA 3DQVR 2VPBA 2MUMA 2KWNA 5B78A 4LJNA 5B76A 2K1JA 2LXPC 4B7YC 2K4DA 2G6QA 1MM2A 2OXQC 5C13A 2G45A 4AYCA 5B77A 4A4CA 2YREA 2YSJA 3SOUA 2CSYA 3QZVA 2C2VS 4LKAA 4ZQLA 3ZVZB 3N9LA 5C11A 3N9PA 3U5OA 5LKUA 1MM3A 5LKXA 2XEUA 5B75A 3GL6A 2YHNA 3O36A 5KH9A 4FK5A 1Z60A 4B86C 2M85A 2YUCA 1WEEA 3MHHA 2Y1NA 5D1LB 2HDPA 4GNFA 1X4UA 5G0FA 2L0BA 3ZPV1 3C6WA 3PUQA 2MNZA 4BHWA 3O70A 2Y1MA 3IHPA 3M99A 2KYUA 3RPGC 5EYAF 3LQJA 4PPEA 4YBTA 2CKLA 5FB1A 2FSAA 2QJ0A 3V43A 2M6MA 2ECTA 4ZUXU 3I2DA 4YADA 2VJFA 4FJCA 3T7LA 1LDKC 1V87A 3RPGB 2QIZA 2MIQA 1WILA 2K17A 1HYIA 3NG2A 2ECGA 1WEPA 5G04B 4WZ0A 4AYCB 2UZGA 4WZ3B 2FUIA 1N87A 2VP7A 1ZBDB 3L1ZB 4TKPB 2KGIA 5KH3A 2K16A 2RI7A 4WZ2A 2M1RA 4A49A 5DKAA 3HCTA 3U5PA 2PUYA 4O64A 2Y43A 4I7BA 4CCGX 4UP5A 4LADB 3VK6A 2JMIA 2F6NA 2C2LA 3L11A 3ZNIA 3C5KA 4L7XA 1BORA 4F52B 3LRQA 2F42A 5B8DA 3O37A 2PNXA 4YATA 5H1VA 2FUUA 2CKLB 1WFKA 3KV5A 4AUQB 3ZTGA 3PHDA 4NN2A 2JRJA 5TDWA 3U5NA 2MA5A 2VJFB 5LKTA 2EA6A 5FB0A 3SOXA 4AP4A 5H1TA 4LK9A 3GV4A 4CA1A 3SHBA 2ECVA 2EGPA 2I50A 2LGVA 1F62A 2ECNA 4YC9A 2MA6A 2CT2A 3HCSA 1G25A 2ECJA 1E4UA 2KE1A 5FERA 4R8PK 2VJEA 1RMDA 2MT5A 3ZVYA 4YABA 5H1UA 2ZETC 5TDRA 4A4BA 3N9MA 2E6RA 4I7DA 5D1MB 2YSMA 4AVXA 1WIMA 5JG6A 4R7EA 3RTRB 2ECIA 2YW8A 2L5UA 4ZDTA 5B79A 1VYXA 2AN6A 1VD4A 1WEWA 1IYMA 3O33A 4LLBA 5KH7A 1HYJA 5LKZA 3L1XA 2F6JA 5G05B 2VPEA 2LDRA 4BBQA 1JM7A 2KWOA 2KREA 2G43A 4FIPA 3LQHA 5J3XA 4PTBA 3M63A 4P5OB 2YQLA 1T1HA 5TRBA 2YURA 4QF3A 2LGKA 1WEVA 2DX8A 1CHCA 2YT5A 4GNGA 4QF2A 4R2YA 4IC3A 3PURA 3M62A 4YBMA 2YYRA 2H0DA 2ECWA 2LN0A 2BAYA 2L75A 1VFYA 1U6GB 3LQIA 2LRIC 2EODA 4X3GA 3EB5A 2XB1A 2L80A 3KQIA 3ASLA 1WENA 2JMDA 2QICA 3HCUA 3MHSA 4W4UA 2VJEB 5DINA 2LGLA 4GNEA 4YAXA 4I7CA 1DVPA 4S3OC 2M3HA 2VPGA 1X4IA 2MD8C 3N9NA 3KNVA 5TBNA 1X4JA 1FBVA 4C9ZA 1WGMA 4L58A 1JM7B 4UP0A 4S3OB 2LGGA 1XWHA 2L43A 5TABA 5FEYA 3ZPVE 3HTKC 3O35A 5LCWB 1WESA 4A0CD 2JMJA 4GNDA 3DPLR 4MVTA 1Z2QA 2RSDA 2LQ6A 3ZYQA 2YHOA 2KR4A 3EB6A 4V3LC 5AIUA 2CSZA 2NAAA 3N9QA 2H0DB 4FO9A 4YBSA 4MSXA 2E6SA 2VNFA 2KWJA 1WEUA 4Q6FA 3T6RA 4XI1A 1FP0A 5I3LA 2HYED 1WEOA 3SOWA 1LDJB 2YQMA 3O7AA 2KGGA 4UI9B 2LXHC 4N3WA 1K2FA 2KIZA 4WA6A 1WE9A 2D8SA 5D1KB 4GB0A 3U5MA 1WEQA 5AITA 4IC2A 2MNYA 5H9MA 2LV9A 2VPDA 1JOCA 2YU4A 2IDAA 2KU3A 2KFTA 4N4FA 2KWKA 3FL2A 1Z6UA 3N9OA 4V3KC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O34 A;  2MD7 B;  3KV6 A;  1WEM A;  3DQV R;  2VPB A;  2MUM A;  2KWN A;  5B78 A;  4LJN A;  5B76 A;  2K1J A;  2LXP C;  4B7Y C;  2K4D A;  2G6Q A;  1MM2 A;  2OXQ C;  5C13 A;  2G45 A;  4AYC A;  5B77 A;  4A4C A;  2YRE A;  2YSJ A;  3SOU A;  2CSY A;  3QZV A;  2C2V S;  4LKA A;  4ZQL A;  3ZVZ B;  3N9L A;  5C11 A;  3N9P A;  3U5O A;  5LKU A;  1MM3 A;  5LKX A;  2XEU A;  5B75 A;  3GL6 A;  2YHN A;  3O36 A;  5KH9 A;  4FK5 A;  1Z60 A;  4B86 C;  2M85 A;  2YUC A;  1WEE A;  3MHH A;  2Y1N A;  5D1L B;  2HDP A;  4GNF A;  1X4U A;  5G0F A;  2L0B A;  3ZPV 1;  3C6W A;  3PUQ A;  2MNZ A;  4BHW A;  3O70 A;  2Y1M A;  3IHP A;  3M99 A;  2KYU A;  3RPG C;  5EYA F;  3LQJ A;  4PPE A;  4YBT A;  2CKL A;  5FB1 A;  2FSA A;  2QJ0 A;  3V43 A;  2M6M A;  2ECT A;  4ZUX U;  3I2D A;  4YAD A;  2VJF A;  4FJC A;  3T7L A;  1LDK C;  1V87 A;  3RPG B;  2QIZ A;  2MIQ A;  1WIL A;  2K17 A;  1HYI A;  3NG2 A;  2ECG A;  1WEP A;  5G04 B;  4WZ0 A;  4AYC B;  2UZG A;  4WZ3 B;  2FUI A;  1N87 A;  2VP7 A;  1ZBD B;  3L1Z B;  4TKP B;  2KGI A;  5KH3 A;  2K16 A;  2RI7 A;  4WZ2 A;  2M1R A;  4A49 A;  5DKA A;  3HCT A;  3U5P A;  2PUY A;  4O64 A;  2Y43 A;  4I7B A;  4CCG X;  4UP5 A;  4LAD B;  3VK6 A;  2JMI A;  2F6N A;  2C2L A;  3L11 A;  3ZNI A;  3C5K A;  4L7X A;  1BOR A;  4F52 B;  3LRQ A;  2F42 A;  5B8D A;  3O37 A;  2PNX A;  4YAT A;  5H1V A;  2FUU A;  2CKL B;  1WFK A;  3KV5 A;  4AUQ B;  3ZTG A;  3PHD A;  4NN2 A;  2JRJ A;  5TDW A;  3U5N A;  2MA5 A;  2VJF B;  5LKT A;  2EA6 A;  5FB0 A;  3SOX A;  4AP4 A;  5H1T A;  4LK9 A;  3GV4 A;  4CA1 A;  3SHB A;  2ECV A;  2EGP A;  2I50 A;  2LGV A;  1F62 A;  2ECN A;  4YC9 A;  2MA6 A;  2CT2 A;  3HCS A;  1G25 A;  2ECJ A;  1E4U A;  2KE1 A;  5FER A;  4R8P K;  2VJE A;  1RMD A;  2MT5 A;  3ZVY A;  4YAB A;  5H1U A;  2ZET C;  5TDR A;  4A4B A;  3N9M A;  2E6R A;  4I7D A;  5D1M B;  2YSM A;  4AVX A;  1WIM A;  5JG6 A;  4R7E A;  3RTR B;  2ECI A;  2YW8 A;  2L5U A;  4ZDT A;  5B79 A;  1VYX A;  2AN6 A;  1VD4 A;  1WEW A;  1IYM A;  3O33 A;  4LLB A;  5KH7 A;  1HYJ A;  5LKZ A;  3L1X A;  2F6J A;  5G05 B;  2VPE A;  2LDR A;  4BBQ A;  1JM7 A;  2KWO A;  2KRE A;  2G43 A;  4FIP A;  3LQH A;  5J3X A;  4PTB A;  3M63 A;  4P5O B;  2YQL A;  1T1H A;  5TRB A;  2YUR A;  4QF3 A;  2LGK A;  1WEV A;  2DX8 A;  1CHC A;  2YT5 A;  4GNG A;  4QF2 A;  4R2Y A;  4IC3 A;  3PUR A;  3M62 A;  4YBM A;  2YYR A;  2H0D A;  2ECW A;  2LN0 A;  2BAY A;  2L75 A;  1VFY A;  1U6G B;  3LQI A;  2LRI C;  2EOD A;  4X3G A;  3EB5 A;  2XB1 A;  2L80 A;  3KQI A;  3ASL A;  1WEN A;  2JMD A;  2QIC A;  3HCU A;  3MHS A;  4W4U A;  2VJE B;  5DIN A;  2LGL A;  4GNE A;  4YAX A;  4I7C A;  1DVP A;  4S3O C;  2M3H A;  2VPG A;  1X4I A;  2MD8 C;  3N9N A;  3KNV A;  5TBN A;  1X4J A;  1FBV A;  4C9Z A;  1WGM A;  4L58 A;  1JM7 B;  4UP0 A;  4S3O B;  2LGG A;  1XWH A;  2L43 A;  5TAB A;  5FEY A;  3ZPV E;  3HTK C;  3O35 A;  5LCW B;  1WES A;  4A0C D;  2JMJ A;  4GND A;  3DPL R;  4MVT A;  1Z2Q A;  2RSD A;  2LQ6 A;  3ZYQ A;  2YHO A;  2KR4 A;  3EB6 A;  4V3L C;  5AIU A;  2CSZ A;  2NAA A;  3N9Q A;  2H0D B;  4FO9 A;  4YBS A;  4MSX A;  2E6S A;  2VNF A;  2KWJ A;  1WEU A;  4Q6F A;  3T6R A;  4XI1 A;  1FP0 A;  5I3L A;  2HYE D;  1WEO A;  3SOW A;  1LDJ B;  2YQM A;  3O7A A;  2KGG A;  4UI9 B;  2LXH C;  4N3W A;  1K2F A;  2KIZ A;  4WA6 A;  1WE9 A;  2D8S A;  5D1K B;  4GB0 A;  3U5M A;  1WEQ A;  5AIT A;  4IC2 A;  2MNY A;  5H9M A;  2LV9 A;  2VPD A;  1JOC A;  2YU4 A;  2IDA A;  2KU3 A;  2KFT A;  4N4F A;  2KWK A;  3FL2 A;  1Z6U A;  3N9O A;  4V3K C; 
#chains in the Genus database with same CATH topology
 3O34 A;  2MD7 B;  3KV6 A;  1WEM A;  3DQV R;  5SVI B;  2VPB A;  2MUM A;  2KWN A;  5SVY A;  2XOY A;  5B78 A;  4LJN A;  5B76 A;  3H7H A;  2K1J A;  2LXP C;  5K3Q A;  4B7Y C;  2K4D A;  2G6Q A;  1MM2 A;  2OXQ C;  5C13 A;  2G45 A;  2CON A;  4AYC A;  5B77 A;  4A4C A;  2YRE A;  2YSJ A;  3SOU A;  2CSY A;  3QZV A;  2C2V S;  4LKA A;  4ZQL A;  3ZVZ B;  3N9L A;  5C11 A;  3N9P A;  3U5O A;  5LKU A;  1MM3 A;  2LAU A;  5LKX A;  2XEU A;  5B75 A;  3GL6 A;  5SVI A;  2YHN A;  3O36 A;  5KH9 A;  4FK5 A;  1Z60 A;  4B86 C;  2M85 A;  2YUC A;  1WEE A;  3MHH A;  2Y1N A;  5D1L B;  2HDP A;  4GNF A;  1X4U A;  5G0F A;  2L0B A;  3ZPV 1;  3C6W A;  3PUQ A;  2MNZ A;  4BHW A;  3O70 A;  2Y1M A;  3IHP A;  2JUN A;  3M99 A;  2KYU A;  3RPG C;  5EYA F;  3PLW A;  3LQJ A;  4PPE A;  4YBT A;  2CKL A;  5FB1 A;  2FSA A;  2QJ0 A;  3V43 A;  2M6M A;  2ECT A;  4ZUX U;  3I2D A;  4YAD A;  1DCQ A;  3FEH A;  2VJF A;  4FJC A;  3FAO A;  3T7L A;  1LDK C;  1V87 A;  3RPG B;  3O47 A;  2QIZ A;  2MIQ A;  1WIL A;  2K17 A;  1HYI A;  3NG2 A;  2ECG A;  1WEP A;  5G04 B;  4WZ0 A;  4AYC B;  2XOZ A;  2UZG A;  4WZ3 B;  2FUI A;  1N87 A;  2VP7 A;  1ZBD B;  3L1Z B;  4TKP B;  2KGI A;  5KH3 A;  2K16 A;  2RI7 A;  4WZ2 A;  2M1R A;  4A49 A;  5DKA A;  3HCT A;  3U5P A;  2PUY A;  2DJA A;  4O64 A;  2B0O E;  2Y43 A;  4I7B A;  4CCG X;  4UP5 A;  4LAD B;  3VK6 A;  3LDY A;  2CRW A;  2JMI A;  2F6N A;  3FAN A;  2C2L A;  2RR4 A;  3L11 A;  3ZNI A;  2M13 A;  3C5K A;  4L7X A;  1BOR A;  4F52 B;  3LRQ A;  2L7P A;  2F42 A;  5B8D A;  3LVR E;  3O37 A;  2PNX A;  4YAT A;  5H1V A;  2FUU A;  1MBM A;  2CKL B;  1WFK A;  3KV5 A;  4AUQ B;  3ZTG A;  3PHD A;  4NN2 A;  2JRJ A;  2XP0 A;  5TDW A;  3U5N A;  2MA5 A;  2VJF B;  5LKT A;  2EA6 A;  2CRR A;  5FB0 A;  3SOX A;  4AP4 A;  5H1T A;  3LVQ E;  4LK9 A;  3GV4 A;  4CA1 A;  3SHB A;  2ECV A;  2EGP A;  2I50 A;  2E61 A;  3MDB C;  2LGV A;  1F62 A;  2ECN A;  4YC9 A;  2MA6 A;  3Q1D A;  2CT2 A;  3HCS A;  1G25 A;  2ECJ A;  2EGM A;  1E4U A;  2KE1 A;  5FER A;  4R8P K;  2VJE A;  1RMD A;  2MT5 A;  3ZVY A;  4YAB A;  5H1U A;  2ZET C;  5TDR A;  4A4B A;  3N9M A;  2IQJ A;  3E2D A;  2E6R A;  4I7D A;  2FD4 A;  5D1M B;  3SUB A;  2YSM A;  3T9K A;  4AVX A;  1WIM A;  5SVX A;  5JG6 A;  4R7E A;  3RTR B;  2ECI A;  2YW8 A;  2L5U A;  4ZDT A;  5B79 A;  4Z0R A;  1VYX A;  2AN6 A;  1VD4 A;  1WEW A;  1IYM A;  3O33 A;  4LLB A;  5KH7 A;  1HYJ A;  5LKZ A;  3L1X A;  2F6J A;  5G05 B;  2VPE A;  2LDR A;  4BBQ A;  1JM7 A;  2KWO A;  2KRE A;  2G43 A;  4FIP A;  2KKY A;  3LQH A;  5J3X A;  4PTB A;  3M63 A;  4P5O B;  2YQL A;  1T1H A;  5TRB A;  2OWA A;  2YUR A;  2KKX A;  4QF3 A;  2LGK A;  1WEV A;  2DX8 A;  1CHC A;  3DWD A;  2YT5 A;  2XOC A;  4GNG A;  4QF2 A;  4R2Y A;  4IC3 A;  3PUR A;  3M62 A;  2CSV A;  4YBM A;  2YVR A;  2YYR A;  2H0D A;  2ECW A;  2LN0 A;  2BAY A;  2L75 A;  1VFY A;  1U6G B;  3LQI A;  2LRI C;  2EOD A;  4X3G A;  3EB5 A;  2XB1 A;  2L80 A;  3KQI A;  2D8U A;  3FM8 C;  3ASL A;  1WEN A;  2JMD A;  3KDE C;  2DSM A;  2QIC A;  3HCU A;  3MHS A;  4W4U A;  2MKE A;  2VJE B;  5DIN A;  2LGL A;  4GNE A;  4YAX A;  4I7C A;  1DVP A;  2EXU A;  2P57 A;  4S3O C;  2M3H A;  2VPG A;  4QQ4 A;  1X4I A;  4OGE A;  2MD8 C;  3FJU B;  3N9N A;  3KNV A;  5TBN A;  1X4J A;  1FBV A;  4C9Z A;  1WGM A;  4L58 A;  1JM7 B;  4Z0O A;  3DDT A;  4UP0 A;  4S3O B;  2LGG A;  1XWH A;  2L43 A;  5TAB A;  5FEY A;  3ZPV E;  2JM3 A;  3HTK C;  3O35 A;  5LCW B;  1WES A;  4H9D A;  4A0C D;  2JMJ A;  4GND A;  3DPL R;  4MVT A;  1Z2Q A;  2RSD A;  2LQ6 A;  3ZYQ A;  2YHO A;  2KR4 A;  3EB6 A;  4V3L C;  5AIU A;  2CSZ A;  2NAA A;  3JUE A;  4O62 A;  4F1P A;  3N9Q A;  2H0D B;  4FO9 A;  4YBS A;  4MSX A;  2E6S A;  2VNF A;  2KWJ A;  1WEU A;  4Q6F A;  3T6R A;  4XI1 A;  1FP0 A;  5I3L A;  2HYE D;  1WEO A;  3SOW A;  1LDJ B;  2YQM A;  3O7A A;  2KGG A;  4UI9 B;  2LXH C;  4N3W A;  1K2F A;  2KIZ A;  4WA6 A;  1WE9 A;  2FFW A;  2D8S A;  5D1K B;  4GB0 A;  3U5M A;  1WEQ A;  5AIT A;  4IC2 A;  2MNY A;  5H9M A;  2LV9 A;  2VPD A;  1JOC A;  2YU4 A;  4OGC A;  3LJU X;  2IDA A;  3M7K A;  2KU3 A;  2KFT A;  4N4F A;  2KWK A;  3FL2 A;  1Z6U A;  3N9O A;  4V3K C; 
#chains in the Genus database with same CATH homology
 3O34 A;  2MD7 B;  3KV6 A;  1WEM A;  3DQV R;  2VPB A;  2MUM A;  2KWN A;  5B78 A;  4LJN A;  5B76 A;  2K1J A;  2LXP C;  4B7Y C;  2K4D A;  2G6Q A;  1MM2 A;  2OXQ C;  5C13 A;  2G45 A;  4AYC A;  5B77 A;  4A4C A;  2YRE A;  2YSJ A;  3SOU A;  2CSY A;  3QZV A;  2C2V S;  4LKA A;  4ZQL A;  3ZVZ B;  3N9L A;  5C11 A;  3N9P A;  3U5O A;  5LKU A;  1MM3 A;  5LKX A;  2XEU A;  5B75 A;  3GL6 A;  2YHN A;  3O36 A;  5KH9 A;  4FK5 A;  1Z60 A;  4B86 C;  2M85 A;  2YUC A;  1WEE A;  3MHH A;  2Y1N A;  5D1L B;  2HDP A;  4GNF A;  1X4U A;  5G0F A;  2L0B A;  3ZPV 1;  3C6W A;  3PUQ A;  2MNZ A;  4BHW A;  3O70 A;  2Y1M A;  3IHP A;  3M99 A;  2KYU A;  3RPG C;  5EYA F;  3LQJ A;  4PPE A;  4YBT A;  2CKL A;  5FB1 A;  2FSA A;  2QJ0 A;  3V43 A;  2M6M A;  2ECT A;  4ZUX U;  3I2D A;  4YAD A;  2VJF A;  4FJC A;  3T7L A;  1LDK C;  1V87 A;  3RPG B;  2QIZ A;  2MIQ A;  1WIL A;  2K17 A;  1HYI A;  3NG2 A;  2ECG A;  1WEP A;  5G04 B;  4WZ0 A;  4AYC B;  2UZG A;  4WZ3 B;  2FUI A;  1N87 A;  2VP7 A;  1ZBD B;  3L1Z B;  4TKP B;  2KGI A;  5KH3 A;  2K16 A;  2RI7 A;  4WZ2 A;  2M1R A;  4A49 A;  5DKA A;  3HCT A;  3U5P A;  2PUY A;  4O64 A;  2Y43 A;  4I7B A;  4CCG X;  4UP5 A;  4LAD B;  3VK6 A;  2JMI A;  2F6N A;  2C2L A;  3L11 A;  3ZNI A;  3C5K A;  4L7X A;  1BOR A;  4F52 B;  3LRQ A;  2F42 A;  5B8D A;  3O37 A;  2PNX A;  4YAT A;  5H1V A;  2FUU A;  2CKL B;  1WFK A;  3KV5 A;  4AUQ B;  3ZTG A;  3PHD A;  4NN2 A;  2JRJ A;  5TDW A;  3U5N A;  2MA5 A;  2VJF B;  5LKT A;  2EA6 A;  5FB0 A;  3SOX A;  4AP4 A;  5H1T A;  4LK9 A;  3GV4 A;  4CA1 A;  3SHB A;  2ECV A;  2EGP A;  2I50 A;  2LGV A;  1F62 A;  2ECN A;  4YC9 A;  2MA6 A;  2CT2 A;  3HCS A;  1G25 A;  2ECJ A;  1E4U A;  2KE1 A;  5FER A;  4R8P K;  2VJE A;  1RMD A;  2MT5 A;  3ZVY A;  4YAB A;  5H1U A;  2ZET C;  5TDR A;  4A4B A;  3N9M A;  2E6R A;  4I7D A;  5D1M B;  2YSM A;  4AVX A;  1WIM A;  5JG6 A;  4R7E A;  3RTR B;  2ECI A;  2YW8 A;  2L5U A;  4ZDT A;  5B79 A;  1VYX A;  2AN6 A;  1VD4 A;  1WEW A;  1IYM A;  3O33 A;  4LLB A;  5KH7 A;  1HYJ A;  5LKZ A;  3L1X A;  2F6J A;  5G05 B;  2VPE A;  2LDR A;  4BBQ A;  1JM7 A;  2KWO A;  2KRE A;  2G43 A;  4FIP A;  3LQH A;  5J3X A;  4PTB A;  3M63 A;  4P5O B;  2YQL A;  1T1H A;  5TRB A;  2YUR A;  4QF3 A;  2LGK A;  1WEV A;  2DX8 A;  1CHC A;  2YT5 A;  4GNG A;  4QF2 A;  4R2Y A;  4IC3 A;  3PUR A;  3M62 A;  4YBM A;  2YYR A;  2H0D A;  2ECW A;  2LN0 A;  2BAY A;  2L75 A;  1VFY A;  1U6G B;  3LQI A;  2LRI C;  2EOD A;  4X3G A;  3EB5 A;  2XB1 A;  2L80 A;  3KQI A;  3ASL A;  1WEN A;  2JMD A;  2QIC A;  3HCU A;  3MHS A;  4W4U A;  2VJE B;  5DIN A;  2LGL A;  4GNE A;  4YAX A;  4I7C A;  1DVP A;  4S3O C;  2M3H A;  2VPG A;  1X4I A;  2MD8 C;  3N9N A;  3KNV A;  5TBN A;  1X4J A;  1FBV A;  4C9Z A;  1WGM A;  4L58 A;  1JM7 B;  4UP0 A;  4S3O B;  2LGG A;  1XWH A;  2L43 A;  5TAB A;  5FEY A;  3ZPV E;  3HTK C;  3O35 A;  5LCW B;  1WES A;  4A0C D;  2JMJ A;  4GND A;  3DPL R;  4MVT A;  1Z2Q A;  2RSD A;  2LQ6 A;  3ZYQ A;  2YHO A;  2KR4 A;  3EB6 A;  4V3L C;  5AIU A;  2CSZ A;  2NAA A;  3N9Q A;  2H0D B;  4FO9 A;  4YBS A;  4MSX A;  2E6S A;  2VNF A;  2KWJ A;  1WEU A;  4Q6F A;  3T6R A;  4XI1 A;  1FP0 A;  5I3L A;  2HYE D;  1WEO A;  3SOW A;  1LDJ B;  2YQM A;  3O7A A;  2KGG A;  4UI9 B;  2LXH C;  4N3W A;  1K2F A;  2KIZ A;  4WA6 A;  1WE9 A;  2D8S A;  5D1K B;  4GB0 A;  3U5M A;  1WEQ A;  5AIT A;  4IC2 A;  2MNY A;  5H9M A;  2LV9 A;  2VPD A;  1JOC A;  2YU4 A;  2IDA A;  2KU3 A;  2KFT A;  4N4F A;  2KWK A;  3FL2 A;  1Z6U A;  3N9O A;  4V3K C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...