1V87A

Solution structure of the ring-h2 finger domain of mouse deltex protein 2
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
114
structure length
114
Chain Sequence
GSSGSSGEPEQVIRKYTEELKVAPEEDCIICMEKLAVASGYSDMTDSKALGPMVVGRLTKCSHAFHLLCLLAMYCNGNKDGSLQCPSCKTIYGEKTGTQPWGKMEVFRSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Deltex protein 2
publication title Solution Structure of the Ring-H2 Finger Domain of Mouse Deltex Protein 2
rcsb
source organism Mus musculus
molecule tags Metal binding protein
total genus 14
structure length 114
sequence length 114
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2003-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1v87A01
3L11A 3N9LA 4Q6FA 3I2DA 4P5OB 3SOXA 2Y1NA 2RI7A 2RSDA 2LXPC 2M3HA 2ECWA 3HCUA 2FSAA 3KQIA 3EB5A 1WEWA 3HTKC 5D1MB 2PUYA 3IHPA 2CSYA 2EGPA 3C5KA 2KIZA 3LRQA 4GNDA 5TRBA 3O36A 3LQIA 2K1JA 2CT2A 4C9ZA 3M99A 2VNFA 2E6SA 3N9PA 4LLBA 5KH7A 2IDAA 2ECGA 4IC2A 4PPEA 2YHOA 4FK5A 2VPGA 1MM2A 1T1HA 4W4UA 4S3OB 5H1UA 4YBTA 2VJFA 5J3XA 2XEUA 1X4JA 2L75A 5LKUA 5D1LB 1E4UA 4A49A 2F6NA 5B8DA 2JMDA 3T6RA 2ECTA 3PUQA 4LKAA 3M62A 4S3OC 2VPDA 5FEYA 3PURA 5FB0A 1JM7A 4ZUXU 2LDRA 3N9OA 3V43A 2BAYA 4GNEA 2KGGA 4A0CD 2CSZA 2MA5A 4WZ2A 5C11A 1LDJB 4YBMA 4YBSA 2YUCA 4MSXA 4A4CA 2LN0A 2LQ6A 2C2LA 3O34A 2FUIA 5C13A 4GNFA 2MNYA 4F52B 2DX8A 2OXQC 2YT5A 2UZGA 5B78A 2KWNA 2YQMA 5JG6A 5G04B 1DVPA 4I7DA 2MUMA 3O7AA 1K2FA 2ECVA 4GNGA 2ECJA 1WEMA 3MHHA 3MHSA 3KNVA 4LJNA 2G6QA 3ZVZB 3N9QA 3LQJA 1U6GB 2VJFB 2YU4A 4YAXA 2YREA 4WZ0A 2LV9A 2JRJA 1FBVA 2LGGA 3C6WA 1Z60A 2YQLA 1G25A 2ECIA 1WEEA 4N4FA 1WFKA 3ZVYA 4FJCA 4B86C 3L1ZB 4GB0A 5H9MA 1VFYA 2LGKA 1JM7B 4CA1A 2L5UA 1HYIA 2YSMA 2CKLA 5B76A 4PTBA 3PHDA 4TKPB 3U5NA 1X4UA 2VPEA 2MNZA 4A4BA 5AIUA 1WILA 2YW8A 2F42A 3O33A 1BORA 2AN6A 2D8SA 3NG2A 3HCTA 2HYED 2VP7A 3SOWA 1F62A 4L58A 4UI9B 1V87A 4YC9A 2NAAA 3RPGB 2L80A 2PNXA 3VK6A 2KE1A 2MD7B 2E6RA 2G45A 2M1RA 3GV4A 5B77A 5I3LA 2Y43A 4AVXA 5KH9A 5H1VA 1RMDA 1WEVA 1WENA 2JMIA 5LCWB 2KGIA 2KWKA 2XB1A 2VJEA 4FO9A 2MA6A 1MM3A 3L1XA 2YURA 5B79A 1VD4A 2ZETC 3SHBA 5FERA 1WEUA 2JMJA 3U5OA 2KU3A 4MVTA 4AYCB 2K16A 2CKLB 4LK9A 1XWHA 2MIQA 2QIZA 2H0DA 4L7XA 3EB6A 2K17A 1VYXA 3ZTGA 4QF2A 1Z6UA 1X4IA 4BBQA 3QZVA 1N87A 5H1TA 2ECNA 3ZYQA 2EA6A 5EYAF 3U5PA 4V3KC 3DPLR 4FIPA 2M85A 5B75A 2YYRA 3M63A 3HCSA 4AUQB 3LQHA 1IYMA 2VPBA 3ZPVE 4O64A 1JOCA 2C2VS 4ZDTA 3O37A 4LADB 4IC3A 3ZNIA 3FL2A 2YHNA 1ZBDB 2KR4A 4WA6A 4AYCA 4ZQLA 4QF3A 4V3LC 1WIMA 5TDWA 4UP5A 3KV5A 4WZ3B 2VJEB 1WEQA 2LGVA 4X3GA 3O35A 1Z2QA 5DINA 2G43A 1WEOA 1LDKC 2HDPA 3KV6A 2MT5A 5LKTA 5D1KB 4R8PK 3O70A 4YADA 1FP0A 5G05B 2KYUA 2H0DB 2M6MA 2Y1MA 2EODA 2I50A 2KFTA 4BHWA 1WESA 4YATA 2L43A 3GL6A 2FUUA 4R2YA 2LXHC 5TABA 1WGMA 3ZPV1 1WE9A 4AP4A 2MD8C 3RPGC 3U5MA 4B7YC 2L0BA 5G0FA 4XI1A 5LKXA 4UP0A 2YSJA 4NN2A 2QICA 5TBNA 2LRIC 3SOUA 1CHCA 2LGLA 5TDRA 5AITA 3T7LA 3N9MA 1HYJA 4YABA 5KH3A 5LKZA 2F6JA 2KREA 3DQVR 5FB1A 2K4DA 4R7EA 4I7BA 3RTRB 3ASLA 4N3WA 4CCGX 2KWOA 4I7CA 5DKAA 2KWJA 3N9NA 1WEPA 2QJ0A
chains in the Genus database with same CATH superfamily
3L11A 3N9LA 2RR4A 4Q6FA 3I2DA 4P5OB 3SOXA 2Y1NA 2RI7A 2RSDA 2LXPC 2M3HA 3M7KA 2ECWA 3HCUA 2FSAA 3KQIA 3EB5A 2DJAA 1WEWA 3HTKC 5D1MB 2PUYA 3IHPA 2CSYA 5SVXA 2EGPA 2XOZA 3C5KA 2KIZA 3LRQA 4GNDA 5SVIB 3O36A 5TRBA 3LQIA 2K1JA 2CT2A 4C9ZA 3M99A 2VNFA 2E6SA 3N9PA 2XP0A 4LLBA 5KH7A 2IDAA 2ECGA 4IC2A 4PPEA 2YHOA 4FK5A 2VPGA 1MM2A 1T1HA 4W4UA 4S3OB 5H1UA 4YBTA 2VJFA 5J3XA 2XEUA 1X4JA 2L75A 5SVYA 5LKUA 5D1LB 1E4UA 4A49A 2F6NA 5B8DA 2JMDA 4QQ4A 3T6RA 2ECTA 4F1PA 3PUQA 3FEHA 4LKAA 3M62A 4S3OC 2VPDA 5FEYA 3PURA 5FB0A 1JM7A 4ZUXU 2EGMA 2YVRA 2LDRA 3N9OA 3V43A 2BAYA 3T9KA 4GNEA 2KGGA 4A0CD 2CSZA 2MA5A 4WZ2A 5C11A 1LDJB 4YBMA 3Q1DA 4YBSA 2YUCA 4MSXA 4A4CA 2LN0A 2LQ6A 2C2LA 3O34A 2FUIA 5C13A 2LAUA 2MNYA 4GNFA 4F52B 2DX8A 2OXQC 2YT5A 3E2DA 2UZGA 5B78A 2KWNA 2YQMA 5K3QA 5JG6A 5G04B 2D8UA 1DVPA 4I7DA 2MUMA 3O7AA 1K2FA 2ECVA 4GNGA 2ECJA 1WEMA 3MHHA 3MHSA 3KNVA 4LJNA 2G6QA 2E61A 3ZVZB 3N9QA 3LQJA 1U6GB 2VJFB 2YU4A 4YAXA 2YREA 2M13A 4WZ0A 2OWAA 2LV9A 2KKYA 2JRJA 1FBVA 2LGGA 3C6WA 1Z60A 2YQLA 2XOCA 1G25A 2ECIA 1WEEA 4N4FA 1WFKA 3ZVYA 4FJCA 4B86C 3L1ZB 4GB0A 5H9MA 4H9DA 1VFYA 2LGKA 1DCQA 4CA1A 1JM7B 2L5UA 1HYIA 2YSMA 2CKLA 5B76A 4PTBA 3PHDA 2IQJA 3JUEA 4TKPB 3U5NA 1X4UA 2VPEA 2MNZA 4A4BA 5AIUA 1WILA 2L7PA 2YW8A 2F42A 3FJUB 3O33A 1BORA 2AN6A 2D8SA 3NG2A 3HCTA 2FFWA 2HYED 2VP7A 3SOWA 1F62A 4L58A 4UI9B 1V87A 4YC9A 2NAAA 3RPGB 2L80A 2PNXA 3VK6A 2KE1A 2MD7B 2E6RA 2G45A 2M1RA 3GV4A 5B77A 5I3LA 2Y43A 4AVXA 5KH9A 1MBMA 5H1VA 1RMDA 1WEVA 1WENA 2JMIA 5LCWB 2KGIA 2KWKA 2XB1A 2VJEA 4FO9A 2MA6A 4O62A 1MM3A 3PLWA 3L1XA 2YURA 5B79A 1VD4A 2ZETC 3SHBA 5FERA 1WEUA 2JMJA 3U5OA 2JM3A 3LVRE 2KU3A 2JUNA 4MVTA 4AYCB 3FM8C 2K16A 2CKLB 4LK9A 1XWHA 2MIQA 2QIZA 2H0DA 3H7HA 4L7XA 3EB6A 2K17A 1VYXA 3ZTGA 4QF2A 2CRWA 1Z6UA 2DSMA 1X4IA 4BBQA 3QZVA 1N87A 5H1TA 2ECNA 3ZYQA 2EA6A 5EYAF 3U5PA 4V3KC 3DPLR 4FIPA 3LJUX 2M85A 5B75A 2YYRA 3M63A 3HCSA 4AUQB 3LQHA 1IYMA 2VPBA 3ZPVE 4O64A 1JOCA 3DDTA 2C2VS 4ZDTA 3O37A 4LADB 4IC3A 3ZNIA 3FL2A 2YHNA 3SUBA 2CSVA 1ZBDB 2KR4A 4WA6A 4OGEA 4AYCA 2FD4A 4ZQLA 4QF3A 4V3LC 1WIMA 5TDWA 4UP5A 3KV5A 4WZ3B 2VJEB 1WEQA 2LGVA 4X3GA 3O35A 1Z2QA 1WEOA 2G43A 5DINA 2MKEA 3LDYA 1LDKC 2HDPA 3FANA 3KV6A 2MT5A 5LKTA 5D1KB 4R8PK 3O70A 4YADA 1FP0A 5G05B 2KYUA 2H0DB 2M6MA 2Y1MA 2CRRA 2EODA 2I50A 2KFTA 4BHWA 1WESA 2B0OE 3O47A 4YATA 2EXUA 2CONA 2L43A 3GL6A 4Z0RA 2FUUA 4R2YA 2LXHC 5TABA 1WGMA 3ZPV1 1WE9A 5SVIA 4AP4A 2MD8C 3RPGC 3U5MA 4B7YC 2L0BA 5G0FA 3LVQE 2KKXA 4XI1A 4Z0OA 3MDBC 5LKXA 4UP0A 2YSJA 4NN2A 2QICA 3FAOA 5TBNA 2LRIC 2XOYA 1CHCA 2LGLA 3SOUA 5TDRA 5AITA 3T7LA 3N9MA 1HYJA 4YABA 5KH3A 3KDEC 3DWDA 2F6JA 4OGCA 5LKZA 2KREA 3DQVR 5FB1A 2K4DA 4R7EA 2P57A 4I7BA 3RTRB 3ASLA 4N3WA 4CCGX 2KWOA 4I7CA 5DKAA 2KWJA 3N9NA 1WEPA 2QJ0A
chains in the Genus database with same CATH topology
3L11A 3N9LA 4Q6FA 3I2DA 4P5OB 3SOXA 2Y1NA 2RI7A 2RSDA 2LXPC 2M3HA 2ECWA 3HCUA 2FSAA 3KQIA 3EB5A 1WEWA 3HTKC 5D1MB 2PUYA 3IHPA 2CSYA 2EGPA 3C5KA 2KIZA 3LRQA 4GNDA 5TRBA 3O36A 3LQIA 2K1JA 2CT2A 4C9ZA 3M99A 2VNFA 2E6SA 3N9PA 4LLBA 5KH7A 2IDAA 2ECGA 4IC2A 4PPEA 2YHOA 4FK5A 2VPGA 1MM2A 1T1HA 4W4UA 4S3OB 5H1UA 4YBTA 2VJFA 5J3XA 2XEUA 1X4JA 2L75A 5LKUA 5D1LB 1E4UA 4A49A 2F6NA 5B8DA 2JMDA 3T6RA 2ECTA 3PUQA 4LKAA 3M62A 4S3OC 2VPDA 5FEYA 3PURA 5FB0A 1JM7A 4ZUXU 2LDRA 3N9OA 3V43A 2BAYA 4GNEA 2KGGA 4A0CD 2CSZA 2MA5A 4WZ2A 5C11A 1LDJB 4YBMA 4YBSA 2YUCA 4MSXA 4A4CA 2LN0A 2LQ6A 2C2LA 3O34A 2FUIA 5C13A 4GNFA 2MNYA 4F52B 2DX8A 2OXQC 2YT5A 2UZGA 5B78A 2KWNA 2YQMA 5JG6A 5G04B 1DVPA 4I7DA 2MUMA 3O7AA 1K2FA 2ECVA 4GNGA 2ECJA 1WEMA 3MHHA 3MHSA 3KNVA 4LJNA 2G6QA 3ZVZB 3N9QA 3LQJA 1U6GB 2VJFB 2YU4A 4YAXA 2YREA 4WZ0A 2LV9A 2JRJA 1FBVA 2LGGA 3C6WA 1Z60A 2YQLA 1G25A 2ECIA 1WEEA 4N4FA 1WFKA 3ZVYA 4FJCA 4B86C 3L1ZB 4GB0A 5H9MA 1VFYA 2LGKA 1JM7B 4CA1A 2L5UA 1HYIA 2YSMA 2CKLA 5B76A 4PTBA 3PHDA 4TKPB 3U5NA 1X4UA 2VPEA 2MNZA 4A4BA 5AIUA 1WILA 2YW8A 2F42A 3O33A 1BORA 2AN6A 2D8SA 3NG2A 3HCTA 2HYED 2VP7A 3SOWA 1F62A 4L58A 4UI9B 1V87A 4YC9A 2NAAA 3RPGB 2L80A 2PNXA 3VK6A 2KE1A 2MD7B 2E6RA 2G45A 2M1RA 3GV4A 5B77A 5I3LA 2Y43A 4AVXA 5KH9A 5H1VA 1RMDA 1WEVA 1WENA 2JMIA 5LCWB 2KGIA 2KWKA 2XB1A 2VJEA 4FO9A 2MA6A 1MM3A 3L1XA 2YURA 5B79A 1VD4A 2ZETC 3SHBA 5FERA 1WEUA 2JMJA 3U5OA 2KU3A 4MVTA 4AYCB 2K16A 2CKLB 4LK9A 1XWHA 2MIQA 2QIZA 2H0DA 4L7XA 3EB6A 2K17A 1VYXA 3ZTGA 4QF2A 1Z6UA 1X4IA 4BBQA 3QZVA 1N87A 5H1TA 2ECNA 3ZYQA 2EA6A 5EYAF 3U5PA 4V3KC 3DPLR 4FIPA 2M85A 5B75A 2YYRA 3M63A 3HCSA 4AUQB 3LQHA 1IYMA 2VPBA 3ZPVE 4O64A 1JOCA 2C2VS 4ZDTA 3O37A 4LADB 4IC3A 3ZNIA 3FL2A 2YHNA 1ZBDB 2KR4A 4WA6A 4AYCA 4ZQLA 4QF3A 4V3LC 1WIMA 5TDWA 4UP5A 3KV5A 4WZ3B 2VJEB 1WEQA 2LGVA 4X3GA 3O35A 1Z2QA 5DINA 2G43A 1WEOA 1LDKC 2HDPA 3KV6A 2MT5A 5LKTA 5D1KB 4R8PK 3O70A 4YADA 1FP0A 5G05B 2KYUA 2H0DB 2M6MA 2Y1MA 2EODA 2I50A 2KFTA 4BHWA 1WESA 4YATA 2L43A 3GL6A 2FUUA 4R2YA 2LXHC 5TABA 1WGMA 3ZPV1 1WE9A 4AP4A 2MD8C 3RPGC 3U5MA 4B7YC 2L0BA 5G0FA 4XI1A 5LKXA 4UP0A 2YSJA 4NN2A 2QICA 5TBNA 2LRIC 3SOUA 1CHCA 2LGLA 5TDRA 5AITA 3T7LA 3N9MA 1HYJA 4YABA 5KH3A 5LKZA 2F6JA 2KREA 3DQVR 5FB1A 2K4DA 4R7EA 4I7BA 3RTRB 3ASLA 4N3WA 4CCGX 2KWOA 4I7CA 5DKAA 2KWJA 3N9NA 1WEPA 2QJ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L11 A;  3N9L A;  4Q6F A;  3I2D A;  4P5O B;  3SOX A;  2Y1N A;  2RI7 A;  2RSD A;  2LXP C;  2M3H A;  2ECW A;  3HCU A;  2FSA A;  3KQI A;  3EB5 A;  1WEW A;  3HTK C;  5D1M B;  2PUY A;  3IHP A;  2CSY A;  2EGP A;  3C5K A;  2KIZ A;  3LRQ A;  4GND A;  5TRB A;  3O36 A;  3LQI A;  2K1J A;  2CT2 A;  4C9Z A;  3M99 A;  2VNF A;  2E6S A;  3N9P A;  4LLB A;  5KH7 A;  2IDA A;  2ECG A;  4IC2 A;  4PPE A;  2YHO A;  4FK5 A;  2VPG A;  1MM2 A;  1T1H A;  4W4U A;  4S3O B;  5H1U A;  4YBT A;  2VJF A;  5J3X A;  2XEU A;  1X4J A;  2L75 A;  5LKU A;  5D1L B;  1E4U A;  4A49 A;  2F6N A;  5B8D A;  2JMD A;  3T6R A;  2ECT A;  3PUQ A;  4LKA A;  3M62 A;  4S3O C;  2VPD A;  5FEY A;  3PUR A;  5FB0 A;  1JM7 A;  4ZUX U;  2LDR A;  3N9O A;  3V43 A;  2BAY A;  4GNE A;  2KGG A;  4A0C D;  2CSZ A;  2MA5 A;  4WZ2 A;  5C11 A;  1LDJ B;  4YBM A;  4YBS A;  2YUC A;  4MSX A;  4A4C A;  2LN0 A;  2LQ6 A;  2C2L A;  3O34 A;  2FUI A;  5C13 A;  4GNF A;  2MNY A;  4F52 B;  2DX8 A;  2OXQ C;  2YT5 A;  2UZG A;  5B78 A;  2KWN A;  2YQM A;  5JG6 A;  5G04 B;  1DVP A;  4I7D A;  2MUM A;  3O7A A;  1K2F A;  2ECV A;  4GNG A;  2ECJ A;  1WEM A;  3MHH A;  3MHS A;  3KNV A;  4LJN A;  2G6Q A;  3ZVZ B;  3N9Q A;  3LQJ A;  1U6G B;  2VJF B;  2YU4 A;  4YAX A;  2YRE A;  4WZ0 A;  2LV9 A;  2JRJ A;  1FBV A;  2LGG A;  3C6W A;  1Z60 A;  2YQL A;  1G25 A;  2ECI A;  1WEE A;  4N4F A;  1WFK A;  3ZVY A;  4FJC A;  4B86 C;  3L1Z B;  4GB0 A;  5H9M A;  1VFY A;  2LGK A;  1JM7 B;  4CA1 A;  2L5U A;  1HYI A;  2YSM A;  2CKL A;  5B76 A;  4PTB A;  3PHD A;  4TKP B;  3U5N A;  1X4U A;  2VPE A;  2MNZ A;  4A4B A;  5AIU A;  1WIL A;  2YW8 A;  2F42 A;  3O33 A;  1BOR A;  2AN6 A;  2D8S A;  3NG2 A;  3HCT A;  2HYE D;  2VP7 A;  3SOW A;  1F62 A;  4L58 A;  4UI9 B;  1V87 A;  4YC9 A;  2NAA A;  3RPG B;  2L80 A;  2PNX A;  3VK6 A;  2KE1 A;  2MD7 B;  2E6R A;  2G45 A;  2M1R A;  3GV4 A;  5B77 A;  5I3L A;  2Y43 A;  4AVX A;  5KH9 A;  5H1V A;  1RMD A;  1WEV A;  1WEN A;  2JMI A;  5LCW B;  2KGI A;  2KWK A;  2XB1 A;  2VJE A;  4FO9 A;  2MA6 A;  1MM3 A;  3L1X A;  2YUR A;  5B79 A;  1VD4 A;  2ZET C;  3SHB A;  5FER A;  1WEU A;  2JMJ A;  3U5O A;  2KU3 A;  4MVT A;  4AYC B;  2K16 A;  2CKL B;  4LK9 A;  1XWH A;  2MIQ A;  2QIZ A;  2H0D A;  4L7X A;  3EB6 A;  2K17 A;  1VYX A;  3ZTG A;  4QF2 A;  1Z6U A;  1X4I A;  4BBQ A;  3QZV A;  1N87 A;  5H1T A;  2ECN A;  3ZYQ A;  2EA6 A;  5EYA F;  3U5P A;  4V3K C;  3DPL R;  4FIP A;  2M85 A;  5B75 A;  2YYR A;  3M63 A;  3HCS A;  4AUQ B;  3LQH A;  1IYM A;  2VPB A;  3ZPV E;  4O64 A;  1JOC A;  2C2V S;  4ZDT A;  3O37 A;  4LAD B;  4IC3 A;  3ZNI A;  3FL2 A;  2YHN A;  1ZBD B;  2KR4 A;  4WA6 A;  4AYC A;  4ZQL A;  4QF3 A;  4V3L C;  1WIM A;  5TDW A;  4UP5 A;  3KV5 A;  4WZ3 B;  2VJE B;  1WEQ A;  2LGV A;  4X3G A;  3O35 A;  1Z2Q A;  5DIN A;  2G43 A;  1WEO A;  1LDK C;  2HDP A;  3KV6 A;  2MT5 A;  5LKT A;  5D1K B;  4R8P K;  3O70 A;  4YAD A;  1FP0 A;  5G05 B;  2KYU A;  2H0D B;  2M6M A;  2Y1M A;  2EOD A;  2I50 A;  2KFT A;  4BHW A;  1WES A;  4YAT A;  2L43 A;  3GL6 A;  2FUU A;  4R2Y A;  2LXH C;  5TAB A;  1WGM A;  3ZPV 1;  1WE9 A;  4AP4 A;  2MD8 C;  3RPG C;  3U5M A;  4B7Y C;  2L0B A;  5G0F A;  4XI1 A;  5LKX A;  4UP0 A;  2YSJ A;  4NN2 A;  2QIC A;  5TBN A;  2LRI C;  3SOU A;  1CHC A;  2LGL A;  5TDR A;  5AIT A;  3T7L A;  3N9M A;  1HYJ A;  4YAB A;  5KH3 A;  5LKZ A;  2F6J A;  2KRE A;  3DQV R;  5FB1 A;  2K4D A;  4R7E A;  4I7B A;  3RTR B;  3ASL A;  4N3W A;  4CCG X;  2KWO A;  4I7C A;  5DKA A;  2KWJ A;  3N9N A;  1WEP A;  2QJ0 A; 
#chains in the Genus database with same CATH topology
 3L11 A;  3N9L A;  2RR4 A;  4Q6F A;  3I2D A;  4P5O B;  3SOX A;  2Y1N A;  2RI7 A;  2RSD A;  2LXP C;  2M3H A;  3M7K A;  2ECW A;  3HCU A;  2FSA A;  3KQI A;  3EB5 A;  2DJA A;  1WEW A;  3HTK C;  5D1M B;  2PUY A;  3IHP A;  2CSY A;  5SVX A;  2EGP A;  2XOZ A;  3C5K A;  2KIZ A;  3LRQ A;  4GND A;  5SVI B;  3O36 A;  5TRB A;  3LQI A;  2K1J A;  2CT2 A;  4C9Z A;  3M99 A;  2VNF A;  2E6S A;  3N9P A;  2XP0 A;  4LLB A;  5KH7 A;  2IDA A;  2ECG A;  4IC2 A;  4PPE A;  2YHO A;  4FK5 A;  2VPG A;  1MM2 A;  1T1H A;  4W4U A;  4S3O B;  5H1U A;  4YBT A;  2VJF A;  5J3X A;  2XEU A;  1X4J A;  2L75 A;  5SVY A;  5LKU A;  5D1L B;  1E4U A;  4A49 A;  2F6N A;  5B8D A;  2JMD A;  4QQ4 A;  3T6R A;  2ECT A;  4F1P A;  3PUQ A;  3FEH A;  4LKA A;  3M62 A;  4S3O C;  2VPD A;  5FEY A;  3PUR A;  5FB0 A;  1JM7 A;  4ZUX U;  2EGM A;  2YVR A;  2LDR A;  3N9O A;  3V43 A;  2BAY A;  3T9K A;  4GNE A;  2KGG A;  4A0C D;  2CSZ A;  2MA5 A;  4WZ2 A;  5C11 A;  1LDJ B;  4YBM A;  3Q1D A;  4YBS A;  2YUC A;  4MSX A;  4A4C A;  2LN0 A;  2LQ6 A;  2C2L A;  3O34 A;  2FUI A;  5C13 A;  2LAU A;  2MNY A;  4GNF A;  4F52 B;  2DX8 A;  2OXQ C;  2YT5 A;  3E2D A;  2UZG A;  5B78 A;  2KWN A;  2YQM A;  5K3Q A;  5JG6 A;  5G04 B;  2D8U A;  1DVP A;  4I7D A;  2MUM A;  3O7A A;  1K2F A;  2ECV A;  4GNG A;  2ECJ A;  1WEM A;  3MHH A;  3MHS A;  3KNV A;  4LJN A;  2G6Q A;  2E61 A;  3ZVZ B;  3N9Q A;  3LQJ A;  1U6G B;  2VJF B;  2YU4 A;  4YAX A;  2YRE A;  2M13 A;  4WZ0 A;  2OWA A;  2LV9 A;  2KKY A;  2JRJ A;  1FBV A;  2LGG A;  3C6W A;  1Z60 A;  2YQL A;  2XOC A;  1G25 A;  2ECI A;  1WEE A;  4N4F A;  1WFK A;  3ZVY A;  4FJC A;  4B86 C;  3L1Z B;  4GB0 A;  5H9M A;  4H9D A;  1VFY A;  2LGK A;  1DCQ A;  4CA1 A;  1JM7 B;  2L5U A;  1HYI A;  2YSM A;  2CKL A;  5B76 A;  4PTB A;  3PHD A;  2IQJ A;  3JUE A;  4TKP B;  3U5N A;  1X4U A;  2VPE A;  2MNZ A;  4A4B A;  5AIU A;  1WIL A;  2L7P A;  2YW8 A;  2F42 A;  3FJU B;  3O33 A;  1BOR A;  2AN6 A;  2D8S A;  3NG2 A;  3HCT A;  2FFW A;  2HYE D;  2VP7 A;  3SOW A;  1F62 A;  4L58 A;  4UI9 B;  1V87 A;  4YC9 A;  2NAA A;  3RPG B;  2L80 A;  2PNX A;  3VK6 A;  2KE1 A;  2MD7 B;  2E6R A;  2G45 A;  2M1R A;  3GV4 A;  5B77 A;  5I3L A;  2Y43 A;  4AVX A;  5KH9 A;  1MBM A;  5H1V A;  1RMD A;  1WEV A;  1WEN A;  2JMI A;  5LCW B;  2KGI A;  2KWK A;  2XB1 A;  2VJE A;  4FO9 A;  2MA6 A;  4O62 A;  1MM3 A;  3PLW A;  3L1X A;  2YUR A;  5B79 A;  1VD4 A;  2ZET C;  3SHB A;  5FER A;  1WEU A;  2JMJ A;  3U5O A;  2JM3 A;  3LVR E;  2KU3 A;  2JUN A;  4MVT A;  4AYC B;  3FM8 C;  2K16 A;  2CKL B;  4LK9 A;  1XWH A;  2MIQ A;  2QIZ A;  2H0D A;  3H7H A;  4L7X A;  3EB6 A;  2K17 A;  1VYX A;  3ZTG A;  4QF2 A;  2CRW A;  1Z6U A;  2DSM A;  1X4I A;  4BBQ A;  3QZV A;  1N87 A;  5H1T A;  2ECN A;  3ZYQ A;  2EA6 A;  5EYA F;  3U5P A;  4V3K C;  3DPL R;  4FIP A;  3LJU X;  2M85 A;  5B75 A;  2YYR A;  3M63 A;  3HCS A;  4AUQ B;  3LQH A;  1IYM A;  2VPB A;  3ZPV E;  4O64 A;  1JOC A;  3DDT A;  2C2V S;  4ZDT A;  3O37 A;  4LAD B;  4IC3 A;  3ZNI A;  3FL2 A;  2YHN A;  3SUB A;  2CSV A;  1ZBD B;  2KR4 A;  4WA6 A;  4OGE A;  4AYC A;  2FD4 A;  4ZQL A;  4QF3 A;  4V3L C;  1WIM A;  5TDW A;  4UP5 A;  3KV5 A;  4WZ3 B;  2VJE B;  1WEQ A;  2LGV A;  4X3G A;  3O35 A;  1Z2Q A;  1WEO A;  2G43 A;  5DIN A;  2MKE A;  3LDY A;  1LDK C;  2HDP A;  3FAN A;  3KV6 A;  2MT5 A;  5LKT A;  5D1K B;  4R8P K;  3O70 A;  4YAD A;  1FP0 A;  5G05 B;  2KYU A;  2H0D B;  2M6M A;  2Y1M A;  2CRR A;  2EOD A;  2I50 A;  2KFT A;  4BHW A;  1WES A;  2B0O E;  3O47 A;  4YAT A;  2EXU A;  2CON A;  2L43 A;  3GL6 A;  4Z0R A;  2FUU A;  4R2Y A;  2LXH C;  5TAB A;  1WGM A;  3ZPV 1;  1WE9 A;  5SVI A;  4AP4 A;  2MD8 C;  3RPG C;  3U5M A;  4B7Y C;  2L0B A;  5G0F A;  3LVQ E;  2KKX A;  4XI1 A;  4Z0O A;  3MDB C;  5LKX A;  4UP0 A;  2YSJ A;  4NN2 A;  2QIC A;  3FAO A;  5TBN A;  2LRI C;  2XOY A;  1CHC A;  2LGL A;  3SOU A;  5TDR A;  5AIT A;  3T7L A;  3N9M A;  1HYJ A;  4YAB A;  5KH3 A;  3KDE C;  3DWD A;  2F6J A;  4OGC A;  5LKZ A;  2KRE A;  3DQV R;  5FB1 A;  2K4D A;  4R7E A;  2P57 A;  4I7B A;  3RTR B;  3ASL A;  4N3W A;  4CCG X;  2KWO A;  4I7C A;  5DKA A;  2KWJ A;  3N9N A;  1WEP A;  2QJ0 A; 
#chains in the Genus database with same CATH homology
 3L11 A;  3N9L A;  4Q6F A;  3I2D A;  4P5O B;  3SOX A;  2Y1N A;  2RI7 A;  2RSD A;  2LXP C;  2M3H A;  2ECW A;  3HCU A;  2FSA A;  3KQI A;  3EB5 A;  1WEW A;  3HTK C;  5D1M B;  2PUY A;  3IHP A;  2CSY A;  2EGP A;  3C5K A;  2KIZ A;  3LRQ A;  4GND A;  5TRB A;  3O36 A;  3LQI A;  2K1J A;  2CT2 A;  4C9Z A;  3M99 A;  2VNF A;  2E6S A;  3N9P A;  4LLB A;  5KH7 A;  2IDA A;  2ECG A;  4IC2 A;  4PPE A;  2YHO A;  4FK5 A;  2VPG A;  1MM2 A;  1T1H A;  4W4U A;  4S3O B;  5H1U A;  4YBT A;  2VJF A;  5J3X A;  2XEU A;  1X4J A;  2L75 A;  5LKU A;  5D1L B;  1E4U A;  4A49 A;  2F6N A;  5B8D A;  2JMD A;  3T6R A;  2ECT A;  3PUQ A;  4LKA A;  3M62 A;  4S3O C;  2VPD A;  5FEY A;  3PUR A;  5FB0 A;  1JM7 A;  4ZUX U;  2LDR A;  3N9O A;  3V43 A;  2BAY A;  4GNE A;  2KGG A;  4A0C D;  2CSZ A;  2MA5 A;  4WZ2 A;  5C11 A;  1LDJ B;  4YBM A;  4YBS A;  2YUC A;  4MSX A;  4A4C A;  2LN0 A;  2LQ6 A;  2C2L A;  3O34 A;  2FUI A;  5C13 A;  4GNF A;  2MNY A;  4F52 B;  2DX8 A;  2OXQ C;  2YT5 A;  2UZG A;  5B78 A;  2KWN A;  2YQM A;  5JG6 A;  5G04 B;  1DVP A;  4I7D A;  2MUM A;  3O7A A;  1K2F A;  2ECV A;  4GNG A;  2ECJ A;  1WEM A;  3MHH A;  3MHS A;  3KNV A;  4LJN A;  2G6Q A;  3ZVZ B;  3N9Q A;  3LQJ A;  1U6G B;  2VJF B;  2YU4 A;  4YAX A;  2YRE A;  4WZ0 A;  2LV9 A;  2JRJ A;  1FBV A;  2LGG A;  3C6W A;  1Z60 A;  2YQL A;  1G25 A;  2ECI A;  1WEE A;  4N4F A;  1WFK A;  3ZVY A;  4FJC A;  4B86 C;  3L1Z B;  4GB0 A;  5H9M A;  1VFY A;  2LGK A;  1JM7 B;  4CA1 A;  2L5U A;  1HYI A;  2YSM A;  2CKL A;  5B76 A;  4PTB A;  3PHD A;  4TKP B;  3U5N A;  1X4U A;  2VPE A;  2MNZ A;  4A4B A;  5AIU A;  1WIL A;  2YW8 A;  2F42 A;  3O33 A;  1BOR A;  2AN6 A;  2D8S A;  3NG2 A;  3HCT A;  2HYE D;  2VP7 A;  3SOW A;  1F62 A;  4L58 A;  4UI9 B;  1V87 A;  4YC9 A;  2NAA A;  3RPG B;  2L80 A;  2PNX A;  3VK6 A;  2KE1 A;  2MD7 B;  2E6R A;  2G45 A;  2M1R A;  3GV4 A;  5B77 A;  5I3L A;  2Y43 A;  4AVX A;  5KH9 A;  5H1V A;  1RMD A;  1WEV A;  1WEN A;  2JMI A;  5LCW B;  2KGI A;  2KWK A;  2XB1 A;  2VJE A;  4FO9 A;  2MA6 A;  1MM3 A;  3L1X A;  2YUR A;  5B79 A;  1VD4 A;  2ZET C;  3SHB A;  5FER A;  1WEU A;  2JMJ A;  3U5O A;  2KU3 A;  4MVT A;  4AYC B;  2K16 A;  2CKL B;  4LK9 A;  1XWH A;  2MIQ A;  2QIZ A;  2H0D A;  4L7X A;  3EB6 A;  2K17 A;  1VYX A;  3ZTG A;  4QF2 A;  1Z6U A;  1X4I A;  4BBQ A;  3QZV A;  1N87 A;  5H1T A;  2ECN A;  3ZYQ A;  2EA6 A;  5EYA F;  3U5P A;  4V3K C;  3DPL R;  4FIP A;  2M85 A;  5B75 A;  2YYR A;  3M63 A;  3HCS A;  4AUQ B;  3LQH A;  1IYM A;  2VPB A;  3ZPV E;  4O64 A;  1JOC A;  2C2V S;  4ZDT A;  3O37 A;  4LAD B;  4IC3 A;  3ZNI A;  3FL2 A;  2YHN A;  1ZBD B;  2KR4 A;  4WA6 A;  4AYC A;  4ZQL A;  4QF3 A;  4V3L C;  1WIM A;  5TDW A;  4UP5 A;  3KV5 A;  4WZ3 B;  2VJE B;  1WEQ A;  2LGV A;  4X3G A;  3O35 A;  1Z2Q A;  5DIN A;  2G43 A;  1WEO A;  1LDK C;  2HDP A;  3KV6 A;  2MT5 A;  5LKT A;  5D1K B;  4R8P K;  3O70 A;  4YAD A;  1FP0 A;  5G05 B;  2KYU A;  2H0D B;  2M6M A;  2Y1M A;  2EOD A;  2I50 A;  2KFT A;  4BHW A;  1WES A;  4YAT A;  2L43 A;  3GL6 A;  2FUU A;  4R2Y A;  2LXH C;  5TAB A;  1WGM A;  3ZPV 1;  1WE9 A;  4AP4 A;  2MD8 C;  3RPG C;  3U5M A;  4B7Y C;  2L0B A;  5G0F A;  4XI1 A;  5LKX A;  4UP0 A;  2YSJ A;  4NN2 A;  2QIC A;  5TBN A;  2LRI C;  3SOU A;  1CHC A;  2LGL A;  5TDR A;  5AIT A;  3T7L A;  3N9M A;  1HYJ A;  4YAB A;  5KH3 A;  5LKZ A;  2F6J A;  2KRE A;  3DQV R;  5FB1 A;  2K4D A;  4R7E A;  4I7B A;  3RTR B;  3ASL A;  4N3W A;  4CCG X;  2KWO A;  4I7C A;  5DKA A;  2KWJ A;  3N9N A;  1WEP A;  2QJ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...