1V87A

Solution structure of the ring-h2 finger domain of mouse deltex protein 2
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
114
structure length
114
Chain Sequence
GSSGSSGEPEQVIRKYTEELKVAPEEDCIICMEKLAVASGYSDMTDSKALGPMVVGRLTKCSHAFHLLCLLAMYCNGNKDGSLQCPSCKTIYGEKTGTQPWGKMEVFRSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Deltex protein 2
publication title Solution Structure of the Ring-H2 Finger Domain of Mouse Deltex Protein 2
rcsb
source organism Mus musculus
total genus 14
structure length 114
sequence length 114
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2003-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1v87A01
1WFKA 2C2LA 2VPBA 2DX8A 4AYCB 3ZYQA 2KGGA 3KNVA 3ZVYA 2KFTA 4LK9A 2EA6A 3N9NA 2LN0A 2HDPA 5FEYA 3NG2A 2F6JA 3ZNIA 1U6GB 2CSYA 2NAAA 2H0DB 2ECTA 4UP5A 4R8PK 4I7CA 4YC9A 5KH3A 4YATA 2LGLA 3SOWA 4YADA 1WE9A 2L75A 3T6RA 3U5NA 2EODA 1X4JA 1RMDA 1F62A 2LV9A 3ZTGA 2M6MA 3EB6A 3PURA 2M85A 2YU4A 4AVXA 5B77A 1VD4A 3HCUA 1WESA 5LCWB 2VJFB 4IC2A 2CT2A 3O36A 4Q6FA 2YQLA 4FK5A 2QICA 5LKUA 2VPDA 3RTRB 2G43A 2VP7A 3O35A 4YBTA 2KWKA 1CHCA 4A49A 2KYUA 4AUQB 4YBSA 4N3WA 4GNDA 3N9PA 2XB1A 3DPLR 5LKXA 2UZGA 1G25A 4WA6A 4CCGX 5AIUA 2MIQA 3N9MA 5LKTA 2G45A 2YUCA 5TDWA 3M63A 2CSZA 2LXPC 2KWOA 2E6RA 1ZBDB 2EGPA 1JM7B 3KV6A 1V87A 2YSMA 5TRBA 3O37A 4LLBA 2JMDA 1WEUA 1N87A 3ZPV1 2KU3A 5C11A 4L7XA 5LKZA 3MHHA 3MHSA 2VPEA 4A0CD 4I7BA 5H1TA 5TBNA 4B86C 2LQ6A 2KE1A 4CA1A 2YW8A 2YSJA 2D8SA 5H1UA 2L5UA 1WEMA 4GNFA 1K2FA 3LQJA 2KWJA 4FO9A 2AN6A 4R7EA 2E6SA 1LDJB 3O70A 4GNGA 1WEVA 2G6QA 1WGMA 2QJ0A 5B79A 4X3GA 1T1HA 4YABA 5AITA 5DINA 1JOCA 4PTBA 2VJEA 2M1RA 3KQIA 2KWNA 2LRIC 4ZDTA 2XEUA 2MNZA 2JRJA 5D1LB 3HCSA 1WIMA 4F52B 2BAYA 3U5MA 3N9QA 2L0BA 3C5KA 3O33A 2RI7A 1FBVA 2OXQC 2LGKA 2ECNA 2ECJA 4QF3A 5B8DA 5I3LA 3M99A 4UI9B 3KV5A 3RPGB 4IC3A 1MM3A 3M62A 2YT5A 1X4UA 3L11A 1JM7A 4W4UA 2C2VS 1X4IA 3LQIA 2IDAA 2MD7B 2YYRA 4UP0A 4N4FA 2K1JA 3DQVR 4YAXA 1WENA 3O34A 4AYCA 5H9MA 2MT5A 5G05B 2K17A 4V3KC 3T7LA 2LGVA 3EB5A 5TDRA 5FERA 3ASLA 4A4CA 4AP4A 2MD8C 2Y43A 4V3LC 4LJNA 4S3OB 1WEEA 2H0DA 1WEOA 2LGGA 2ECWA 3QZVA 2LXHC 5J3XA 4FJCA 3FL2A 3RPGC 2YHOA 2YURA 4R2YA 2I50A 2KIZA 2MA6A 3LRQA 2CKLB 2L43A 4XI1A 4WZ2A 4O64A 2ECIA 3I2DA 4BBQA 2VPGA 2MNYA 1LDKC 5FB0A 4P5OB 5JG6A 4L58A 4FIPA 5KH7A 3SOXA 1MM2A 3PUQA 3HCTA 4MSXA 2YQMA 2VJFA 3SOUA 4TKPB 3L1ZB 2JMJA 2PUYA 4GB0A 3HTKC 3L1XA 4LADB 2HYED 3VK6A 4S3OC 3ZVZB 3ZPVE 2KREA 3N9LA 3LQHA 2F42A 1Z60A 3O7AA 2JMIA 5G0FA 2YHNA 1HYIA 1VYXA 5D1MB 2ECGA 4I7DA 3C6WA 1WILA 2LDRA 2VJEB 3SHBA 4QF2A 2L80A 2M3HA 1Z6UA 1VFYA 4YBMA 4WZ3B 2FUUA 3GV4A 1WEPA 5G04B 5H1VA 3GL6A 5TABA 2ECVA 5DKAA 4PPEA 4A4BA 1Z2QA 2FUIA 2Y1MA 2FSAA 4GNEA 4LKAA 5D1KB 2K4DA 3U5PA 5FB1A 5B75A 5C13A 4MVTA 2MUMA 4NN2A 1E4UA 3V43A 5EYAF 4BHWA 4ZUXU 4WZ0A 2QIZA 1BORA 2Y1NA 1FP0A 2CKLA 5KH9A 1WEQA 3IHPA 3N9OA 2K16A 5B78A 4ZQLA 1HYJA 3PHDA 2PNXA 2MA5A 2YREA 2ZETC 1WEWA 4B7YC 2VNFA 2RSDA 1IYMA 2F6NA 1XWHA 4C9ZA 5B76A 1DVPA 2KR4A 3U5OA 2KGIA
chains in the Genus database with same CATH superfamily
1WFKA 2C2LA 2VPBA 2FD4A 2DX8A 4AYCB 3ZYQA 2KGGA 3KNVA 3ZVYA 2KFTA 4LK9A 2EA6A 3N9NA 2XOZA 2LN0A 2HDPA 5FEYA 3NG2A 2F6JA 3ZNIA 1U6GB 2CSYA 2NAAA 2H0DB 2ECTA 4UP5A 3FM8C 4R8PK 4I7CA 4YC9A 5KH3A 4YATA 2LGLA 3SOWA 4YADA 1WE9A 2FFWA 2L75A 3T6RA 2JM3A 3U5NA 2EODA 1X4JA 1RMDA 1F62A 2LV9A 3ZTGA 2M6MA 3EB6A 3PURA 2M85A 2YU4A 4AVXA 2DSMA 5B77A 1VD4A 3HCUA 1WESA 5LCWB 2XOYA 2VJFB 4IC2A 2CT2A 3O36A 3H7HA 4Q6FA 2YQLA 3T9KA 4FK5A 2QICA 5LKUA 2VPDA 2OWAA 3RTRB 2G43A 2VP7A 3O35A 4YBTA 2KWKA 1CHCA 4A49A 2KYUA 4AUQB 4YBSA 5SVIA 4N3WA 2YVRA 1DCQA 4GNDA 3N9PA 2XB1A 3DPLR 2XOCA 2UZGA 5LKXA 1G25A 4WA6A 3FAOA 4CCGX 5AIUA 2MIQA 3DDTA 3N9MA 5LKTA 2G45A 2YUCA 5TDWA 3JUEA 3M63A 4F1PA 2CSZA 2LXPC 2KWOA 2E6RA 1ZBDB 2EGPA 1JM7B 3KV6A 1V87A 2YSMA 5TRBA 3O37A 4LLBA 2JMDA 1WEUA 1N87A 3ZPV1 2KU3A 5C11A 4L7XA 5LKZA 3MHHA 3MHSA 2VPEA 4A0CD 4I7BA 5H1TA 5TBNA 4B86C 2LQ6A 2KE1A 4CA1A 2YW8A 3LJUX 2YSJA 2D8SA 5H1UA 2L5UA 1WEMA 4GNFA 1K2FA 3LQJA 3E2DA 2EGMA 2MKEA 2KWJA 3LVRE 4FO9A 3Q1DA 2AN6A 4R7EA 2E6SA 5SVYA 1LDJB 3O70A 4GNGA 1WEVA 2G6QA 1WGMA 2QJ0A 5B79A 4X3GA 1T1HA 2KKXA 3LDYA 4Z0RA 2RR4A 4YABA 5AITA 5DINA 1JOCA 4PTBA 2VJEA 2M1RA 3KQIA 2KWNA 4OGCA 2LRIC 4ZDTA 4H9DA 2XEUA 2MNZA 2JRJA 5D1LB 3HCSA 1WIMA 4F52B 2BAYA 3FANA 5K3QA 3U5MA 3N9QA 2L0BA 3C5KA 3O33A 4Z0OA 2RI7A 1FBVA 2OXQC 2LGKA 2CONA 2M13A 2ECNA 2ECJA 4QF3A 5B8DA 5I3LA 3M99A 4UI9B 3KV5A 3RPGB 4IC3A 5SVXA 1MM3A 2DJAA 3M62A 3SUBA 2YT5A 1X4UA 3L11A 1JM7A 2CRRA 4W4UA 2C2VS 3KDEC 1X4IA 3LQIA 2IDAA 2MD7B 2YYRA 4UP0A 4N4FA 2K1JA 3DQVR 4YAXA 1WENA 3O34A 4AYCA 5H9MA 2MT5A 5G05B 2K17A 4V3KC 3T7LA 2LGVA 3EB5A 5TDRA 5FERA 3ASLA 4A4CA 4AP4A 2MD8C 2B0OE 2Y43A 4V3LC 4LJNA 4S3OB 1WEEA 2H0DA 1WEOA 2LGGA 2ECWA 3QZVA 2P57A 2LXHC 5J3XA 4FJCA 3FL2A 3RPGC 2YHOA 2YURA 4R2YA 2I50A 2KIZA 2MA6A 3FJUB 3LRQA 2CKLB 2L43A 4XI1A 4WZ2A 4O64A 2ECIA 3I2DA 4BBQA 2VPGA 2MNYA 1LDKC 5FB0A 4P5OB 5JG6A 4L58A 4FIPA 5KH7A 3SOXA 2CSVA 1MM2A 3PUQA 3HCTA 4MSXA 2YQMA 2VJFA 2XP0A 3LVQE 2JUNA 2L7PA 3SOUA 4TKPB 3L1ZB 2JMJA 2PUYA 4GB0A 2CRWA 3HTKC 3L1XA 4LADB 2HYED 3DWDA 4S3OC 3VK6A 3ZVZB 3ZPVE 2KREA 3N9LA 4O62A 3LQHA 2F42A 1Z60A 3O7AA 2JMIA 5G0FA 2YHNA 1HYIA 1VYXA 2LAUA 5D1MB 2ECGA 4I7DA 3C6WA 1WILA 2LDRA 2D8UA 2VJEB 3M7KA 3SHBA 4OGEA 4QF2A 2E61A 2L80A 2M3HA 1Z6UA 1VFYA 4YBMA 4WZ3B 2FUUA 3GV4A 1MBMA 1WEPA 5G04B 5H1VA 3GL6A 5TABA 2ECVA 5DKAA 3PLWA 4PPEA 4A4BA 1Z2QA 2FUIA 2Y1MA 2FSAA 4GNEA 4LKAA 5D1KB 2K4DA 3U5PA 5FB1A 5B75A 5C13A 4MVTA 2MUMA 4NN2A 1E4UA 5SVIB 3V43A 5EYAF 4BHWA 2EXUA 4WZ0A 2QIZA 4ZUXU 1BORA 2KKYA 2Y1NA 1FP0A 2CKLA 4QQ4A 5KH9A 1WEQA 3IHPA 3N9OA 2K16A 5B78A 4ZQLA 1HYJA 3PHDA 2IQJA 3MDBC 2PNXA 2MA5A 2YREA 2ZETC 1WEWA 4B7YC 2VNFA 2RSDA 3O47A 1IYMA 3FEHA 2F6NA 1XWHA 4C9ZA 5B76A 1DVPA 2KR4A 3U5OA 2KGIA
chains in the Genus database with same CATH topology
1WFKA 2C2LA 2VPBA 2DX8A 4AYCB 3ZYQA 2KGGA 3KNVA 3ZVYA 2KFTA 4LK9A 2EA6A 3N9NA 2LN0A 2HDPA 5FEYA 3NG2A 2F6JA 3ZNIA 1U6GB 2CSYA 2NAAA 2H0DB 2ECTA 4UP5A 4R8PK 4I7CA 4YC9A 5KH3A 4YATA 2LGLA 3SOWA 4YADA 1WE9A 2L75A 3T6RA 3U5NA 2EODA 1X4JA 1RMDA 1F62A 2LV9A 3ZTGA 2M6MA 3EB6A 3PURA 2M85A 2YU4A 4AVXA 5B77A 1VD4A 3HCUA 1WESA 5LCWB 2VJFB 4IC2A 2CT2A 3O36A 4Q6FA 2YQLA 4FK5A 2QICA 5LKUA 2VPDA 3RTRB 2G43A 2VP7A 3O35A 4YBTA 2KWKA 1CHCA 4A49A 2KYUA 4AUQB 4YBSA 4N3WA 4GNDA 3N9PA 2XB1A 3DPLR 5LKXA 2UZGA 1G25A 4WA6A 4CCGX 5AIUA 2MIQA 3N9MA 5LKTA 2G45A 2YUCA 5TDWA 3M63A 2CSZA 2LXPC 2KWOA 2E6RA 1ZBDB 2EGPA 1JM7B 3KV6A 1V87A 2YSMA 5TRBA 3O37A 4LLBA 2JMDA 1WEUA 1N87A 3ZPV1 2KU3A 5C11A 4L7XA 5LKZA 3MHHA 3MHSA 2VPEA 4A0CD 4I7BA 5H1TA 5TBNA 4B86C 2LQ6A 2KE1A 4CA1A 2YW8A 2YSJA 2D8SA 5H1UA 2L5UA 1WEMA 4GNFA 1K2FA 3LQJA 2KWJA 4FO9A 2AN6A 4R7EA 2E6SA 1LDJB 3O70A 4GNGA 1WEVA 2G6QA 1WGMA 2QJ0A 5B79A 4X3GA 1T1HA 4YABA 5AITA 5DINA 1JOCA 4PTBA 2VJEA 2M1RA 3KQIA 2KWNA 2LRIC 4ZDTA 2XEUA 2MNZA 2JRJA 5D1LB 3HCSA 1WIMA 4F52B 2BAYA 3U5MA 3N9QA 2L0BA 3C5KA 3O33A 2RI7A 1FBVA 2OXQC 2LGKA 2ECNA 2ECJA 4QF3A 5B8DA 5I3LA 3M99A 4UI9B 3KV5A 3RPGB 4IC3A 1MM3A 3M62A 2YT5A 1X4UA 3L11A 1JM7A 4W4UA 2C2VS 1X4IA 3LQIA 2IDAA 2MD7B 2YYRA 4UP0A 4N4FA 2K1JA 3DQVR 4YAXA 1WENA 3O34A 4AYCA 5H9MA 2MT5A 5G05B 2K17A 4V3KC 3T7LA 2LGVA 3EB5A 5TDRA 5FERA 3ASLA 4A4CA 4AP4A 2MD8C 2Y43A 4V3LC 4LJNA 4S3OB 1WEEA 2H0DA 1WEOA 2LGGA 2ECWA 3QZVA 2LXHC 5J3XA 4FJCA 3FL2A 3RPGC 2YHOA 2YURA 4R2YA 2I50A 2KIZA 2MA6A 3LRQA 2CKLB 2L43A 4XI1A 4WZ2A 4O64A 2ECIA 3I2DA 4BBQA 2VPGA 2MNYA 1LDKC 5FB0A 4P5OB 5JG6A 4L58A 4FIPA 5KH7A 3SOXA 1MM2A 3PUQA 3HCTA 4MSXA 2YQMA 2VJFA 3SOUA 4TKPB 3L1ZB 2JMJA 2PUYA 4GB0A 3HTKC 3L1XA 4LADB 2HYED 3VK6A 4S3OC 3ZVZB 3ZPVE 2KREA 3N9LA 3LQHA 2F42A 1Z60A 3O7AA 2JMIA 5G0FA 2YHNA 1HYIA 1VYXA 5D1MB 2ECGA 4I7DA 3C6WA 1WILA 2LDRA 2VJEB 3SHBA 4QF2A 2L80A 2M3HA 1Z6UA 1VFYA 4YBMA 4WZ3B 2FUUA 3GV4A 1WEPA 5G04B 5H1VA 3GL6A 5TABA 2ECVA 5DKAA 4PPEA 4A4BA 1Z2QA 2FUIA 2Y1MA 2FSAA 4GNEA 4LKAA 5D1KB 2K4DA 3U5PA 5FB1A 5B75A 5C13A 4MVTA 2MUMA 4NN2A 1E4UA 3V43A 5EYAF 4BHWA 4ZUXU 4WZ0A 2QIZA 1BORA 2Y1NA 1FP0A 2CKLA 5KH9A 1WEQA 3IHPA 3N9OA 2K16A 5B78A 4ZQLA 1HYJA 3PHDA 2PNXA 2MA5A 2YREA 2ZETC 1WEWA 4B7YC 2VNFA 2RSDA 1IYMA 2F6NA 1XWHA 4C9ZA 5B76A 1DVPA 2KR4A 3U5OA 2KGIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WFK A;  2C2L A;  2VPB A;  2DX8 A;  4AYC B;  3ZYQ A;  2KGG A;  3KNV A;  3ZVY A;  2KFT A;  4LK9 A;  2EA6 A;  3N9N A;  2LN0 A;  2HDP A;  5FEY A;  3NG2 A;  2F6J A;  3ZNI A;  1U6G B;  2CSY A;  2NAA A;  2H0D B;  2ECT A;  4UP5 A;  4R8P K;  4I7C A;  4YC9 A;  5KH3 A;  4YAT A;  2LGL A;  3SOW A;  4YAD A;  1WE9 A;  2L75 A;  3T6R A;  3U5N A;  2EOD A;  1X4J A;  1RMD A;  1F62 A;  2LV9 A;  3ZTG A;  2M6M A;  3EB6 A;  3PUR A;  2M85 A;  2YU4 A;  4AVX A;  5B77 A;  1VD4 A;  3HCU A;  1WES A;  5LCW B;  2VJF B;  4IC2 A;  2CT2 A;  3O36 A;  4Q6F A;  2YQL A;  4FK5 A;  2QIC A;  5LKU A;  2VPD A;  3RTR B;  2G43 A;  2VP7 A;  3O35 A;  4YBT A;  2KWK A;  1CHC A;  4A49 A;  2KYU A;  4AUQ B;  4YBS A;  4N3W A;  4GND A;  3N9P A;  2XB1 A;  3DPL R;  5LKX A;  2UZG A;  1G25 A;  4WA6 A;  4CCG X;  5AIU A;  2MIQ A;  3N9M A;  5LKT A;  2G45 A;  2YUC A;  5TDW A;  3M63 A;  2CSZ A;  2LXP C;  2KWO A;  2E6R A;  1ZBD B;  2EGP A;  1JM7 B;  3KV6 A;  1V87 A;  2YSM A;  5TRB A;  3O37 A;  4LLB A;  2JMD A;  1WEU A;  1N87 A;  3ZPV 1;  2KU3 A;  5C11 A;  4L7X A;  5LKZ A;  3MHH A;  3MHS A;  2VPE A;  4A0C D;  4I7B A;  5H1T A;  5TBN A;  4B86 C;  2LQ6 A;  2KE1 A;  4CA1 A;  2YW8 A;  2YSJ A;  2D8S A;  5H1U A;  2L5U A;  1WEM A;  4GNF A;  1K2F A;  3LQJ A;  2KWJ A;  4FO9 A;  2AN6 A;  4R7E A;  2E6S A;  1LDJ B;  3O70 A;  4GNG A;  1WEV A;  2G6Q A;  1WGM A;  2QJ0 A;  5B79 A;  4X3G A;  1T1H A;  4YAB A;  5AIT A;  5DIN A;  1JOC A;  4PTB A;  2VJE A;  2M1R A;  3KQI A;  2KWN A;  2LRI C;  4ZDT A;  2XEU A;  2MNZ A;  2JRJ A;  5D1L B;  3HCS A;  1WIM A;  4F52 B;  2BAY A;  3U5M A;  3N9Q A;  2L0B A;  3C5K A;  3O33 A;  2RI7 A;  1FBV A;  2OXQ C;  2LGK A;  2ECN A;  2ECJ A;  4QF3 A;  5B8D A;  5I3L A;  3M99 A;  4UI9 B;  3KV5 A;  3RPG B;  4IC3 A;  1MM3 A;  3M62 A;  2YT5 A;  1X4U A;  3L11 A;  1JM7 A;  4W4U A;  2C2V S;  1X4I A;  3LQI A;  2IDA A;  2MD7 B;  2YYR A;  4UP0 A;  4N4F A;  2K1J A;  3DQV R;  4YAX A;  1WEN A;  3O34 A;  4AYC A;  5H9M A;  2MT5 A;  5G05 B;  2K17 A;  4V3K C;  3T7L A;  2LGV A;  3EB5 A;  5TDR A;  5FER A;  3ASL A;  4A4C A;  4AP4 A;  2MD8 C;  2Y43 A;  4V3L C;  4LJN A;  4S3O B;  1WEE A;  2H0D A;  1WEO A;  2LGG A;  2ECW A;  3QZV A;  2LXH C;  5J3X A;  4FJC A;  3FL2 A;  3RPG C;  2YHO A;  2YUR A;  4R2Y A;  2I50 A;  2KIZ A;  2MA6 A;  3LRQ A;  2CKL B;  2L43 A;  4XI1 A;  4WZ2 A;  4O64 A;  2ECI A;  3I2D A;  4BBQ A;  2VPG A;  2MNY A;  1LDK C;  5FB0 A;  4P5O B;  5JG6 A;  4L58 A;  4FIP A;  5KH7 A;  3SOX A;  1MM2 A;  3PUQ A;  3HCT A;  4MSX A;  2YQM A;  2VJF A;  3SOU A;  4TKP B;  3L1Z B;  2JMJ A;  2PUY A;  4GB0 A;  3HTK C;  3L1X A;  4LAD B;  2HYE D;  3VK6 A;  4S3O C;  3ZVZ B;  3ZPV E;  2KRE A;  3N9L A;  3LQH A;  2F42 A;  1Z60 A;  3O7A A;  2JMI A;  5G0F A;  2YHN A;  1HYI A;  1VYX A;  5D1M B;  2ECG A;  4I7D A;  3C6W A;  1WIL A;  2LDR A;  2VJE B;  3SHB A;  4QF2 A;  2L80 A;  2M3H A;  1Z6U A;  1VFY A;  4YBM A;  4WZ3 B;  2FUU A;  3GV4 A;  1WEP A;  5G04 B;  5H1V A;  3GL6 A;  5TAB A;  2ECV A;  5DKA A;  4PPE A;  4A4B A;  1Z2Q A;  2FUI A;  2Y1M A;  2FSA A;  4GNE A;  4LKA A;  5D1K B;  2K4D A;  3U5P A;  5FB1 A;  5B75 A;  5C13 A;  4MVT A;  2MUM A;  4NN2 A;  1E4U A;  3V43 A;  5EYA F;  4BHW A;  4ZUX U;  4WZ0 A;  2QIZ A;  1BOR A;  2Y1N A;  1FP0 A;  2CKL A;  5KH9 A;  1WEQ A;  3IHP A;  3N9O A;  2K16 A;  5B78 A;  4ZQL A;  1HYJ A;  3PHD A;  2PNX A;  2MA5 A;  2YRE A;  2ZET C;  1WEW A;  4B7Y C;  2VNF A;  2RSD A;  1IYM A;  2F6N A;  1XWH A;  4C9Z A;  5B76 A;  1DVP A;  2KR4 A;  3U5O A;  2KGI A; 
#chains in the Genus database with same CATH topology
 1WFK A;  2C2L A;  2VPB A;  2FD4 A;  2DX8 A;  4AYC B;  3ZYQ A;  2KGG A;  3KNV A;  3ZVY A;  2KFT A;  4LK9 A;  2EA6 A;  3N9N A;  2XOZ A;  2LN0 A;  2HDP A;  5FEY A;  3NG2 A;  2F6J A;  3ZNI A;  1U6G B;  2CSY A;  2NAA A;  2H0D B;  2ECT A;  4UP5 A;  3FM8 C;  4R8P K;  4I7C A;  4YC9 A;  5KH3 A;  4YAT A;  2LGL A;  3SOW A;  4YAD A;  1WE9 A;  2FFW A;  2L75 A;  3T6R A;  2JM3 A;  3U5N A;  2EOD A;  1X4J A;  1RMD A;  1F62 A;  2LV9 A;  3ZTG A;  2M6M A;  3EB6 A;  3PUR A;  2M85 A;  2YU4 A;  4AVX A;  2DSM A;  5B77 A;  1VD4 A;  3HCU A;  1WES A;  5LCW B;  2XOY A;  2VJF B;  4IC2 A;  2CT2 A;  3O36 A;  3H7H A;  4Q6F A;  2YQL A;  3T9K A;  4FK5 A;  2QIC A;  5LKU A;  2VPD A;  2OWA A;  3RTR B;  2G43 A;  2VP7 A;  3O35 A;  4YBT A;  2KWK A;  1CHC A;  4A49 A;  2KYU A;  4AUQ B;  4YBS A;  5SVI A;  4N3W A;  2YVR A;  1DCQ A;  4GND A;  3N9P A;  2XB1 A;  3DPL R;  2XOC A;  2UZG A;  5LKX A;  1G25 A;  4WA6 A;  3FAO A;  4CCG X;  5AIU A;  2MIQ A;  3DDT A;  3N9M A;  5LKT A;  2G45 A;  2YUC A;  5TDW A;  3JUE A;  3M63 A;  4F1P A;  2CSZ A;  2LXP C;  2KWO A;  2E6R A;  1ZBD B;  2EGP A;  1JM7 B;  3KV6 A;  1V87 A;  2YSM A;  5TRB A;  3O37 A;  4LLB A;  2JMD A;  1WEU A;  1N87 A;  3ZPV 1;  2KU3 A;  5C11 A;  4L7X A;  5LKZ A;  3MHH A;  3MHS A;  2VPE A;  4A0C D;  4I7B A;  5H1T A;  5TBN A;  4B86 C;  2LQ6 A;  2KE1 A;  4CA1 A;  2YW8 A;  3LJU X;  2YSJ A;  2D8S A;  5H1U A;  2L5U A;  1WEM A;  4GNF A;  1K2F A;  3LQJ A;  3E2D A;  2EGM A;  2MKE A;  2KWJ A;  3LVR E;  4FO9 A;  3Q1D A;  2AN6 A;  4R7E A;  2E6S A;  5SVY A;  1LDJ B;  3O70 A;  4GNG A;  1WEV A;  2G6Q A;  1WGM A;  2QJ0 A;  5B79 A;  4X3G A;  1T1H A;  2KKX A;  3LDY A;  4Z0R A;  2RR4 A;  4YAB A;  5AIT A;  5DIN A;  1JOC A;  4PTB A;  2VJE A;  2M1R A;  3KQI A;  2KWN A;  4OGC A;  2LRI C;  4ZDT A;  4H9D A;  2XEU A;  2MNZ A;  2JRJ A;  5D1L B;  3HCS A;  1WIM A;  4F52 B;  2BAY A;  3FAN A;  5K3Q A;  3U5M A;  3N9Q A;  2L0B A;  3C5K A;  3O33 A;  4Z0O A;  2RI7 A;  1FBV A;  2OXQ C;  2LGK A;  2CON A;  2M13 A;  2ECN A;  2ECJ A;  4QF3 A;  5B8D A;  5I3L A;  3M99 A;  4UI9 B;  3KV5 A;  3RPG B;  4IC3 A;  5SVX A;  1MM3 A;  2DJA A;  3M62 A;  3SUB A;  2YT5 A;  1X4U A;  3L11 A;  1JM7 A;  2CRR A;  4W4U A;  2C2V S;  3KDE C;  1X4I A;  3LQI A;  2IDA A;  2MD7 B;  2YYR A;  4UP0 A;  4N4F A;  2K1J A;  3DQV R;  4YAX A;  1WEN A;  3O34 A;  4AYC A;  5H9M A;  2MT5 A;  5G05 B;  2K17 A;  4V3K C;  3T7L A;  2LGV A;  3EB5 A;  5TDR A;  5FER A;  3ASL A;  4A4C A;  4AP4 A;  2MD8 C;  2B0O E;  2Y43 A;  4V3L C;  4LJN A;  4S3O B;  1WEE A;  2H0D A;  1WEO A;  2LGG A;  2ECW A;  3QZV A;  2P57 A;  2LXH C;  5J3X A;  4FJC A;  3FL2 A;  3RPG C;  2YHO A;  2YUR A;  4R2Y A;  2I50 A;  2KIZ A;  2MA6 A;  3FJU B;  3LRQ A;  2CKL B;  2L43 A;  4XI1 A;  4WZ2 A;  4O64 A;  2ECI A;  3I2D A;  4BBQ A;  2VPG A;  2MNY A;  1LDK C;  5FB0 A;  4P5O B;  5JG6 A;  4L58 A;  4FIP A;  5KH7 A;  3SOX A;  2CSV A;  1MM2 A;  3PUQ A;  3HCT A;  4MSX A;  2YQM A;  2VJF A;  2XP0 A;  3LVQ E;  2JUN A;  2L7P A;  3SOU A;  4TKP B;  3L1Z B;  2JMJ A;  2PUY A;  4GB0 A;  2CRW A;  3HTK C;  3L1X A;  4LAD B;  2HYE D;  3DWD A;  4S3O C;  3VK6 A;  3ZVZ B;  3ZPV E;  2KRE A;  3N9L A;  4O62 A;  3LQH A;  2F42 A;  1Z60 A;  3O7A A;  2JMI A;  5G0F A;  2YHN A;  1HYI A;  1VYX A;  2LAU A;  5D1M B;  2ECG A;  4I7D A;  3C6W A;  1WIL A;  2LDR A;  2D8U A;  2VJE B;  3M7K A;  3SHB A;  4OGE A;  4QF2 A;  2E61 A;  2L80 A;  2M3H A;  1Z6U A;  1VFY A;  4YBM A;  4WZ3 B;  2FUU A;  3GV4 A;  1MBM A;  1WEP A;  5G04 B;  5H1V A;  3GL6 A;  5TAB A;  2ECV A;  5DKA A;  3PLW A;  4PPE A;  4A4B A;  1Z2Q A;  2FUI A;  2Y1M A;  2FSA A;  4GNE A;  4LKA A;  5D1K B;  2K4D A;  3U5P A;  5FB1 A;  5B75 A;  5C13 A;  4MVT A;  2MUM A;  4NN2 A;  1E4U A;  5SVI B;  3V43 A;  5EYA F;  4BHW A;  2EXU A;  4WZ0 A;  2QIZ A;  4ZUX U;  1BOR A;  2KKY A;  2Y1N A;  1FP0 A;  2CKL A;  4QQ4 A;  5KH9 A;  1WEQ A;  3IHP A;  3N9O A;  2K16 A;  5B78 A;  4ZQL A;  1HYJ A;  3PHD A;  2IQJ A;  3MDB C;  2PNX A;  2MA5 A;  2YRE A;  2ZET C;  1WEW A;  4B7Y C;  2VNF A;  2RSD A;  3O47 A;  1IYM A;  3FEH A;  2F6N A;  1XWH A;  4C9Z A;  5B76 A;  1DVP A;  2KR4 A;  3U5O A;  2KGI A; 
#chains in the Genus database with same CATH homology
 1WFK A;  2C2L A;  2VPB A;  2DX8 A;  4AYC B;  3ZYQ A;  2KGG A;  3KNV A;  3ZVY A;  2KFT A;  4LK9 A;  2EA6 A;  3N9N A;  2LN0 A;  2HDP A;  5FEY A;  3NG2 A;  2F6J A;  3ZNI A;  1U6G B;  2CSY A;  2NAA A;  2H0D B;  2ECT A;  4UP5 A;  4R8P K;  4I7C A;  4YC9 A;  5KH3 A;  4YAT A;  2LGL A;  3SOW A;  4YAD A;  1WE9 A;  2L75 A;  3T6R A;  3U5N A;  2EOD A;  1X4J A;  1RMD A;  1F62 A;  2LV9 A;  3ZTG A;  2M6M A;  3EB6 A;  3PUR A;  2M85 A;  2YU4 A;  4AVX A;  5B77 A;  1VD4 A;  3HCU A;  1WES A;  5LCW B;  2VJF B;  4IC2 A;  2CT2 A;  3O36 A;  4Q6F A;  2YQL A;  4FK5 A;  2QIC A;  5LKU A;  2VPD A;  3RTR B;  2G43 A;  2VP7 A;  3O35 A;  4YBT A;  2KWK A;  1CHC A;  4A49 A;  2KYU A;  4AUQ B;  4YBS A;  4N3W A;  4GND A;  3N9P A;  2XB1 A;  3DPL R;  5LKX A;  2UZG A;  1G25 A;  4WA6 A;  4CCG X;  5AIU A;  2MIQ A;  3N9M A;  5LKT A;  2G45 A;  2YUC A;  5TDW A;  3M63 A;  2CSZ A;  2LXP C;  2KWO A;  2E6R A;  1ZBD B;  2EGP A;  1JM7 B;  3KV6 A;  1V87 A;  2YSM A;  5TRB A;  3O37 A;  4LLB A;  2JMD A;  1WEU A;  1N87 A;  3ZPV 1;  2KU3 A;  5C11 A;  4L7X A;  5LKZ A;  3MHH A;  3MHS A;  2VPE A;  4A0C D;  4I7B A;  5H1T A;  5TBN A;  4B86 C;  2LQ6 A;  2KE1 A;  4CA1 A;  2YW8 A;  2YSJ A;  2D8S A;  5H1U A;  2L5U A;  1WEM A;  4GNF A;  1K2F A;  3LQJ A;  2KWJ A;  4FO9 A;  2AN6 A;  4R7E A;  2E6S A;  1LDJ B;  3O70 A;  4GNG A;  1WEV A;  2G6Q A;  1WGM A;  2QJ0 A;  5B79 A;  4X3G A;  1T1H A;  4YAB A;  5AIT A;  5DIN A;  1JOC A;  4PTB A;  2VJE A;  2M1R A;  3KQI A;  2KWN A;  2LRI C;  4ZDT A;  2XEU A;  2MNZ A;  2JRJ A;  5D1L B;  3HCS A;  1WIM A;  4F52 B;  2BAY A;  3U5M A;  3N9Q A;  2L0B A;  3C5K A;  3O33 A;  2RI7 A;  1FBV A;  2OXQ C;  2LGK A;  2ECN A;  2ECJ A;  4QF3 A;  5B8D A;  5I3L A;  3M99 A;  4UI9 B;  3KV5 A;  3RPG B;  4IC3 A;  1MM3 A;  3M62 A;  2YT5 A;  1X4U A;  3L11 A;  1JM7 A;  4W4U A;  2C2V S;  1X4I A;  3LQI A;  2IDA A;  2MD7 B;  2YYR A;  4UP0 A;  4N4F A;  2K1J A;  3DQV R;  4YAX A;  1WEN A;  3O34 A;  4AYC A;  5H9M A;  2MT5 A;  5G05 B;  2K17 A;  4V3K C;  3T7L A;  2LGV A;  3EB5 A;  5TDR A;  5FER A;  3ASL A;  4A4C A;  4AP4 A;  2MD8 C;  2Y43 A;  4V3L C;  4LJN A;  4S3O B;  1WEE A;  2H0D A;  1WEO A;  2LGG A;  2ECW A;  3QZV A;  2LXH C;  5J3X A;  4FJC A;  3FL2 A;  3RPG C;  2YHO A;  2YUR A;  4R2Y A;  2I50 A;  2KIZ A;  2MA6 A;  3LRQ A;  2CKL B;  2L43 A;  4XI1 A;  4WZ2 A;  4O64 A;  2ECI A;  3I2D A;  4BBQ A;  2VPG A;  2MNY A;  1LDK C;  5FB0 A;  4P5O B;  5JG6 A;  4L58 A;  4FIP A;  5KH7 A;  3SOX A;  1MM2 A;  3PUQ A;  3HCT A;  4MSX A;  2YQM A;  2VJF A;  3SOU A;  4TKP B;  3L1Z B;  2JMJ A;  2PUY A;  4GB0 A;  3HTK C;  3L1X A;  4LAD B;  2HYE D;  3VK6 A;  4S3O C;  3ZVZ B;  3ZPV E;  2KRE A;  3N9L A;  3LQH A;  2F42 A;  1Z60 A;  3O7A A;  2JMI A;  5G0F A;  2YHN A;  1HYI A;  1VYX A;  5D1M B;  2ECG A;  4I7D A;  3C6W A;  1WIL A;  2LDR A;  2VJE B;  3SHB A;  4QF2 A;  2L80 A;  2M3H A;  1Z6U A;  1VFY A;  4YBM A;  4WZ3 B;  2FUU A;  3GV4 A;  1WEP A;  5G04 B;  5H1V A;  3GL6 A;  5TAB A;  2ECV A;  5DKA A;  4PPE A;  4A4B A;  1Z2Q A;  2FUI A;  2Y1M A;  2FSA A;  4GNE A;  4LKA A;  5D1K B;  2K4D A;  3U5P A;  5FB1 A;  5B75 A;  5C13 A;  4MVT A;  2MUM A;  4NN2 A;  1E4U A;  3V43 A;  5EYA F;  4BHW A;  4ZUX U;  4WZ0 A;  2QIZ A;  1BOR A;  2Y1N A;  1FP0 A;  2CKL A;  5KH9 A;  1WEQ A;  3IHP A;  3N9O A;  2K16 A;  5B78 A;  4ZQL A;  1HYJ A;  3PHD A;  2PNX A;  2MA5 A;  2YRE A;  2ZET C;  1WEW A;  4B7Y C;  2VNF A;  2RSD A;  1IYM A;  2F6N A;  1XWH A;  4C9Z A;  5B76 A;  1DVP A;  2KR4 A;  3U5O A;  2KGI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...